BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13989_g1_i1 len=1700 path=[1717:0-433 2151:434-459 3456:460-1699]

Length=1700
                                                                      Score     E

ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              508   4e-172   
gb|EPS66620.1|  hypothetical protein M569_08154                         496   2e-167   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      494   1e-166   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           493   1e-166   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      493   2e-166   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             488   2e-164   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                484   4e-163   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           484   5e-163   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    484   6e-163   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    481   7e-162   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      480   1e-161   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      479   4e-161   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             479   5e-161   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      479   5e-161   
emb|CDP02199.1|  unnamed protein product                                475   7e-161   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              478   9e-161   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             478   1e-160   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                478   2e-160   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    478   2e-160   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         477   3e-160   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      477   3e-160   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    476   4e-160   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      477   5e-160   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  476   9e-160   Ricinus communis
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              476   1e-159   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              476   1e-159   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     474   2e-159   Vitis vinifera
ref|XP_002282500.3|  PREDICTED: pectate lyase                           474   3e-159   Vitis vinifera
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      474   4e-159   Vitis vinifera
ref|XP_010112093.1|  putative pectate lyase 7                           474   5e-159   
emb|CBI22159.3|  unnamed protein product                                474   9e-159   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         473   1e-158   
ref|XP_007032453.1|  Pectate lyase family protein                       473   1e-158   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                473   1e-158   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              473   2e-158   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     473   2e-158   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         472   2e-158   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      472   2e-158   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           472   2e-158   Vitis vinifera
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              471   3e-158   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      472   3e-158   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              471   4e-158   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         471   5e-158   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    471   1e-157   
ref|XP_007046218.1|  Pectate lyase family protein, putative             470   2e-157   
ref|NP_172894.1|  putative pectate lyase 3                              471   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                470   2e-157   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                470   2e-157   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             470   3e-157   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               469   4e-157   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              469   6e-157   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      466   9e-157   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              468   1e-156   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      468   1e-156   
gb|AAB69759.1|  putative pectate lyase                                  468   2e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96854.1|  BnaA08g23970D                                          468   2e-156   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     468   2e-156   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         468   2e-156   
emb|CDY45254.1|  BnaA06g09240D                                          468   2e-156   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    467   2e-156   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    468   2e-156   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    466   5e-156   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                466   7e-156   
emb|CDY68729.1|  BnaCnng60280D                                          466   7e-156   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                465   1e-155   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              465   2e-155   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           465   2e-155   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                465   2e-155   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                464   3e-155   
emb|CDY39314.1|  BnaC05g10650D                                          464   4e-155   
ref|XP_002311599.2|  pectate lyase family protein                       464   4e-155   Populus trichocarpa [western balsam poplar]
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                463   6e-155   
ref|NP_178375.1|  putative pectate lyase 6                              464   6e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             464   7e-155   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             463   1e-154   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                463   1e-154   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         462   1e-154   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      462   2e-154   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    462   2e-154   Solanum lycopersicum
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       462   2e-154   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         462   2e-154   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      462   3e-154   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                462   3e-154   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           460   7e-154   
emb|CDP02198.1|  unnamed protein product                                461   1e-153   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                461   1e-153   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      459   2e-153   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                460   2e-153   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             459   2e-153   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      459   2e-153   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             459   3e-153   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              459   3e-153   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             459   4e-153   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      459   4e-153   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      458   6e-153   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              458   6e-153   
gb|KHN13652.1|  Pectate lyase                                           458   7e-153   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              458   8e-153   
ref|XP_010105747.1|  putative pectate lyase P59                         457   9e-153   
gb|KHN01171.1|  Putative pectate lyase 3                                457   9e-153   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         458   1e-152   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    455   1e-152   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                457   1e-152   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           457   1e-152   
ref|XP_002875142.1|  pectate lyase family protein                       457   2e-152   
emb|CDY09356.1|  BnaA02g26540D                                          457   3e-152   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      456   3e-152   
gb|KEH24975.1|  pectate lyase P59-like protein                          457   4e-152   
ref|NP_197015.4|  putative pectate lyase 19                             457   4e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                457   4e-152   
gb|ABK28696.1|  unknown                                                 457   5e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      455   6e-152   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      456   6e-152   
emb|CDP14850.1|  unnamed protein product                                455   7e-152   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           455   7e-152   
emb|CDY41679.1|  BnaC02g34750D                                          456   9e-152   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               456   1e-151   
gb|KHN08706.1|  Putative pectate lyase 3                                455   1e-151   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           455   2e-151   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              452   2e-151   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             454   3e-151   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      453   3e-151   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             454   4e-151   Populus trichocarpa [western balsam poplar]
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      453   5e-151   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      453   6e-151   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           454   6e-151   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      453   6e-151   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           452   1e-150   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          452   1e-150   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             452   1e-150   Populus trichocarpa [western balsam poplar]
gb|AAA86241.1|  pectate lyase homolog                                   452   1e-150   Medicago sativa [alfalfa]
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              452   2e-150   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      452   2e-150   
emb|CDY53552.1|  BnaA09g57110D                                          454   2e-150   
gb|AES91206.2|  pectate lyase P59-like protein                          452   2e-150   
ref|XP_007037229.1|  Pectate lyase family protein                       451   4e-150   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      448   5e-150   
gb|ACU23277.1|  unknown                                                 451   6e-150   Glycine max [soybeans]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      451   1e-149   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         448   1e-149   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   449   3e-149   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             449   3e-149   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           447   3e-149   
ref|XP_003621115.1|  Pectate lyase                                      449   5e-149   
gb|KHG08055.1|  putative pectate lyase P59                              448   5e-149   
ref|XP_002871648.1|  pectate lyase family protein                       449   9e-149   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           448   9e-149   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             447   1e-148   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      447   2e-148   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              446   3e-148   
emb|CDX81636.1|  BnaC08g39650D                                          447   3e-148   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    447   3e-148   Arabidopsis thaliana [mouse-ear cress]
gb|KHG16093.1|  hypothetical protein F383_07683                         446   4e-148   
gb|KHG05193.1|  hypothetical protein F383_30875                         443   7e-148   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           445   7e-148   
ref|NP_186776.1|  putative pectate lyase 7                              446   8e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      443   8e-148   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          446   1e-147   
ref|XP_003609009.1|  Pectate lyase                                      445   1e-147   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      444   1e-147   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      445   1e-147   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     454   2e-147   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      443   2e-147   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      444   3e-147   
gb|AAM60924.1|  putative pectate lyase                                  444   4e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          443   5e-147   Sorghum bicolor [broomcorn]
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      443   6e-147   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           443   6e-147   Vitis vinifera
emb|CAN69904.1|  hypothetical protein VITISV_001006                     442   8e-147   Vitis vinifera
ref|XP_010925369.1|  PREDICTED: pectate lyase                           442   8e-147   
emb|CDY04133.1|  BnaA09g19110D                                          443   9e-147   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                443   1e-146   
dbj|BAK06965.1|  predicted protein                                      442   1e-146   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                443   1e-146   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    442   2e-146   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                442   3e-146   
gb|KHN13240.1|  Putative pectate lyase 3                                441   4e-146   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      440   5e-146   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                441   6e-146   
ref|XP_003613595.1|  Pectate lyase                                      440   8e-146   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              439   1e-145   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     438   1e-145   Vitis vinifera
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         439   2e-145   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      437   3e-145   
emb|CDY17432.1|  BnaC09g21050D                                          439   3e-145   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      440   4e-145   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      437   4e-145   
gb|KEH19822.1|  pectate lyase-like protein                              439   5e-145   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      438   6e-145   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      437   1e-144   
gb|KHG23093.1|  hypothetical protein F383_29772                         434   2e-144   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               437   3e-144   
emb|CDX70590.1|  BnaC03g06740D                                          437   3e-144   
emb|CDX85564.1|  BnaA02g02490D                                          437   3e-144   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               438   4e-144   
emb|CDP00293.1|  unnamed protein product                                436   4e-144   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             435   6e-144   
ref|NP_001057945.1|  Os06g0583900                                       435   7e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               436   7e-144   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         434   8e-144   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             434   2e-143   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              432   2e-143   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    435   6e-143   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             432   8e-143   Elaeis guineensis
emb|CDX74293.1|  BnaA03g27540D                                          433   8e-143   
emb|CDX91953.1|  BnaC03g32550D                                          433   1e-142   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      430   2e-142   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      431   2e-142   
gb|KHN13490.1|  Putative pectate lyase 3                                428   3e-142   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      432   3e-142   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              430   4e-142   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             430   4e-142   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               431   8e-142   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           430   9e-142   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          429   1e-141   Sorghum bicolor [broomcorn]
gb|KHN08855.1|  Putative pectate lyase P59                              429   1e-141   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      429   2e-141   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      429   2e-141   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           427   3e-141   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      428   3e-141   
ref|NP_001046281.1|  Os02g0214400                                       428   3e-141   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87417.1|  unknown                                                 428   5e-141   Zea mays [maize]
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      427   8e-141   
gb|EAY85003.1|  hypothetical protein OsI_06363                          427   9e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               428   1e-140   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    427   2e-140   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           427   2e-140   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                427   2e-140   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    425   4e-140   Lilium longiflorum [Easter lily]
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          425   5e-140   Sorghum bicolor [broomcorn]
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      425   5e-140   
gb|AFW87059.1|  pectate lyase                                           425   8e-140   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      424   1e-139   
dbj|BAH20311.1|  AT3G01270                                              421   1e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66593.1|  BnaCnng51570D                                          426   1e-139   
ref|NP_001150723.1|  pectate lyase precursor                            424   2e-139   Zea mays [maize]
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      424   2e-139   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               425   3e-139   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    426   3e-139   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    423   3e-139   
gb|AAA16476.1|  pectate lyase homolog                                   423   4e-139   Zea mays [maize]
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             425   4e-139   
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      421   1e-138   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       421   1e-138   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    424   1e-138   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                421   2e-138   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                422   2e-138   
emb|CDY45202.1|  BnaA06g34060D                                          421   4e-138   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             421   7e-138   
ref|XP_010096345.1|  putative pectate lyase 7                           417   1e-137   
emb|CDY03043.1|  BnaC07g21840D                                          419   1e-137   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      419   1e-137   
gb|KHG07401.1|  putative pectate lyase P59                              418   2e-137   
dbj|BAK05605.1|  predicted protein                                      418   3e-137   
gb|AGT16687.1|  pectate lyase                                           418   3e-137   
ref|XP_002882189.1|  pectate lyase family protein                       419   3e-137   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  417   4e-137   Ricinus communis
ref|XP_003613596.1|  Pectate lyase                                      417   1e-136   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                416   2e-136   
emb|CDY28691.1|  BnaCnng05770D                                          415   8e-136   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    412   1e-134   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      411   1e-134   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             411   2e-134   Elaeis guineensis
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               412   3e-134   
emb|CDY63769.1|  BnaCnng42620D                                          412   3e-134   
gb|EPS73633.1|  hypothetical protein M569_01123                         410   5e-134   
gb|EAY99626.1|  hypothetical protein OsI_21605                          409   6e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          409   9e-134   
gb|EPS62426.1|  hypothetical protein M569_12361                         408   1e-133   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          407   5e-133   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             407   5e-133   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             407   5e-133   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           404   6e-132   
ref|NP_001056784.1|  Os06g0144900                                       403   2e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         402   2e-131   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         403   2e-131   
gb|EAY99621.1|  hypothetical protein OsI_21600                          403   3e-131   Oryza sativa Indica Group [Indian rice]
ref|NP_001150425.1|  LOC100284055 precursor                             401   2e-130   Zea mays [maize]
dbj|BAD68402.1|  putative pectate lyase homolog                         400   2e-130   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056781.1|  Os06g0144200                                       400   2e-130   
gb|KHN45481.1|  Putative pectate lyase 3                                396   2e-129   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      398   2e-129   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          399   2e-129   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          396   1e-128   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   395   2e-128   
gb|EMS45831.1|  Pectate lyase                                           398   3e-128   
emb|CDY01151.1|  BnaA04g06680D                                          395   4e-128   
gb|EMT27253.1|  hypothetical protein F775_20306                         390   8e-128   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      390   8e-128   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               393   2e-127   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                392   4e-127   
emb|CDY53564.1|  BnaC04g55760D                                          392   6e-127   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      390   6e-127   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    390   7e-127   
emb|CDY56220.1|  BnaAnng14170D                                          389   1e-126   
emb|CBI33346.3|  unnamed protein product                                390   2e-126   
ref|XP_002870357.1|  pectate lyase family protein                       391   2e-126   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    390   5e-126   
emb|CDY16732.1|  BnaA09g06500D                                          389   5e-126   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    390   6e-126   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    390   6e-126   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                390   6e-126   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                389   6e-126   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               389   7e-126   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    390   7e-126   
dbj|BAB10560.1|  pectate lyase                                          387   9e-126   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             389   1e-125   
gb|AAK66161.1|  pectate lyase                                           385   1e-125   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               387   1e-125   
ref|XP_010102919.1|  hypothetical protein L484_018936                   387   1e-125   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      388   2e-125   
ref|NP_567409.1|  probable pectate lyase 15                             389   2e-125   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     388   2e-125   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                386   2e-125   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                388   2e-125   
ref|NP_001190720.1|  probable pectate lyase 15                          388   2e-125   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                386   2e-125   
ref|NP_568967.1|  putative pectate lyase 22                             387   2e-125   
emb|CDY48132.1|  BnaCnng15740D                                          387   2e-125   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  385   3e-125   
emb|CDY01846.1|  BnaC06g28860D                                          386   3e-125   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     386   4e-125   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          387   4e-125   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     384   4e-125   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               385   5e-125   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               385   5e-125   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     387   6e-125   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             385   6e-125   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               387   6e-125   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   384   7e-125   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                386   8e-125   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          386   8e-125   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     385   9e-125   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                385   9e-125   
gb|KHG08946.1|  Pectate lyase                                           384   1e-124   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                384   2e-124   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    384   2e-124   
gb|ADB90476.1|  pectate lyase                                           384   2e-124   
ref|NP_001056786.1|  Os06g0145100                                       382   2e-124   
emb|CDY41506.1|  BnaA06g22590D                                          384   2e-124   
ref|XP_003608909.1|  Pectate lyase                                      383   3e-124   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                383   3e-124   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                383   4e-124   
gb|KHG22990.1|  hypothetical protein F383_28754                         383   4e-124   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     382   6e-124   
gb|AEN70981.1|  pectate lyase                                           383   6e-124   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     383   6e-124   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               383   6e-124   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          384   6e-124   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          384   7e-124   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          384   7e-124   
gb|KHG22755.1|  hypothetical protein F383_29653                         382   1e-123   
gb|KHG19997.1|  hypothetical protein F383_02891                         382   1e-123   
gb|ADB90475.1|  pectate lyase                                           382   1e-123   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                383   1e-123   
gb|AEN70964.1|  pectate lyase                                           382   1e-123   
gb|AEN70963.1|  pectate lyase                                           382   1e-123   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               382   1e-123   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          382   1e-123   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             382   1e-123   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    380   1e-123   
emb|CDY65626.1|  BnaC03g74840D                                          384   1e-123   
gb|KHG06252.1|  hypothetical protein F383_10745                         382   1e-123   
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                381   2e-123   
ref|XP_002866540.1|  pectate lyase                                      382   2e-123   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             382   2e-123   
emb|CDY18738.1|  BnaC08g08780D                                          384   2e-123   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     383   2e-123   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     381   2e-123   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               382   2e-123   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                382   2e-123   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                382   3e-123   
gb|EEE56553.1|  hypothetical protein OsJ_05879                          381   3e-123   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               381   3e-123   
gb|AFK44189.1|  unknown                                                 381   3e-123   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               381   3e-123   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                381   3e-123   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             382   3e-123   
gb|KHG30349.1|  hypothetical protein F383_15991                         384   3e-123   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               381   3e-123   
emb|CDX92652.1|  BnaC07g39100D                                          380   3e-123   
gb|AEN70984.1|  pectate lyase                                           381   3e-123   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               382   4e-123   
gb|AEN70985.1|  pectate lyase                                           380   4e-123   
ref|NP_564906.1|  putative pectate lyase 5                              380   5e-123   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                382   6e-123   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                382   6e-123   
ref|XP_002887143.1|  pectate lyase family protein                       380   7e-123   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             380   7e-123   
emb|CDY11033.1|  BnaA03g46920D                                          380   8e-123   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               379   1e-122   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                380   1e-122   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                379   1e-122   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         381   1e-122   
gb|ADB90479.1|  pectate lyase                                           379   1e-122   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          381   1e-122   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               379   1e-122   
gb|AEN70977.1|  pectate lyase                                           379   1e-122   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          379   1e-122   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                379   1e-122   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                380   2e-122   
ref|XP_002885608.1|  pectate lyase family protein                       380   2e-122   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                380   2e-122   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    379   2e-122   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                378   2e-122   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                380   2e-122   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          379   2e-122   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     379   3e-122   
gb|KHN34377.1|  Putative pectate lyase 22                               378   3e-122   
ref|XP_002892236.1|  pectate lyase family protein                       379   3e-122   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                379   3e-122   
dbj|BAF43573.1|  pectate lyase                                          379   3e-122   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                379   4e-122   
gb|AAM67091.1|  putative pectate lyase                                  378   4e-122   
gb|AAG28907.1|AC008113_23  F12A21.12                                    377   5e-122   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                378   5e-122   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                379   5e-122   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             379   5e-122   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                379   5e-122   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             379   5e-122   
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             377   6e-122   
ref|NP_563715.1|  putative pectate lyase 1                              378   7e-122   
emb|CDO99404.1|  unnamed protein product                                379   7e-122   
ref|NP_189065.2|  putative pectate lyase 9                              379   7e-122   
gb|AEN70965.1|  pectate lyase                                           377   7e-122   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     379   7e-122   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              379   8e-122   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           379   8e-122   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     379   8e-122   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             377   9e-122   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     379   9e-122   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          377   9e-122   
gb|ADB90478.1|  pectate lyase                                           377   9e-122   
ref|XP_002297822.1|  pectate lyase family protein                       379   9e-122   
gb|ADB90477.1|  pectate lyase                                           377   9e-122   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           379   1e-121   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                378   1e-121   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    377   1e-121   
gb|KEH41255.1|  pectate lyase family protein                            378   1e-121   
dbj|BAI94495.1|  pectate lyase                                          377   1e-121   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                378   1e-121   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               377   1e-121   
ref|NP_187357.1|  putative pectate lyase 8                              377   1e-121   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           378   1e-121   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                377   1e-121   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             380   1e-121   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                377   1e-121   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   378   1e-121   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          378   1e-121   
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               377   1e-121   
gb|AEN70968.1|  pectate lyase                                           377   2e-121   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                378   2e-121   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                377   2e-121   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                376   2e-121   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              379   2e-121   
ref|XP_010106682.1|  hypothetical protein L484_004616                   375   3e-121   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             376   3e-121   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               375   3e-121   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                377   3e-121   
emb|CDY28857.1|  BnaC06g26450D                                          375   3e-121   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     378   3e-121   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                375   3e-121   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          375   4e-121   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                377   4e-121   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         377   4e-121   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                376   4e-121   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          377   4e-121   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           378   4e-121   
emb|CAE02420.2|  OSJNBa0095E20.8                                        377   4e-121   
gb|AAM61584.1|  putative pectate lyase                                  375   4e-121   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           375   4e-121   
gb|EEC76710.1|  hypothetical protein OsI_14719                          377   4e-121   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          377   6e-121   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                375   6e-121   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                375   8e-121   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         375   8e-121   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                374   8e-121   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          375   8e-121   
gb|ACB12931.1|  pectate lyase 1-27                                      376   1e-120   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    375   1e-120   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     374   1e-120   
emb|CDY19932.1|  BnaA09g03190D                                          374   1e-120   
ref|XP_002304700.1|  pectate lyase family protein                       375   1e-120   
gb|EPS68938.1|  hypothetical protein M569_05827                         373   1e-120   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                374   2e-120   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                375   2e-120   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    374   2e-120   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                375   2e-120   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                374   2e-120   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                374   2e-120   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                374   2e-120   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                375   2e-120   
emb|CDY56668.1|  BnaCnng30870D                                          374   2e-120   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          373   2e-120   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               374   2e-120   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               373   3e-120   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     374   3e-120   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             373   3e-120   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             374   3e-120   
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               373   4e-120   



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   508 bits (1308),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 264/461 (57%), Positives = 315/461 (68%), Gaps = 12/461 (3%)
 Frame = -2

Query  1561  GKKIEMFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKH  1382
             G KI M    + + L +FF   A IP       D H  D+YW  R A A    ++A+  +
Sbjct  14    GLKI-MEKNFSITFLFLFFISAAFIPTSGANYTDSH--DVYWQERAALARARILQAYNPN  70

Query  1381  PEHVTRNITAEV-HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDK  1205
             PE +  +   +   ++ H  +    +R   NGTRR+L G+K+ GPC A NPIDRCWRC+ 
Sbjct  71    PEAIVTDFNQKTKEALEHSQV----NRAPHNGTRRNL-GRKYMGPCVATNPIDRCWRCNP  125

Query  1204  DWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWII  1025
             +W  NR+++ADCA GFGA  TGGK GP YVV D SDN+M  PKPGTLRHAVIQ GPLWII
Sbjct  126   NWALNRQKLADCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWII  185

Query  1024  FSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGG  845
             FS SM I L  EL++TSDKTIDGRGA ++I GGAG T+QFV N+IITNLKI  I  + GG
Sbjct  186   FSHSMNIKLNQELIMTSDKTIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGG  245

Query  844   IIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFT  665
              IRDS  H G RT  +GD I IFGS N+WIDHLSMS   DG+IDAV GSTA+TISNCHF 
Sbjct  246   TIRDSVNHFGFRTGSDGDAINIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFV  305

Query  664   DHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAV  485
              H KVLLFG  + D ID  MQIT+AFNHFGK L QRMPRCR G FH++NNDYTHW MYA+
Sbjct  306   RHDKVLLFGGRDMDEIDSKMQITLAFNHFGKHLVQRMPRCRRGFFHLVNNDYTHWLMYAI  365

Query  484   GGSAGSTIISQGNRYIAPPGPSYFKEITHR--DWPNDEWKGWTWVSDRDEFVNDAFFTPS  311
             GGS  +TIISQGNRYIAPP P   +++THR  D P  EW+ WTWV+D D F+N A+F PS
Sbjct  366   GGSHHATIISQGNRYIAPPLPDK-RQVTHREADSPESEWRKWTWVTDHDVFLNGAYFVPS  424

Query  310   GDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             GDP GA  Y  L+ + P P      +TRFAGAL C    PC
Sbjct  425   GDPNGAATYLALEKIRPAPGEQVYDLTRFAGALKCVVSLPC  465



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 255/451 (57%), Positives = 308/451 (68%), Gaps = 9/451 (2%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGEL-----GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAE  1349
             +FFA    + A++  L       I   D +W  R+AEA +  + ++  +P  +  ++   
Sbjct  1     LFFALALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLH  60

Query  1348  VHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADC  1169
              H + HE  A +    V N TRR LRG+++ GPC   NPIDRCWRC  DW  NR R+ADC
Sbjct  61    SHRLLHELNATDHFHLVGNHTRRSLRGRRYNGPCTVTNPIDRCWRCRSDWATNRFRLADC  120

Query  1168  ALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHE  989
              LGFG    GGK+GP YVVTDSSDN+M  PKPGTLRHAVIQ GPLWI+F+ SM I L  E
Sbjct  121   GLGFGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQE  180

Query  988   LLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLR  809
             LLVTSDKTIDGRGA V +  GAG T+QFV NVII  L I  I   SGG+IRDS  H G R
Sbjct  181   LLVTSDKTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFR  240

Query  808   TFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANN  629
             T  +GDGI+IFGS ++WIDH+SM RC DG+IDA+ GST +TISN HFTDH++V+LFGA++
Sbjct  241   TRSDGDGISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASD  300

Query  628   WDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQG  449
                 D  MQ+TVAFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS+  TIISQG
Sbjct  301   GYSPDAKMQMTVAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQG  360

Query  448   NRYIAPPGP--SYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-G  281
             NRYIAPP     Y KE+T RD+ P   W+ WTW SD D F+  A+FT SGDP    K+  
Sbjct  361   NRYIAPPDDVNMYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYMSKHPE  420

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             R DL+     S+   ITRFAGAL CK G PC
Sbjct  421   RYDLMQAADGSNVAAITRFAGALLCKVGAPC  451



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   494 bits (1271),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/458 (55%), Positives = 318/458 (69%), Gaps = 9/458 (2%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGD----IHSSDLYWVNRKAEAMDYAMKAFTKHP  1379
             M +K+N  L++   +F  ++P++  E  +    I + D  W  R  +A   A+KA+  +P
Sbjct  6     MASKLN--LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNP  63

Query  1378  EHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDW  1199
             E VT +    V     E    EDD+   N TRR+LRGK +KGPCKA NPIDRCWRC  +W
Sbjct  64    EQVTEDFNESVEQTVVEE-DLEDDQSAGNSTRRNLRGKXYKGPCKATNPIDRCWRCRANW  122

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
               NRK++A C  GFG  T GGK G YY+VTDSSD+ + +PKPGTLRHAVIQ  PLWIIF+
Sbjct  123   ANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFA  182

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              SM I L  EL+VTS KTID RGA V I  GAG T+QFV+NVII  L+I      SGG+I
Sbjct  183   RSMVIRLSQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMI  242

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS +H G+RT  +GDGI+I+GSSN+W+DHLSM  C DG+IDA++GSTA+TISNCHFT H
Sbjct  243   RDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHH  302

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
             + V+LFGA++    D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GG
Sbjct  303   NDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGG  362

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDP  302
             S+  TIISQGNR+IAPP  +  KE+T RD+ P   WK W W S+ D  +N AFF  SG P
Sbjct  363   SSHPTIISQGNRFIAPPNQAA-KEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVP  421

Query  301   QGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                  +G+LD++   P +   ++TRFAG+L+CK GK C
Sbjct  422   NKKHGFGKLDMIKAKPGTFVRRLTRFAGSLNCKVGKKC  459



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   493 bits (1269),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 317/448 (71%), Gaps = 21/448 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
               + F +F  ++P++     +I   D YW  R  EA   A+KA+  HPE VT    A+V 
Sbjct  7     FFLFFSSFAVLVPSLQA---NIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKV-  62

Query  1342  SMRHETMAFEDDREVV--NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADC  1169
                        D+ V   N TRR L  KK+KGPC A NPIDRCWRC+++W +NRKR+A+C
Sbjct  63    -----------DKAVRGNNSTRRQL--KKYKGPCLATNPIDRCWRCNRNWARNRKRLANC  109

Query  1168  ALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHE  989
              LGFG  T GGK G +YVVTDSSDN+M  PKPGTLRHAV+Q GPLWIIF+ SM I L  E
Sbjct  110   VLGFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQE  169

Query  988   LLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLR  809
             L++TSDKTID RGA V I  GAG T+QF++NVII  L I  I   SGG+IRD+  H GLR
Sbjct  170   LIMTSDKTIDARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLR  229

Query  808   TFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANN  629
             T  +GDGI+IFGSS++WIDH+SMS C DG+IDA++GSTA+TISNCHFT H++V+LFGA++
Sbjct  230   TASDGDGISIFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASD  289

Query  628   WDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQG  449
                 D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQG
Sbjct  290   GYSQDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQG  349

Query  448   NRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLD  272
             NR+IAPP  +  KE+T RD+   D+WK W W S+ D  +N AFF  SG+P+    + R D
Sbjct  350   NRFIAPPNIAA-KEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPFSRRD  408

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
             ++   P ++  ++TRFAG L C+ G+PC
Sbjct  409   VIKAKPGTYVRRLTRFAGKLGCRVGRPC  436



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   493 bits (1269),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 317/458 (69%), Gaps = 9/458 (2%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGD----IHSSDLYWVNRKAEAMDYAMKAFTKHP  1379
             M +K+N  L++   +F  ++P++  E  +    I + D  W  R  +A   A+KA+  +P
Sbjct  1     MASKLN--LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNP  58

Query  1378  EHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDW  1199
             E VT +    V     E    EDD+   N TRRHLRGK  KGPCKA NPIDRCWRC  +W
Sbjct  59    EQVTEDFNESVEQTVVEE-DLEDDQSAGNSTRRHLRGKHNKGPCKATNPIDRCWRCRANW  117

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
               NRK++A C  GFG  T GGK G YY+VTDSSD+ + +PKPGTLRHAVIQ  PLWIIF+
Sbjct  118   ANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFA  177

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              SM I L  EL+VTS KTID RGA V I  GAG T+QFV+NVII  L+I      SGG+I
Sbjct  178   RSMVIRLSQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMI  237

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS +H G+RT  +GDGI+I+GSSN+W+DHLSM  C DG+IDA++GSTA+TISNCHFT H
Sbjct  238   RDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTRH  297

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
             + V+LFGA++    D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GG
Sbjct  298   NDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGG  357

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDP  302
             S+  TIISQGNR+IAPP  +  KE+T RD+ P   WK W W S+ D  +N AFF  SG P
Sbjct  358   SSHPTIISQGNRFIAPPNQAA-KEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVP  416

Query  301   QGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                  +G+LD++   P +   ++TRFAG+L+CK GK C
Sbjct  417   NRKHGFGKLDMIKAKPGTFVTRLTRFAGSLNCKVGKKC  454



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   488 bits (1255),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 300/423 (71%), Gaps = 16/423 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D+YW  R  EA   AM++F   PE VT    + V  +  +           NGTRRHLRG
Sbjct  37    DIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMKQ----------NGTRRHLRG  86

Query  1267  -KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
              KK+ GPC A NP+D CWRCDK+W KNRKR+ADC  GFG  TTGGK GP YVVTD SD +
Sbjct  87    NKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTDPSDLD  146

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             +  PKPGTLRHAVIQ GPLWIIF+ +M I LQ ELLVTSDKTIDGRGA V I  GAG T+
Sbjct  147   LVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHNGAGITL  206

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFVKNVIITNL IK+I    GG+IRDS  H G RT  +GDGI+IFGSSNVWIDH+SM  C
Sbjct  207   QFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDHVSMENC  266

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+IDA+ GSTA+TISN HFT H+ V+LFGA+N    DK+MQITVAFNHFG+ L QRMP
Sbjct  267   ADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMP  326

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EW  374
             RCR G FH++NNDYTHW MYA+GGS   TIISQGNR+IAPP     KE+T RD   + EW
Sbjct  327   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGA-KEVTKRDHTAEAEW  385

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-GRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             K W W S+ D  +N A F  SG   G  K+  ++DL+   P ++  K+T+F+GAL C  G
Sbjct  386   KNWEWRSEGDLMMNGAVFVQSG--SGKSKHPAKMDLMPFKPGTYVAKLTKFSGALDCFVG  443

Query  196   KPC  188
             KPC
Sbjct  444   KPC  446



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   484 bits (1247),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 299/422 (71%), Gaps = 14/422 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R  EA   AM++F   PE VT    + V  +  +          +NGTRR+LRG
Sbjct  34    DAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMK----------LNGTRRNLRG  83

Query  1267  -KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
              KK+ GPC A NPID CWRCDK+W KNRKR+A+C  GFG  TTGGK GP YVVTD SD +
Sbjct  84    VKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTDPSDLD  143

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             +  PKPGTLRHAVIQ GPLWIIF+ SM I LQ EL+VTSDKTIDGRGA V I  GAG T+
Sbjct  144   LVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHDGAGITL  203

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFVKNVIITNL IKRI    GG+IRDS  H G RT  +GDGI+IFGSSNVWIDH+SM  C
Sbjct  204   QFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDHVSMENC  263

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+IDA+ GSTA+TISN HFT H+ V+LFGA+N    DK+MQITVAFNHFG+ L QRMP
Sbjct  264   ADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMP  323

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRD-WPNDEW  374
             RCR G FH++NNDYTHW MYA+GGS   TIISQGNR+IAPP     KE+T RD  P  EW
Sbjct  324   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGA-KEVTKRDHTPEAEW  382

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K W W S+ D  +N A F  SG  + +    ++DL+   P ++  ++T+FAGAL C  GK
Sbjct  383   KKWEWRSEGDLMMNGAIFVQSGSGK-SNHPAKMDLMPFKPGTYVAELTKFAGALDCFVGK  441

Query  193   PC  188
             PC
Sbjct  442   PC  443



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   484 bits (1247),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 313/449 (70%), Gaps = 7/449 (2%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGD---IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             L++   +F  ++P++   + +   +   D  W  R+ +A   A+KA+ ++PE VT +   
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNE  66

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              V  +  + + FEDD +V N T RHL GKK+KGPCKA NPIDRCWRC KDW  +RK++A+
Sbjct  67    SVQEV--DDLNFEDDDQVSNITGRHLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLAN  124

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             C  GFG  T GGK G +YVVTD SD+ + EPKPGTLRHAVIQ  PLWIIF+ SMTI L  
Sbjct  125   CVKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMTIRLTQ  184

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL++TS KTID RGA V I  GAG T+QFV+NVII  L I  I   SGG IRDS  H G 
Sbjct  185   ELIMTSHKTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGT  244

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGI+IFGSS+VW+DHLSM  C DG+ID ++GSTAVTISNCHFT H+ VLLFGA+
Sbjct  245   RTQSDGDGISIFGSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGAS  304

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS+  TIISQ
Sbjct  305   DSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQ  364

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAPP  +  KE+T RD+ P   WK W W S+ D  +N AFF  SG  +    +G+L
Sbjct  365   GNRFIAPPNQAA-KEVTKRDYAPMGVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGFGKL  423

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P +   ++TRFAG L C+ G+ C
Sbjct  424   DMMTAKPGTFVSRLTRFAGTLGCRVGQKC  452



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   484 bits (1245),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 318/452 (70%), Gaps = 14/452 (3%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ +S   +F  F  +IP +   +GD    D  W  R  EA +YA + +  +PE+VT   
Sbjct  5     KLMYSFFFLFIIFATIIPCLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               +V  M+  T++        N TRR L  KK+KGPC   NPIDRCWRCD +W  NRKR+
Sbjct  62    NQKVRDMKEVTVS-------NNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRL  114

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA+GFG+  TGGKDG  Y+VTD+SD +  EPKPGTLR+AVIQ  PLWIIF  SMTI L
Sbjct  115   ADCAMGFGSKATGGKDGEIYIVTDNSD-DYAEPKPGTLRYAVIQKEPLWIIFERSMTIRL  173

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               EL++ SDKTID RGA V I  GAG T+Q++KNVII  L I  I   SGG++RD+  H 
Sbjct  174   HQELIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHI  233

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDGI+IFG+SN+WIDH+SM +C DGIIDAV+GSTA+TISN HFTDH++V+LFG
Sbjct  234   GIRTVSDGDGISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFG  293

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  294   ASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTII  353

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             +QGNR+IAPP   + K++T R++ P + WK WTW S+ + F+N A+F  SGDP  + K+ 
Sbjct  354   TQGNRFIAPP-DIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHK  412

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +   P+     ITRFAGAL CK GK C
Sbjct  413   ELYDGISAAPAEEVTWITRFAGALGCKKGKAC  444



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   481 bits (1238),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 252/453 (56%), Positives = 319/453 (70%), Gaps = 15/453 (3%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ +S   +F  F  +IP +   +GD    D  W  R  EA +YA + +  +PE+VT   
Sbjct  5     KLMYSFFFLFIIFATIIPCLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  1357  TAEVH-SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
               +V  SM+  T++        N TRR L  KK+KGPC   NPIDRCWRCD +W  NRKR
Sbjct  62    NQKVRDSMKEVTVS-------NNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKR  114

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             +ADCA+GFG+  TGGKDG  Y+VTD+SD +  EPKPGTLR+AVIQ  PLWIIF  SMTI 
Sbjct  115   LADCAMGFGSKATGGKDGEIYIVTDNSD-DYAEPKPGTLRYAVIQKEPLWIIFERSMTIR  173

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATH  821
             L  EL++ SDKTID RGA V I  GAG T+Q++KNVII  L I  I   SGG++RD+  H
Sbjct  174   LHQELIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDH  233

Query  820   KGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLF  641
              G+RT  +GDGI+IFG+SN+WIDH+SM +C DGIIDAV+GSTA+TISN HFTDH++V+LF
Sbjct  234   IGIRTVSDGDGISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLF  293

Query  640   GANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTI  461
             GA++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TI
Sbjct  294   GASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTI  353

Query  460   ISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY  284
             I+QGNR+IAPP   + K++T R++ P + WK WTW S+ + F+N A+F  SGDP  + K+
Sbjct  354   ITQGNRFIAPP-DIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKH  412

Query  283   GRL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               L D +   P+     ITRFAGAL CK GK C
Sbjct  413   KELYDGISAAPAEEVTWITRFAGALGCKKGKAC  445



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 305/445 (69%), Gaps = 16/445 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
              ++  +   ++P++   + +    D YW  R  EA   A++AF   PE+VT    A V+ 
Sbjct  6     FILALSLAVLVPSLEAHIKEF---DEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNK  62

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
             +              N TRR L   K+ GPC A NPIDRCWRC K+W K+RKR+A C LG
Sbjct  63    VLDGN----------NSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLG  112

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGG  G YYVV D SDN++  PKPGTLRHAVIQ  PLWIIF+ SM I L  EL+V
Sbjct  113   FGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMV  172

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
              S KTIDGRGA V I  GAG T+QFV+NVII N++I  I    GGIIRD+  H G+RT  
Sbjct  173   ASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMS  232

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+IFGS+N+WIDH+SM RC+DG+IDA++GSTA+TISN H+T H+ V+LFGA++  P
Sbjct  233   DGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYP  292

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              DK+MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TIISQGNR+
Sbjct  293   RDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRF  352

Query  439   IAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP  +  KE+T RD+   D W+ WTW S  D  +N AFF  SG P    KYGR D++ 
Sbjct  353   IAPPNLAA-KEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQPLKK-KYGRKDMIK  410

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRF+G L+CK  K C
Sbjct  411   AKPGTFVRRLTRFSGTLNCKPKKRC  435



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   479 bits (1232),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 245/425 (58%), Positives = 303/425 (71%), Gaps = 20/425 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVV--NGTRRHL  1274
             D YW  R  EA   A  AF  +PE VT N+ A V             R +V  N TRR L
Sbjct  25    DEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAV------------SRAMVGRNSTRRSL  72

Query  1273  RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
               KK++GPC A NPIDRCWRCD++W KNRK++A+C LGFG  T GGK GP YVVTD+SD+
Sbjct  73    --KKYRGPCLATNPIDRCWRCDRNWAKNRKKLAECPLGFGHQTIGGKRGPIYVVTDASDD  130

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             ++  PKPGTLR+ VIQ GPLWIIF  SM I L  EL+++SDKTID RGA V I  GAG T
Sbjct  131   DLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRLSQELMISSDKTIDARGANVHIAFGAGLT  190

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +QFV NVII NL I  I + SGG+IRDS  H G RT  +GDGI+IFGSS+VWIDH+SMS 
Sbjct  191   IQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSN  250

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             CEDG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D++MQ+T+AFNHFG+ L QRM
Sbjct  251   CEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQRM  310

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP-NDE  377
             PRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+IAPP P+  K++T R++   DE
Sbjct  311   PRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNA-KQVTKREYAMEDE  369

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG--RLDLLDPMPSSHAGKITRFAGALSCK  203
             WK W+W S+ DE +N A F PSGD     K G  R D++   P ++  ++ RF+G L C 
Sbjct  370   WKHWSWRSEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGTYVRRLARFSGTLECT  429

Query  202   YGKPC  188
              GKPC
Sbjct  430   PGKPC  434



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   479 bits (1233),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 313/449 (70%), Gaps = 7/449 (2%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGD---IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             L++   +F  ++P++   + +   +   D  W  R+ +A   A+KA+  +PE VT +   
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNE  66

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              V     + + FEDD +V N T RHL GKK+KGPCKA NPIDRCWRC KDW  +RK++A+
Sbjct  67    SVQEF--DDLNFEDDDQVSNITGRHLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLAN  124

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             C  GFG  T GGK G +YVVTD SD+ + +PKPGTLRHAVIQ  PLWIIF+ SMTI L  
Sbjct  125   CVKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMTIRLTQ  184

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL++TS KTID RGA V+I  GAG T+QFV+NVII  L I  I   SGG IRDS  H G 
Sbjct  185   ELILTSHKTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGT  244

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGI+IFGSS++W+DHLSM  C DG+ID ++GSTA+TISNCHFT H+ VLLFGA+
Sbjct  245   RTQSDGDGISIFGSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGAS  304

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS+  TIISQ
Sbjct  305   DSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQ  364

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAPP  +  KE+T RD+ P D WK W W S+ D  +N AFF  SG  +    +G+L
Sbjct  365   GNRFIAPPNHAA-KEVTKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGFGKL  423

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P +   ++TRFAG L C+ G+ C
Sbjct  424   DMMTAKPGTFVTRLTRFAGTLGCRVGQKC  452



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   479 bits (1232),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 245/445 (55%), Positives = 306/445 (69%), Gaps = 19/445 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L++ F F  + P +   + D    D  W  R  EA   + +A+  HPE  T N   +VH 
Sbjct  13    LLMIFGFVMIFPTLKANIADF---DEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                         +  N TRRHLR  K+ GPC A NPIDRCWRCD++W +NRK++ADCALG
Sbjct  70    ----------SLDGGNNTRRHLR--KYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGGKDG  YVV DSSDN++  PKPGTLRHAVIQ+ PLWIIF+  M I L  EL+V
Sbjct  118   FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             T DKT+DGRGA V I  G   T+QFVKN+II NL I  IKA +GG+IRDS +H G RT  
Sbjct  178   TDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRS  237

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI++FG+S VWIDH+SMS C+DG+IDAV  STA+TISNCHFT H+ V+L GA+N   
Sbjct  238   DGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYS  297

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D++MQ+T+AFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGNR+
Sbjct  298   NDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRF  357

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP P+  KE+T R + P  EW+ W W S+ D  +N AFF  SG+P    +Y + D++ 
Sbjct  358   IAPPNPNC-KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSKKDVIH  414

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRFAG L CK  +PC
Sbjct  415   SKPGTFVTRLTRFAGPLKCKKNQPC  439



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   475 bits (1223),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 274/352 (78%), Gaps = 0/352 (0%)
 Frame = -2

Query  1243  ALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTL  1064
             A N ID+CWRCD +W  NR+R+ADCA GFG    GG+ GP YVVTD SD+ + EP+PGTL
Sbjct  2     ATNVIDKCWRCDPNWANNRQRLADCAQGFGRAAKGGQGGPIYVVTDPSDDNVAEPRPGTL  61

Query  1063  RHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIIT  884
             RHAVIQ GPLWIIF+ SMTITL  EL++ S KTIDGRG  V I  GAGFT+QFV+N+II 
Sbjct  62    RHAVIQKGPLWIIFARSMTITLSQELIMQSHKTIDGRGVNVHIAYGAGFTIQFVRNIIIH  121

Query  883   NLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVK  704
             N+ I  +K TSGG+IRDS  H GLRT +EGDGI+IFG+ +VW+DHLSMS+C DG+IDAV+
Sbjct  122   NVHIHDVKTTSGGMIRDSVDHVGLRTANEGDGISIFGARDVWLDHLSMSKCSDGLIDAVQ  181

Query  703   GSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHI  524
              STA+TISNCHFTDH KVLLFGA++   +DK MQ+TVAFNHFGKRL QRMPRCR G FH+
Sbjct  182   ASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQVTVAFNHFGKRLVQRMPRCRSGFFHL  241

Query  523   INNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRD  344
             +NNDYTHWEMYA+GGS  +TIISQGNR+IAPP   +FKE+THRD P   W  WTWVSD D
Sbjct  242   VNNDYTHWEMYAIGGSHDATIISQGNRFIAPPLSQFFKEVTHRDAPVALWSKWTWVSDGD  301

Query  343   EFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              F+N A F PSG+P GA ++  L+L+   P +    +TRF+G LSC  G+ C
Sbjct  302   VFLNGARFVPSGNPDGARQFAALELIKAAPGTEVFTLTRFSGFLSCVIGRAC  353



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   478 bits (1231),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 248/451 (55%), Positives = 313/451 (69%), Gaps = 9/451 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+NW LL+ F AF +++P +     DI   D  W  R AEA +  ++A+   P  V  + 
Sbjct  5     KLNW-LLISFLAFASILPLLRA---DIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHF  60

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
                V+    E+    DD  ++N TRRHL GK +KGPCK  NPID CWRC+  W  NR R+
Sbjct  61    NKHVNKHVEESGGL-DDVMMLNTTRRHL-GKAYKGPCKVTNPIDACWRCNPKWHLNRFRL  118

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADC +GFG+  TGGK G  Y+VTD SD+++  PKPGTLRHAVIQ+ PLWI F  +M I L
Sbjct  119   ADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNMVIKL  178

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             + EL+VTSDKTIDGRGA V+I  GAG T+QFVKNVII NLKI  I    GG+IRDSA+H 
Sbjct  179   KQELMVTSDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHT  238

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI+IFGS ++WIDH+SM+RC DG+ID ++GST +TISN HFTDH   +LFG
Sbjct  239   GLRTQSDGDGISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFG  298

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
              N+  P D+ MQITVAFNHFGKR+ QRMPRCR+G FH++NNDYTHW+MYA+GGS+  TII
Sbjct  299   GNDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTII  358

Query  457   SQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-G  281
             SQGNRYIA     Y K++T R+ P  EWK WTWV+D D F+  A+F PSGD     K+  
Sbjct  359   SQGNRYIAD--HPYAKQVTKRECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPSKHPE  416

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + D + P  +    ++T+FAG L CK    C
Sbjct  417   KSDNIKPASAKLVSQMTKFAGRLGCKLKYAC  447



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   478 bits (1230),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 247/422 (59%), Positives = 299/422 (71%), Gaps = 14/422 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R  +A +Y M+++  +P+ VT    AEV  +              N TRR+L+G
Sbjct  34    DEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIMGK----------NETRRNLKG  83

Query  1267  -KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
              KK+ GPCK  NPID CWRCD +W  NR ++ DC  GFG  TTGGK GP YVVTD SD +
Sbjct  84    QKKYVGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGD  143

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             +  P+PGTLRHAVIQ GPLWI F+ +M I LQ EL+V SDKTIDGRGA V I  GAG T+
Sbjct  144   LVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDGAGITI  203

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFVKNVIITNL IK+IKA  GGIIRDS  H G RT  +GDGI+IFGSSN+WIDH+SM  C
Sbjct  204   QFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSSNIWIDHVSMENC  263

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+IDA+ GST +TISNCHFT H++VLLFGA+N    DK+MQITVAFNHFGK L QRMP
Sbjct  264   TDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQITVAFNHFGKGLVQRMP  323

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EW  374
             RCR G FH++NNDYTHW MYA+GGS   TIISQGNR+IA    S  KE+T R++  + EW
Sbjct  324   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLN-SATKEVTKREYTAEAEW  382

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K W W S+ D F+N AFF  SG P   ++  +LD++   P ++  K+T+FAGAL C  GK
Sbjct  383   KNWLWKSEGDLFMNGAFFVESGSP-ANLRADKLDMIPFKPGTYVTKMTKFAGALDCFVGK  441

Query  193   PC  188
             PC
Sbjct  442   PC  443



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   478 bits (1230),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 251/434 (58%), Positives = 307/434 (71%), Gaps = 16/434 (4%)
 Frame = -2

Query  1480  VAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDRE  1301
             VA E   +   D YW  R  EA+  AM+++ K+PE        E H+   E ++ E    
Sbjct  32    VANEDTMVLDLDAYWKERAQEALKEAMESYHKNPEQAAE----EFHTGVAELLSKE----  83

Query  1300  VVNGTRRHLRGKK-FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
               N TRR+LRG K + GPC A NPID CWRCD +W  NRK++  CA GFG   TGGKDGP
Sbjct  84    --NTTRRNLRGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGP  141

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVT  +DN+++ PKPGTLRHAVIQ GPLWIIF+ SM I L+ EL+VTSDKTIDGRGA 
Sbjct  142   IYVVTVGTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGAN  201

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  G G T+QFVKNVIITNL IK I +  GG+IRDS  H GLRT  +GDGI++FG+SN
Sbjct  202   VVIEEGGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASN  261

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFN  584
             VWIDH+SMSRC DG+IDAV  STA+TISN HFTDH  V+LFGANN    DK+MQIT+AFN
Sbjct  262   VWIDHVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFN  321

Query  583   HFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEI  404
             HFG+ L QRMPR R G FH++NNDYTHW MYA+GG+   TIISQGNR+IAP   +  K++
Sbjct  322   HFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAAT-KQV  380

Query  403   THRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-GRLDLLDPMPSSHAGKIT  230
             THR+  P  EWK W W S+ D  +N AFF  SG   GA ++  +LD++   P + A K+T
Sbjct  381   THREHTPESEWKNWEWRSEGDLMMNGAFFVESG--SGASQHPAKLDMMPFQPGTFATKLT  438

Query  229   RFAGALSCKYGKPC  188
             +F+GAL+C  GKPC
Sbjct  439   KFSGALNCVVGKPC  452



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   478 bits (1229),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/433 (57%), Positives = 303/433 (70%), Gaps = 14/433 (3%)
 Frame = -2

Query  1480  VAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDRE  1301
             VA E   +   D YW  R  EA+  AM+++ K+PE VT      V  +  +         
Sbjct  32    VANEDSTVLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELLSKE--------  83

Query  1300  VVNGTRRHLRGKK-FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
               N TRR+LRG K + GPC A NPID CWRCD +W  NRK++  CA GFG   TGGKDGP
Sbjct  84    --NTTRRNLRGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGP  141

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVT  +D++++ PKPGTLRHAVIQ GPLWIIF+ SM I LQ EL+VTSDKTIDGRGA 
Sbjct  142   IYVVTVGTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGAN  201

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  G G T+QFVKNVI+TNL IK I + +GG+IRDS  H GLRT  +GDGI++FG+SN
Sbjct  202   VVIEEGGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASN  261

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFN  584
             VWIDH+SMSRC DG+IDAV  STA+TISN HFTDH  V+LFGANN    DK+MQIT+AFN
Sbjct  262   VWIDHMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFN  321

Query  583   HFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEI  404
             HFG+ L QRMPR R G FH++NNDY HW MYA+GG+   TIISQGNR+IAP   +  K++
Sbjct  322   HFGRGLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEAT-KQV  380

Query  403   THRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITR  227
             THR+  P  EWK W W S+ D  +N AFF  SG  + +    +LD++   P + A K+T+
Sbjct  381   THREHTPESEWKNWEWRSEGDLMMNGAFFVESGS-RASQNPAKLDMMPFQPGTFATKLTK  439

Query  226   FAGALSCKYGKPC  188
             F+GALSC  GKPC
Sbjct  440   FSGALSCVVGKPC  452



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   477 bits (1227),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 306/428 (71%), Gaps = 14/428 (3%)
 Frame = -2

Query  1468  LGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNG  1289
               DI   D YW  R A A   A  A+   PE V  ++ AE+    H +          N 
Sbjct  18    FADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEI---AHASSG-------RNS  67

Query  1288  TRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVT  1109
             TRR+L  KK+ GPC A NPIDRCWRCD +W +NRK++ADC LGFG  TTGGK GPYYVV 
Sbjct  68    TRRNL--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVN  125

Query  1108  DSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVG  929
             DSSD+++  PKPGTLRHAVIQ GPLWIIFS +M I L  EL++TSDKTID RGA V+I  
Sbjct  126   DSSDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIAY  185

Query  928   GAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDH  749
             GAG T+Q+++NVII  L+I  I   SGG+IRD+  H GLRT  +GDGI+IFGSSNVWIDH
Sbjct  186   GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  748   LSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKR  569
             +SMS C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D++MQITVAFNHFG+ 
Sbjct  246   VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQG  305

Query  568   LEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW  389
             L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+IAPP   Y KE+T R++
Sbjct  306   LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPN-VYAKEVTKREY  364

Query  388   -PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
              P   WK WTW S+ D  +N AFF  SGD      + R+D++   P ++  ++TRFAG+L
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRMDMISYKPGTYVKRMTRFAGSL  424

Query  211   SCKYGKPC  188
             +C  G+PC
Sbjct  425   ACFVGRPC  432



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   477 bits (1227),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 302/447 (68%), Gaps = 15/447 (3%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             SL ++ F    + P +   + +    D  W  R  EA   AM A+  +P+ V  ++   V
Sbjct  9     SLFLLAFNLAVITPTLRAHIAEF---DEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNV  65

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             H    E+          NGTRR L+ K + GPC A NPIDRCWRC K+W +NRK++ADC 
Sbjct  66    HLAMQES----------NGTRRSLKTKPYGGPCLATNPIDRCWRCQKNWSRNRKKLADCV  115

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             +GFG  T GGK G +YVVTD SDN+M  PKPGTLRHAVIQ  PLWIIF+  M I L  EL
Sbjct  116   VGFGRKTIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIRLNQEL  175

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             L+  DKTID RGA V +  GAG T+QFVKNVII  L +  I   SGG+IRDS  H GLRT
Sbjct  176   LMAGDKTIDARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRT  235

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI++FG++NVWIDH+SMS C+DG+IDA+  +TAVT+SNCHFT H++V+LFGA+  
Sbjct  236   QSDGDGISLFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGS  295

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D VMQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGN
Sbjct  296   YSGDAVMQITVAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGN  355

Query  445   RYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL  269
             R+IAPP  +  KE+T RD+ P  EWK WTW S+ D  +N AFF  SG+P     + + D+
Sbjct  356   RFIAPPTLAA-KEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGNPSRKHPFSKKDM  414

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             +   P ++   +TRF+GAL CK  KPC
Sbjct  415   IPAKPGTYVSTLTRFSGALGCKINKPC  441



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   476 bits (1225),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 306/428 (71%), Gaps = 14/428 (3%)
 Frame = -2

Query  1468  LGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNG  1289
               DI   D YW  R A A   A  A+   PE V  ++ AE+    H +          N 
Sbjct  18    FADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEI---AHASSG-------RNS  67

Query  1288  TRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVT  1109
             TRR+L  KK+ GPC A NPIDRCWRCD +W +NRK++ADC LGFG  TTGGK GPYYVV 
Sbjct  68    TRRNL--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVN  125

Query  1108  DSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVG  929
             DSSD+++  PKPGTLRHAVIQ GPLWIIFS +M I L  EL++TSDKTID RGA V+I  
Sbjct  126   DSSDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIAY  185

Query  928   GAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDH  749
             GAG T+Q+++NVII  L+I  I   SGG+IRD+  H GLRT  +GDGI+IFGSSNVWIDH
Sbjct  186   GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  748   LSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKR  569
             +SMS C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D++MQITVAFNHFG+ 
Sbjct  246   VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQG  305

Query  568   LEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW  389
             L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+IAPP   Y KE+T R++
Sbjct  306   LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPN-VYAKEVTKREY  364

Query  388   -PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
              P   WK WTW S+ D  +N AFF  SGD      + R+D++   P ++  ++TRFAG+L
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRMDMISYKPGTYVKRMTRFAGSL  424

Query  211   SCKYGKPC  188
             +C  G+PC
Sbjct  425   ACFVGRPC  432



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 248/458 (54%), Positives = 312/458 (68%), Gaps = 9/458 (2%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGD----IHSSDLYWVNRKAEAMDYAMKAFTKHP  1379
             M +K+N +LL++ F    ++P++  E  +    I   D  W  R  +A   A+KA+  +P
Sbjct  1     MASKLNLALLMISFCM--LVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNP  58

Query  1378  EHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDW  1199
             E VT +    V  M       +DD    N T RHL GK++ GPCKA NPIDRCWRC  +W
Sbjct  59    EQVTEDFNESV-EMTIIEDDHDDDHAAGNSTGRHLLGKRYTGPCKATNPIDRCWRCQANW  117

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
               NRK +A C  GFG  T GGK G YY+VTDSSD+ + +PKPGTLRHAVIQ  PLWIIF+
Sbjct  118   ADNRKHLASCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFA  177

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              SM I L  EL+VTS KTID RGA V I  GAG T+QFV+NVII  L I      +GG+I
Sbjct  178   RSMVIRLTQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMI  237

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS  H G+RT  +GDGI+I+GSSN+W+DHLSM  C DG+IDA++GSTA+TISN HFT H
Sbjct  238   RDSVDHIGIRTHSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRH  297

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
             + V+LFGA++    D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GG
Sbjct  298   NDVMLFGASDGFSGDAIMQITVAFNHFGKGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGG  357

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDP  302
             S+  TIISQGNR+IAPP  +  KE+T RD+ P   WK W W S+ D  +N AFF  SG P
Sbjct  358   SSHPTIISQGNRFIAPPNQAA-KEVTKRDYAPESVWKSWQWRSEGDLMINGAFFVQSGVP  416

Query  301   QGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                  +GRLD++   P ++  ++TRFAG+L+CK G PC
Sbjct  417   SKNHGFGRLDVMKARPGTYVTRLTRFAGSLNCKVGHPC  454



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   476 bits (1224),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 313/452 (69%), Gaps = 18/452 (4%)
 Frame = -2

Query  1534  MNWSLL--VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRN  1361
             MN SL   V+F +F  + P +   +GD    D YW  +   A + A +++  +P +V+  
Sbjct  4     MNKSLFTFVLFASFAVIFPTLHANIGDF---DEYWKQKADIAREAAYRSYNPNPFNVSNQ  60

Query  1360  ITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
             +  +V+     T          N TRR+L  +K  GPCKA NPIDRCWRCD  W  NRKR
Sbjct  61    LNYQVNKAVSGT----------NSTRRNLMRRKGGGPCKATNPIDRCWRCDPKWALNRKR  110

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             + +C LGFG  TTGGKDG +Y+VTD SDN+M  PKPGTLRHAVIQ+ PLWIIF+ SM I 
Sbjct  111   LVECVLGFGHSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIR  170

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATH  821
             L  EL+++S+KTID RGA V I GGAG T+QFV+NVII  ++I  I + SGG++RDS  H
Sbjct  171   LNQELMISSNKTIDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDH  230

Query  820   KGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLF  641
              G RT  +GDGI+IFGSSN+WIDH+SMS C+DG+IDA+ GST++TISNCHFT+H++V+LF
Sbjct  231   YGFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLF  290

Query  640   GANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTI  461
             GA++    D +MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI
Sbjct  291   GASDGYSADTIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTI  350

Query  460   ISQGNRYIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY  284
             ISQGNR+IAP    + KE+T R++    EWK W W SDRD  +N A F  SG P     +
Sbjct  351   ISQGNRFIAPNNI-FSKEVTKREYSLESEWKNWNWRSDRDLMMNGAVFVESGKPI-THDF  408

Query  283   GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              RL L+   P +   ++TR++GAL C  GKPC
Sbjct  409   SRLQLIKAKPGTFVTRLTRYSGALDCFVGKPC  440



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   476 bits (1224),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/452 (55%), Positives = 313/452 (69%), Gaps = 11/452 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ +S   +F  F  +I  +   +GD    D  W  R  EA +YA + +  +PE+VT   
Sbjct  5     KLKYSFFFLFIIFATIIRNLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               +V     +TM       V N TRR L  KK+KGPC   NPIDRCWRCD +W  NRKR+
Sbjct  62    NQKVR----DTMKELRQVTVSNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRL  117

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA+GFG   TGGKDG  Y+VTD+SD +  EPKPGTLR+AVIQ  PLWIIF  SMTI L
Sbjct  118   ADCAMGFGYKATGGKDGEIYIVTDNSD-DYAEPKPGTLRYAVIQKEPLWIIFERSMTIRL  176

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               E+++ SDKTID RGA V I  GAG T+Q++KNVII  L I  I   SGG++RD+  H 
Sbjct  177   HQEMIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHI  236

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDGI+IFG+SN+WIDH+SM +C DGIIDAV+GST +TISN HFTDH++V+LFG
Sbjct  237   GIRTVSDGDGISIFGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFG  296

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  297   ASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTII  356

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             +QGNR+IAPP   + K++T R++ P + WK WTW S+ + F+N A+F  SGDP  + K+ 
Sbjct  357   TQGNRFIAPP-DIFKKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKHK  415

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +    +     ITRFAGAL CK GK C
Sbjct  416   ELYDGISAASAEEVTWITRFAGALGCKEGKAC  447



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   476 bits (1224),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 257/448 (57%), Positives = 307/448 (69%), Gaps = 11/448 (2%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L +F  F A+IP++ G +GD    D  W  R  EA ++A+KA+   P +VT     +   
Sbjct  11    LFLFSTFLAIIPSLNGHIGDF---DEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKE  67

Query  1339  MRHETMAFEDDREVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
                E    E  +   N TRR LRG  K + GPC   NPIDRCWRC  +W  NRKR+ADCA
Sbjct  68    SMKELK--EVKKLATNDTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLADCA  125

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG GTTGGK G +YVVTDSSD+    PKPGTLRHAVIQ  PLWIIF+ SM I L  EL
Sbjct  126   LGFGKGTTGGKAGRFYVVTDSSDDS-SNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQEL  184

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             ++ SDKTIDGRG  V I  GAG T+Q+VKNVII  L I  I   +GG++  +  H G+RT
Sbjct  185   IMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRT  244

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSSN+WIDH+SM RC DG+IDAV+GSTA+TISN HFTDH++V+LFGA++ 
Sbjct  245   QSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDS  304

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
               ID+ MQITVAFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGN
Sbjct  305   SSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364

Query  445   RYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL-D  272
             R+IAPP   + KEIT RD+ P   WK WTW S  D F+N AFF  SGDP    K+  L D
Sbjct  365   RFIAPP-EMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFD  423

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
              +   P      ITRFAGAL+CK G  C
Sbjct  424   GISSAPGEQVTWITRFAGALNCKQGHAC  451



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   474 bits (1221),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/436 (55%), Positives = 302/436 (69%), Gaps = 17/436 (4%)
 Frame = -2

Query  1492  VIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFE  1313
             + P++   +G+    D  W  R  EA   A++A+  +PE VT      V      T    
Sbjct  20    LAPSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT----  72

Query  1312  DDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggk  1133
                   N TRR+LR     GPC A NPIDRCWRC +DW KNRK++ADC LGFG  TTGGK
Sbjct  73    ------NTTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGK  124

Query  1132  dGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGR  953
             DG +YVVTD+SDN+M +PKPGTLRHAVIQ  PLWIIF+  M I L+ EL++  +KTIDGR
Sbjct  125   DGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGR  184

Query  952   GAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFG  773
             GA V I  G G T+QFVKN+II NL I  I    GG+IRDS  H GLRT  +GDG++IFG
Sbjct  185   GANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFG  244

Query  772   SSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITV  593
             SSNVW+DHLSMS C+DG++D +  STA+TISNCHFT+H++V+LFG +N    DK+MQ+TV
Sbjct  245   SSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTV  304

Query  592   AFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYF  413
             AFNH+G+ L QRMPRCR+G  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP  +  
Sbjct  305   AFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-C  363

Query  412   KEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGK  236
             KE+T RD+ + DEWK WTW+S  D   N AFF  SGDP+    + R D++   P +   +
Sbjct  364   KEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVNR  423

Query  235   ITRFAGALSCKYGKPC  188
             +TRF+G+L CK  +PC
Sbjct  424   LTRFSGSLGCKVNQPC  439



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   474 bits (1221),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 302/437 (69%), Gaps = 17/437 (4%)
 Frame = -2

Query  1495  AVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAF  1316
              + P++   +G+    D  W  R  EA   A++A+  +PE VT      V      T   
Sbjct  23    VLAPSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT---  76

Query  1315  EDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttgg  1136
                    N TRR+LR     GPC A NPIDRCWRC +DW KNRK++ADC LGFG  TTGG
Sbjct  77    -------NTTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGG  127

Query  1135  kdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDG  956
             KDG +YVVTD+SDN+M +PKPGTLRHAVIQ  PLWIIF+  M I L+ EL++  +KTIDG
Sbjct  128   KDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDG  187

Query  955   RGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIF  776
             RGA V I  G G T+QFVKN+II NL I  I    GG+IRDS  H GLRT  +GDG++IF
Sbjct  188   RGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIF  247

Query  775   GSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQIT  596
             GSSNVW+DHLSMS C+DG++D +  STA+TISNCHFT+H++V+LFG +N    DK+MQ+T
Sbjct  248   GSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVT  307

Query  595   VAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSY  416
             VAFNH+G+ L QRMPRCR+G  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP  + 
Sbjct  308   VAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-  366

Query  415   FKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAG  239
              KE+T RD+ + DEWK WTW+S  D   N AFF  SGDP+    + R D++   P +   
Sbjct  367   CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVN  426

Query  238   KITRFAGALSCKYGKPC  188
             ++TRF+G+L CK  +PC
Sbjct  427   RLTRFSGSLGCKVNQPC  443



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   474 bits (1219),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 245/445 (55%), Positives = 301/445 (68%), Gaps = 19/445 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV+   F  ++PAV   +GD    D  W  R  EA   A++A+  HPE VT N   +VH 
Sbjct  8     LVILIPFLVIVPAVTANIGDF---DEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHK  64

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                 T          N TRR+L   KF G C A NPIDRCWRC  DW  NR ++ADC LG
Sbjct  65    SFDST----------NHTRRNL--SKFSGLCMATNPIDRCWRCRSDWASNRMKLADCVLG  112

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGGK G  YVVTD SDN+M  PKPGTLRHA IQ+ PLWIIF+ SM I L  EL++
Sbjct  113   FGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIM  172

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             TS+KTID RGA V I  GAG T+QFV N+II  L I  IK  +GG+IRDSA+H G RT  
Sbjct  173   TSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRS  232

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+IFG++N+WIDH+SMS C DG+IDA+  STA+TISNCHFT H++V+LFGA++   
Sbjct  233   DGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYS  292

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D +MQIT+ FNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+
Sbjct  293   GDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRF  352

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP  +  KE+T RD+ P   WK WTW S  D  +N AFF  SGDP     +    ++ 
Sbjct  353   IAPPDINC-KEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPN--FDFSNKYVIR  409

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRF+GALSC+ G PC
Sbjct  410   AKPGAFVTRLTRFSGALSCREGMPC  434



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   474 bits (1219),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 307/445 (69%), Gaps = 17/445 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV    F  +IP++   +GD   S   W  R  EA   A++A+  +PE VT +   EV  
Sbjct  9     LVFLIGFVVLIPSLQANIGDFDES---WQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDK  65

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
             +   +          N TRR LR  ++ GPC A NPIDRCWRC  +W  NRKR+A C LG
Sbjct  66    VIDGS----------NSTRRELR--RYSGPCAATNPIDRCWRCRSNWASNRKRLARCVLG  113

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGG+ G YYVVTD SDN+++ P+PGTLRHAVIQ  PLWIIF+ SM I L  ELL+
Sbjct  114   FGRKTTGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLI  173

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             TS KTID RGA + I  GAG T+QF +NVII  L I  I A+ GG+IRDS  H G RT  
Sbjct  174   TSHKTIDARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPA  233

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+IFGS+N+W+DH+SMS C+DG+IDA++GSTA+TISNCHFT H+ V+LFGA++   
Sbjct  234   DGDGISIFGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFE  293

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              DK+MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TIISQGNR+
Sbjct  294   GDKIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGNRF  353

Query  439   IAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP  +  K++T RD+  + EWK WTW S+ D  +N AFF  SG+      + R D++ 
Sbjct  354   IAPPNNAA-KQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQSGNRSKKRPFTRHDMIK  412

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRFAGAL+C  GK C
Sbjct  413   AKPGTFVTRLTRFAGALNCYAGKKC  437



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   474 bits (1220),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 302/437 (69%), Gaps = 17/437 (4%)
 Frame = -2

Query  1495  AVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAF  1316
              + P++   +G+    D  W  R  EA   A++A+  +PE VT      V      T   
Sbjct  48    VLAPSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT---  101

Query  1315  EDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttgg  1136
                    N TRR+LR     GPC A NPIDRCWRC +DW KNRK++ADC LGFG  TTGG
Sbjct  102   -------NTTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGG  152

Query  1135  kdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDG  956
             KDG +YVVTD+SDN+M +PKPGTLRHAVIQ  PLWIIF+  M I L+ EL++  +KTIDG
Sbjct  153   KDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDG  212

Query  955   RGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIF  776
             RGA V I  G G T+QFVKN+II NL I  I    GG+IRDS  H GLRT  +GDG++IF
Sbjct  213   RGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIF  272

Query  775   GSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQIT  596
             GSSNVW+DHLSMS C+DG++D +  STA+TISNCHFT+H++V+LFG +N    DK+MQ+T
Sbjct  273   GSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVT  332

Query  595   VAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSY  416
             VAFNH+G+ L QRMPRCR+G  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP  + 
Sbjct  333   VAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-  391

Query  415   FKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAG  239
              KE+T RD+ + DEWK WTW+S  D   N AFF  SGDP+    + R D++   P +   
Sbjct  392   CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVN  451

Query  238   KITRFAGALSCKYGKPC  188
             ++TRF+G+L CK  +PC
Sbjct  452   RLTRFSGSLGCKVNQPC  468



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   473 bits (1217),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 247/449 (55%), Positives = 306/449 (68%), Gaps = 22/449 (5%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             SL V    F  V  A   E       D YW  R  EA   A  AF  +PE VT  + A V
Sbjct  6     SLFVCSLLFFVVANANVDE-------DEYWETRATEAKKVAQGAFNANPEIVTDTLNAAV  58

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
                   TM         N TRR LR KK++GPC A NPIDRCWRCD++W KNR+++A+C 
Sbjct  59    S----RTMLGH------NSTRRSLR-KKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECP  107

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG  T GGK GP YVVTD+SD+++  PKPGTLRH VIQ GPLWIIF  SM I L  EL
Sbjct  108   LGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQEL  167

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             +++S KTID RGA V I  GAG T+QFV NVII NL I  I + SGG+IRDS  H G RT
Sbjct  168   MISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRT  227

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSS+VWIDH+SMS C+DG+IDA+ GSTA+TISNCHFT H++V+LFGA++ 
Sbjct  228   QSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDS  287

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D++MQ+T+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGN
Sbjct  288   YAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  347

Query  445   RYIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG--RL  275
             R+IAPP P+  K++T R++   DEWK W+W S+ DE +N A F  SGD     K G  R 
Sbjct  348   RFIAPPNPNA-KQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRY  406

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P ++  ++ R +G + C  GKPC
Sbjct  407   DMISFKPGTYVRRLVRLSGTIECTPGKPC  435



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 252/453 (56%), Positives = 320/453 (71%), Gaps = 15/453 (3%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV  F+F A+IP++     DI   D  W  R  +A   A++A+   PE+VT N+   V+ 
Sbjct  8     LVFLFSFAALIPSL---WADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNK  64

Query  1339  M-----RHETMAFEDDREVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
                    ++T AFE      N TRR+LRG  KK+ GPC A NPIDRCWRC K+W +NRK+
Sbjct  65    ALLKGRANKTRAFEG--VTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQ  122

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             +A+C LGFG  T GGK G YY+VTD+SD+ +  P+PGTLRHAVIQ  PLWIIF+  M I 
Sbjct  123   LANCVLGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIK  182

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATH  821
             L  EL+V S KTIDGRGA V I  GAG T+QFV NVII NL I  I+ +SGG+IRDS  H
Sbjct  183   LSQELIVQSKKTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDH  242

Query  820   KGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLF  641
              G RT  +GDGI+IFGS+N+W+DHLSMS CEDG+IDA++GSTA+TISNCHFT H+ V+L 
Sbjct  243   YGFRTVGDGDGISIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILL  302

Query  640   GANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTI  461
             GA++    DK+MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW+MYA+GGS   TI
Sbjct  303   GASDSYSRDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTI  362

Query  460   ISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGA-VK  287
             ISQGNR+IAP  P + KEIT+R++ P   W+ W W S+ D F+N AFF  SG P    +K
Sbjct  363   ISQGNRFIAPNDP-WAKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPPAPPHLK  421

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             Y +L ++   P++   ++TRF+GAL+CK    C
Sbjct  422   YNKLQMIKAKPATFVRRLTRFSGALNCKKRVKC  454



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   473 bits (1217),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 301/423 (71%), Gaps = 16/423 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R  EA   AM+++ K+PE VT     EV  +    M+ E      N TRR+LRG
Sbjct  43    DAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKL----MSKE------NTTRRNLRG  92

Query  1267  KK-FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
              K + GPC A NP+D CWRCD +W  NRK++  CA GFG  TTGGKDGP+YVVT  +D++
Sbjct  93    NKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDGPFYVVTMGTDDD  152

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             ++ PKPGTLRHAVIQ GPLWIIF+ SM I LQ EL+VTSDKTID RGA V I  GAG T+
Sbjct  153   VQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGANVVIEEGAGITL  212

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFVKNVIITNL IK I    GG+IRDS  H GLRT  +GDGI++FG+SNVWIDH+SMSRC
Sbjct  213   QFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWIDHVSMSRC  272

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+IDA+ GSTA+TISN HFTDH + +LFGANN    DK+MQIT+AFNHFG+ L QRMP
Sbjct  273   ADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFGQGLVQRMP  332

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRD-WPNDEW  374
             R R G FH++NNDYTHW MYA+GG+   TIISQGNR+IAP      K++THR+  P  EW
Sbjct  333   RVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPIN-GVTKQVTHRENTPEAEW  391

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-GRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             K W W S+ D  +N AFF  SG   GA K+  +LD +   P +    +T+F+GAL+C  G
Sbjct  392   KNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDXMPFKPGTXVXTLTKFSGALNCAVG  449

Query  196   KPC  188
             KPC
Sbjct  450   KPC  452



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   473 bits (1217),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 255/448 (57%), Positives = 309/448 (69%), Gaps = 11/448 (2%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L +F  F A+IP++ G +G+    D  W  R  EA ++A+KA+   P +VT     +   
Sbjct  11    LFLFSTFLAIIPSLNGHIGNF---DEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRE  67

Query  1339  MRHETMAFEDDREVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
                E    E ++   N TRR LRG  K + GPC   NPIDRCWRC  +W  NRKR+ADCA
Sbjct  68    SMKELK--EVNKLSTNETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLADCA  125

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             +GFG GTTGGK G +YVVTDSSD+    PKPGTLRHAVIQ  PLWIIF+ SMTI L  EL
Sbjct  126   MGFGKGTTGGKAGQFYVVTDSSDDS-SNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQEL  184

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             ++ SDKTIDGRG  V I  GAG T+Q+VKNVII  L I  I   +GG++  +  H G+RT
Sbjct  185   IMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRT  244

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSSN+WIDH+SM RC DG+IDAV+GSTA+TISN HFTDH++V+LFGA++ 
Sbjct  245   QSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDS  304

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
               ID+ MQITVAFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGN
Sbjct  305   SSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364

Query  445   RYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL-D  272
             R+IAPP   + KEIT RD+ P   WK WTW S  D F+N AFF  SGDP    K+  L D
Sbjct  365   RFIAPP-DMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFD  423

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
              +   P      ITRFAGAL+C+ G  C
Sbjct  424   GISSAPGEQVTWITRFAGALNCRPGHAC  451



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 306/458 (67%), Gaps = 29/458 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
              ++  +   ++P++   + +    D YW  R  EA   A++AF   PE+VT    A V+ 
Sbjct  9     FILALSLAVLVPSLEAHIKEF---DEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNK  65

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
             +              N TRR L   K+ GPC A NPIDRCWRC K+W K+RKR+A C LG
Sbjct  66    VLDGN----------NSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLG  115

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGG  G YYVV D SDN++  PKPGTLRHAVIQ  PLWIIF+ SM I L  EL+V
Sbjct  116   FGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMV  175

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
              S KTIDGRGA V I  GAG T+QFV+NVII N++I  I    GGIIRD+  H G+RT  
Sbjct  176   ASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMS  235

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHS------------  656
             +GDGI+IFGS+N+WIDH+SM RC+DG+IDA++GSTA+TISN H+T H+            
Sbjct  236   DGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTY  295

Query  655   -KVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
              +V+LFGA++  P DK+MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GG
Sbjct  296   VQVMLFGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGG  355

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDP  302
             S+  TIISQGNR+IAPP  +  KE+T RD+   D W+ WTW S  D  +N AFF  SG P
Sbjct  356   SSQPTIISQGNRFIAPPNLAA-KEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP  414

Query  301   QGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 KYGR D++   P +   ++TRF+G L+CK  K C
Sbjct  415   LKK-KYGRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 306/449 (68%), Gaps = 22/449 (5%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             SL V    F  V  A   E       D YW  R  EA   A  AF  +PE VT  + A V
Sbjct  13    SLFVCSLLFFVVANANVDE-------DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAV  65

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
                   TM         N TRR LR KK++GPC A NPIDRCWRCD++W KNR+++A+C 
Sbjct  66    S----RTMLGH------NSTRRSLR-KKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECP  114

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG  T GGK GP YVVTD+SD+++  PKPGTLRH VIQ GPLWIIF  SM I L  EL
Sbjct  115   LGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQEL  174

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             +++S KTID RGA V I  GAG T+QFV NVII NL I  I + SGG+IRDS  H G RT
Sbjct  175   MISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRT  234

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSS+VWIDH+SMS C+DG+IDA+ GSTA+TISNCHFT H++V+LFGA++ 
Sbjct  235   QSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDS  294

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D++MQ+T+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGN
Sbjct  295   YAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  354

Query  445   RYIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG--RL  275
             R+IAPP P+  K+IT R++   DEWK W+W S+ DE +N A F  SGD     K G  R 
Sbjct  355   RFIAPPNPNA-KQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRY  413

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P ++  ++ R +G + C  GKPC
Sbjct  414   DMISFKPGTYVRRLVRLSGTIECTPGKPC  442



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 311/456 (68%), Gaps = 18/456 (4%)
 Frame = -2

Query  1552  IEMFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEH  1373
             +E   K+N  +L +F      IPA      +I   D +W  R  EA   A KA+ K+P  
Sbjct  3     MEAAYKLNVFILCIFIV-AITIPATV--TANIAVFDEHWQGRAKEAKQAANKAYNKNPAE  59

Query  1372  VTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVK  1193
             VT +   EVH          +  + +N TRR+L+ +K+KGPC A NPIDRCWRCD +W  
Sbjct  60    VTGSFNKEVH----------NTFDSMNNTRRNLK-EKYKGPCLATNPIDRCWRCDPNWET  108

Query  1192  NRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSAS  1013
             NRK++ADCA GFG  TTGGK G  YVVTD+SDN++  PKPGTLRHAVIQ GPLWIIF+  
Sbjct  109   NRKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHD  168

Query  1012  MTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRD  833
             M I L  EL+VTSDKTID RGA V I  G   T+QFVKNVII NL I   KA +GG+IRD
Sbjct  169   MKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRD  228

Query  832   SATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSK  653
             S  H G RT  +GDGI+++G+SNVWIDH+S S CEDG+IDA++GSTA+TISNCHFT+H+ 
Sbjct  229   SVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHND  288

Query  652   VLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSA  473
             V+LFG+++ +  D+VMQIT+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS 
Sbjct  289   VMLFGSSDSNSQDEVMQITLAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQ  348

Query  472   GSTIISQGNRYIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQG  296
               TIISQGNR+IAP   +  KE+T R++  +  WK W W S+ D  +N AFF  SG P  
Sbjct  349   HPTIISQGNRFIAPLNEAS-KEVTKREYAAENVWKSWNWRSENDLMMNGAFFVESGSP--  405

Query  295   AVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                    D++   P +   K+TRFAG L C  GKPC
Sbjct  406   IRNLPEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 245/428 (57%), Positives = 300/428 (70%), Gaps = 16/428 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D YW  R+ EA   A++AF   P+ V            H  +  ED+    NGTRR
Sbjct  28    IAEYDDYWKEREEEAKKAALEAFHPTPQEVND----------HFNLHVEDELTGSNGTRR  77

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
              LR  K  GPCKA NPIDRCWRC  +W   RKR+ADC LGFG  T GGK G YY VTD S
Sbjct  78    SLRVNK--GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGKYGKYYFVTDPS  135

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DN+M  PK GTLRHAVIQ  PLWI+F+ SM I L  EL++TSDKTIDGRG  V I  GAG
Sbjct  136   DNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGRGVNVHIAYGAG  195

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              T+QFVKNVII  L I  I + SGG+IRDS  H G R+  +GDGI+I+GSS+VWIDH SM
Sbjct  196   ITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYGSSHVWIDHNSM  255

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S C+DG+IDA++GSTA+TISN HFT H++V+LFGA++ +  D++MQITVAFNHFG+ L Q
Sbjct  256   SNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQITVAFNHFGRGLIQ  315

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPP--GPSY-FKEITHRDW  389
             RMPRCRWG FH++NNDYTHW MYA+GGSA  TIISQGNRY AP    P +  K++T RD+
Sbjct  316   RMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDPKHDAKQVTKRDY  375

Query  388   PND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
               + EWK WTW S+ D   N AFF PSG+P   + Y RLD++   P ++  ++TRF+GAL
Sbjct  376   AMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRLDMIKAKPGTYVSRLTRFSGAL  435

Query  211   SCKYGKPC  188
             +C+ G PC
Sbjct  436   TCRRGGPC  443



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   471 bits (1213),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 243/428 (57%), Positives = 306/428 (71%), Gaps = 14/428 (3%)
 Frame = -2

Query  1468  LGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNG  1289
               DI   D YW  R AEA   A  A+  +PE +  ++ AEV      +          N 
Sbjct  18    FADIGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSGS----------NS  67

Query  1288  TRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVT  1109
             TRR+L  KK+ GPC+A NPIDRCWRCD +W +NRK++ADC LGFG  T GGK GPYYVV 
Sbjct  68    TRRNL--KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVVN  125

Query  1108  DSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVG  929
             DSSD+++  PKPGTLRHAVIQ GPLWI FS +M I L  EL+VTSDKTID RGA V+I  
Sbjct  126   DSSDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIAY  185

Query  928   GAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDH  749
             GAG T+Q+V+NVII  L+I  I   +GG+IRD+  H GLRT  +GDGI+IFGSSNVWIDH
Sbjct  186   GAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  748   LSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKR  569
             +SMS C+DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D++MQ+TVAFNHFG+ 
Sbjct  246   VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQG  305

Query  568   LEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW  389
             L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+IAPP   Y KE+T R++
Sbjct  306   LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPN-VYAKEVTKREY  364

Query  388   -PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
              P   WK WTW S+ D  +N AFF  SGD +    +   D++   P ++  ++TRF+GAL
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQRKRRPFSSKDMISYKPGTYVKRMTRFSGAL  424

Query  211   SCKYGKPC  188
             +C  G+PC
Sbjct  425   ACFVGRPC  432



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   472 bits (1214),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 246/446 (55%), Positives = 305/446 (68%), Gaps = 17/446 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
              ++  F     IPA      +I   D +W  R  EA   A KA+ K+P  VT +   EVH
Sbjct  12    FILCIFIVAITIPATV--TANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVH  69

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                       +  + +N TRR+L+ +K+KGPC A NPIDRCWRCD +W  NRK++ADCA 
Sbjct  70    ----------NTFDSMNNTRRNLK-EKYKGPCVATNPIDRCWRCDPNWETNRKKLADCAK  118

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGGK G  YVVTD+SDN++  PKPGTLRHAVIQ GPLWIIF+  M I L  EL+
Sbjct  119   GFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKLSEELM  178

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             VTSDKTID RGA V I  G   T+QFVKNVII NL I   KA +GG+IRDS  H G RT 
Sbjct  179   VTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTR  238

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+++G+SNVWIDH+S S CEDG+IDA++GSTA+TISNCHFT+H+ V+LFG+++ +
Sbjct  239   SDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSN  298

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D+VMQIT+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  299   SQDEVMQITIAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNR  358

Query  442   YIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAP   +  KE+T R++  +  WK W W S+ D  VN AFF  SG P         D++
Sbjct  359   FIAPXNEAS-KEVTKREYAAENVWKSWNWRSENDLMVNGAFFIESGSP--IRNLPEADMI  415

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P +   K+TRFAG L C  GKPC
Sbjct  416   QAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   471 bits (1213),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 247/454 (54%), Positives = 310/454 (68%), Gaps = 15/454 (3%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+  S  V+FF F A+IP+    +G+    D  W  R  EA   A++ +   PE+VT   
Sbjct  5     KVMHSFFVLFFIFTAIIPSFLAHIGEF---DEVWRRRAEEARKVALQTYESEPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVV--NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
               +V        A ++  EV+  N TRR L  KK+ GPC   NPID+CWRCD +W  NRK
Sbjct  62    NKQVRD------AMKELSEVIPKNDTRRELGTKKYTGPCMVTNPIDKCWRCDPNWADNRK  115

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             ++ADCA+GFG+  TGGK G +YVV DSSD +  +PKPGTLRHAVIQ  PLWIIF   MTI
Sbjct  116   KLADCAMGFGSKATGGKAGRFYVVNDSSD-DYTDPKPGTLRHAVIQKEPLWIIFDRGMTI  174

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL++ SDKTID RGA V I GGAG  +Q+ KNVII  L I  I   +GG++RD+  
Sbjct  175   RLHQELIMQSDKTIDARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVD  234

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GDGI+IFG+SN+WIDH+SM  C DGIIDAV+GST +TISN HFTDH++V+L
Sbjct  235   HIGLRTMSDGDGISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVML  294

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA++   ID+ MQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   T
Sbjct  295   FGASDSSSIDQQMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPT  354

Query  463   IISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             IISQGNR+IAPP   + K+IT R++ P   W  WTW S+ D ++N A+F  SGDP  + K
Sbjct  355   IISQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKK  413

Query  286   YGRL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +  L D +   P+     ITRFAGAL CK G+ C
Sbjct  414   HQNLYDGISAAPADQVTWITRFAGALGCKVGQAC  447



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   471 bits (1213),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 307/452 (68%), Gaps = 11/452 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             KM  SL V+FF FGA+IPA    +GD    D  W  R  EAM + ++ +   P ++T   
Sbjct  6     KMTHSLFVLFFVFGAIIPAFNAHIGDF---DEVWRRRAEEAMKFTIQTYESEPANITLAF  62

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               +      E  A     E    TRR L  KK++GPC   NPID+CWRCD +W  NRK++
Sbjct  63    NQKTRDSVKELSAVVSKNE----TRRELGTKKYEGPCTVTNPIDKCWRCDPNWADNRKKL  118

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
              +C++GFG  TTGG+DG YYVV+DSSD +   PKPGTLRHAVIQ  PLWIIF  +M I L
Sbjct  119   VECSMGFGYKTTGGRDGKYYVVSDSSD-DYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKL  177

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               EL++  DKTIDGRGA V I GGA   +Q+ KNVII  L I  I   +GG++RD+  H 
Sbjct  178   HQELIMQGDKTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHI  237

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G RT  +GDGI+IFGSSN+WIDH+SM  C DGIIDAV+GST +TISN H+TDH++V+LFG
Sbjct  238   GFRTKSDGDGISIFGSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFG  297

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+ MQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  298   ASDSSSIDQKMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTII  357

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+IAPP   + K+IT R++ P   W  WTW S+ D ++N A+F  +GDP  + K+ 
Sbjct  358   SQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQ  416

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +   P+     +TRFAGAL+CK GK C
Sbjct  417   NLYDGIAAAPADQVTWMTRFAGALNCKVGKAC  448



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 315/471 (67%), Gaps = 29/471 (6%)
 Frame = -2

Query  1552  IEMFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEH  1373
             +   N   + L  V  A   + P+V      I   D YW  R+ EA+   ++++   P +
Sbjct  3     VAYLNLGTYVLAFVSLALAIIAPSVQAH---IAVYDEYWTQRQTEALRRTLESYEPDPLN  59

Query  1372  VTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG--------KKFKGPCKALNPIDRCW  1217
             VT       H   H  +A E   E VNGTRR LR         KK  G  ++LN ID+CW
Sbjct  60    VTD------HFNYHSALAMETT-EAVNGTRRELRVVGGGRKTIKKRGGRFQSLNAIDKCW  112

Query  1216  RCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGP  1037
             R DK+W KNRK++ADC LGFG  TTGGK GP Y VTD+SDN++  P+PGTLRHAV +D P
Sbjct  113   RGDKNWAKNRKKLADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRP  172

Query  1036  LWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKA  857
             LWIIF+ SM I LQ EL++T+DKTIDGRG  V I GGAG T+QFVKNVII N+ +K I+ 
Sbjct  173   LWIIFAKSMVIKLQQELIITNDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIER  232

Query  856   TSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISN  677
              +GG+IRDS  H GLRT  +GDGI IFG++NVWIDH+SM  C DG+IDA+ GSTA+TISN
Sbjct  233   RAGGMIRDSENHFGLRTESDGDGINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISN  292

Query  676   CHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWE  497
             CHFTDH +V+LFGA N D IDK MQITVAFNHFGKRL+QRMPR R+G+ H++NNDYTHW+
Sbjct  293   CHFTDHEEVMLFGAKNGDVIDKKMQITVAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQ  352

Query  496   MYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFF  320
             MYA+GG+   TIISQGNR+IAPP     K+IT R++ P  EWK W W S+RD F+N A+F
Sbjct  353   MYAIGGNMNPTIISQGNRFIAPPEEDK-KQITKREYTPYPEWKSWNWQSERDYFLNGAYF  411

Query  319   TPSGD-------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               SG        P+  +   R   + P P +   ++T+ AG L CK GK C
Sbjct  412   VQSGKSNAWSSTPKNPIP--RKFTIRPQPGTKVRRLTKDAGTLGCKPGKSC  460



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   470 bits (1209),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 309/436 (71%), Gaps = 15/436 (3%)
 Frame = -2

Query  1492  VIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFE  1313
             +IP +   + +    D YW  R+AEA ++  KA+  +PE VT++     H +    M F 
Sbjct  20    IIPTLHAHIAEY---DDYWRQREAEAKEHFNKAYNPNPEEVTQHFN---HHVARTLMGF-  72

Query  1312  DDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggk  1133
                   N TRR LRGK+  GPC+A NPID+CWRCD +W +NRKR+ADC+LGFG GT GGK
Sbjct  73    ------NSTRRSLRGKRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIGGK  126

Query  1132  dGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGR  953
             +G YY+VTD SDN+M  PKPGTLRHAVIQ  PLWIIF+ SM I L  EL++TSDKTID R
Sbjct  127   NGRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTIDAR  186

Query  952   GAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFG  773
             GA V +  GAG T+QF +N+II  L I  I   SGG+IRDS  H G RT  +GDG+++FG
Sbjct  187   GANVHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFG  246

Query  772   SSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITV  593
             ++N+W+DHLSM  C DG+IDA++GSTA+TISNCHFT+H++V+LFGA++    D+ MQITV
Sbjct  247   ATNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQITV  306

Query  592   AFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYF  413
             AF HFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS+  TIISQGNR++APP  +  
Sbjct  307   AFTHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAAA-  365

Query  412   KEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGK  236
             KE+T RD+ P + WK W+W S+ D  VN AFFT SGDP+ + ++    ++   P      
Sbjct  366   KEVTKRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDPRASRRFLGNFMISAKPGQMVSL  425

Query  235   ITRFAGALSCKYGKPC  188
             +TR++G+L C   +PC
Sbjct  426   LTRYSGSLDCVRRRPC  441



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 309/449 (69%), Gaps = 8/449 (2%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGEL-GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             VF  F + +  VA ++ G++   D YW  R+++A+   + ++  HP +VT +    V+  
Sbjct  12    VFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIA  71

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                + +  D R  +   R   +  K  G C A NPID CWRCD++W  NRK++ADC LGF
Sbjct  72    VDASESRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGF  131

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGKDGP YVV D+SDN++  PKPGTLRHAV +DGPLWIIF+ SM I LQ EL++T
Sbjct  132   GRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMIT  191

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             SDKTIDGRGA V I+ GAG T+QFV NVII N+ +K I   +GG+IRDS  H GLRT  +
Sbjct  192   SDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSD  251

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI++FG++N+WIDH+SM+RC DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   I
Sbjct  252   GDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVI  311

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             DK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+I
Sbjct  312   DKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFI  371

Query  436   APPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL---  269
             APP     K+IT R++ P  EWK W W S+ D F+N A+F  SG         +  L   
Sbjct  372   APPNEEA-KQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNK  430

Query  268   --LDPMPSSHAGKITRFAGALSCKYGKPC  188
               + P P +   K+T  AG L CK G+ C
Sbjct  431   FTIRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 246/456 (54%), Positives = 317/456 (70%), Gaps = 8/456 (2%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELG-DIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             M  + L +   F +++  VA ++G  +   D YW+ RK++A+     ++  +P +VT + 
Sbjct  1     MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHF  60

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
                V+     T +  D R  +   R   + +K  G C A NPID+CWRCD++W  NRK++
Sbjct  61    NYHVNLAVDATESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKL  120

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCALGFG  TTGGKDGP YVVTD+SDN++  PKPGTLR+AV +DGPLWIIF+ SM I L
Sbjct  121   ADCALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKL  180

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             Q EL++TSDKTIDGRGA V I+ GAG T+QFV NVII N+ +K I   +GG+IRDS  H 
Sbjct  181   QQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHI  240

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI++FG++N+WIDH+SM+RCEDG+IDA+ GSTAVTISN HFTDH +V+LFG
Sbjct  241   GLRTKSDGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFG  300

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A +   IDK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TII
Sbjct  301   ARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTII  360

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQG--AVK  287
             SQGNR+IAPP     K+IT R++ P  EWK W W S+ D F+N A+F  SG      A  
Sbjct  361   SQGNRFIAPPNEQA-KQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKL  419

Query  286   YGRLD---LLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +  +     + P P     K+T  AG L CK+GK C
Sbjct  420   HNPIPNKFAIRPKPGMMVRKLTMEAGVLGCKHGKAC  455



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 318/460 (69%), Gaps = 16/460 (3%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELG-DIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             M  + L +   F +++  VA ++G  +   D YW+ RK +A+     ++  +P +VT + 
Sbjct  1     MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHF  60

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
                V+     T +  D R  +   R   + +K  G C A NPID+CWRCD++W  NRK++
Sbjct  61    NYHVNLAVDATESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKL  120

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             A+CALGFG  TTGGKDGP YVVTD+SDN++  PKPGTLR+AV +DGPLWIIF+ SM I L
Sbjct  121   AECALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKL  180

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             Q EL++TSDKTIDGRGA V I+ GAG T+QFV NVII N+ +K+I   +GG+IRDS  H 
Sbjct  181   QQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHI  240

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI++FG++N+WIDH+SM+RCEDG+IDA+ GSTAVTISN HFTDH +V+LFG
Sbjct  241   GLRTKSDGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFG  300

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A +   IDK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TII
Sbjct  301   ARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTII  360

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+IAPP     K+IT R++ P  EWK W W S+ D F+N A+F  SG         
Sbjct  361   SQGNRFIAPPNEQA-KQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAW----  415

Query  280   RLDLLDPMPSSHA---------GKITRFAGALSCKYGKPC  188
                L +P+PS  A          K+T  AG L CK+GK C
Sbjct  416   SAKLHNPIPSKFAIRPKPGTMVRKLTMEAGVLGCKHGKEC  455



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   470 bits (1209),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 312/449 (69%), Gaps = 8/449 (2%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGEL-GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             VF  F + +  VA ++  ++   D YW  R+++A+   M ++  +P +VT +    V+  
Sbjct  12    VFVFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHVNIA  71

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                + +  D R  +   R   + KK  G C A NPID+CWRCD++W KNRK++ADC LGF
Sbjct  72    VDVSESNNDTRRELTQVRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKLADCVLGF  131

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGKDGP YVV D+SD+++  PKPGTLRHAV ++GPLWIIF+ SM I LQ EL++T
Sbjct  132   GRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWIIFARSMIIKLQQELMIT  191

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             SDKTIDGRGA V I+ GAG T+Q+V NVII N+ +K I   +GG+IRDS  H GLRT  +
Sbjct  192   SDKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSD  251

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI++FG++N+WIDH+SM+RC DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   I
Sbjct  252   GDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVI  311

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             DK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+I
Sbjct  312   DKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFI  371

Query  436   APPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL---  269
             APP     K+IT R++ P  EWK W W S+ D F+N A+F  SG         +  L   
Sbjct  372   APPNEQA-KQITKREYTPYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKNPLPNK  430

Query  268   --LDPMPSSHAGKITRFAGALSCKYGKPC  188
               + P P +   K+T  AGAL CK GK C
Sbjct  431   FAIRPKPGTMVRKLTMDAGALGCKQGKAC  459



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   469 bits (1206),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 310/446 (70%), Gaps = 14/446 (3%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             LL+V  +   ++P +   + +    D Y + +  EA   +++AF   P +VT +    VH
Sbjct  9     LLMVLVSMAVLMPTLRAGIAEF---DDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVH  65

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                   +A E   E  N TRR L   K+KGPC A NPIDRCWRCD +W KNRK++A C L
Sbjct  66    ------LALEGI-EGSNSTRRSL--AKYKGPCLATNPIDRCWRCDPNWAKNRKKLAKCVL  116

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGGK G  YVVTD SDN++  PKPGTLR+  +Q  PLWIIF+ SM I L  EL+
Sbjct  117   GFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMIIRLSKELM  176

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             VTS KTID RG+ V I  GAG ++QF +NVII  L+I  + +T GG+IRD+A H GLRT 
Sbjct  177   VTSHKTIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTV  236

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+IFGSSN+W+DHLSMS C+DG+IDA++GSTA+TISN HFT H+ V+LFGA++  
Sbjct  237   SDGDGISIFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSY  296

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  297   QGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNR  356

Query  442   YIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAPP P+  ++IT+R++ P   WK WTW S+ D  +N A+F  SG+P     Y R D++
Sbjct  357   FIAPPNPAA-RQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQSGNPSKRRPYSRFDMI  415

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P +   ++TRF+G+L+C  G+PC
Sbjct  416   KAKPGTFVRRLTRFSGSLNCFVGRPC  441



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   469 bits (1206),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 245/455 (54%), Positives = 309/455 (68%), Gaps = 15/455 (3%)
 Frame = -2

Query  1540  NKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRN  1361
             +K+  S  V+FF F A+IP+    +G+    D  W  R  EA   A++ +   PE+VT  
Sbjct  4     SKVTHSFFVLFFIFAAIIPSFLAHIGEF---DEVWRRRAEEARKVALQTYESEPENVTLA  60

Query  1360  ITAEVHSMRHETMAFEDDREVV--NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNR  1187
                +V        A ++  EV+  N TRR L  KK+ GPC   NPID+CWRCD +W  NR
Sbjct  61    FNKQVRD------AMKELSEVIPKNDTRRELGTKKYTGPCMVTNPIDKCWRCDPNWADNR  114

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
             K++ADCA+GFG+  TGGK G +YVV D SD +  +PKPGTLRHAVIQ  PLWIIF   MT
Sbjct  115   KKLADCAMGFGSKATGGKAGRFYVVNDPSD-DYTDPKPGTLRHAVIQKEPLWIIFDRGMT  173

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I L  EL++ SDKTID RGA V I GGAG  +Q+ KNVII  L I  I   +GG++RD+ 
Sbjct  174   IRLHQELIMQSDKTIDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAV  233

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H GLRT  +GDGI+IFG+SN+WIDH+SM  C DGIIDAV+GST +TISN HFTDH++V+
Sbjct  234   DHIGLRTMSDGDGISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVM  293

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGA++   ID+ MQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   
Sbjct  294   LFGASDSSSIDQQMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNP  353

Query  466   TIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
             TIISQGNR+IAPP   + K+IT R++ P   W  WTW S+ D ++N A+F  SGDP  + 
Sbjct  354   TIISQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSK  412

Query  289   KYGRL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             K+  L D +   P+     ITRFAGAL C  G+ C
Sbjct  413   KHQNLYDGISAAPADQVTWITRFAGALGCMVGQAC  447



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   466 bits (1200),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 230/378 (61%), Positives = 282/378 (75%), Gaps = 2/378 (1%)
 Frame = -2

Query  1318  FEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttg  1139
              EDD+   N TRR+LRGK++KGPCKA NPIDRCWRC  +W  NRK++A C  GFG  T G
Sbjct  20    LEDDQSAGNSTRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRG  79

Query  1138  gkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTID  959
             GK G YY+VTDSSD+ + +PKPGTLRHAVIQ  PLWIIF+ SM I L  EL+VTS KTID
Sbjct  80    GKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTID  139

Query  958   GRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITI  779
              RGA V I  GAG T+QFV+NVII  L+I      SGG+IRDS +H G+RT  +GDGI+I
Sbjct  140   ARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISI  199

Query  778   FGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQI  599
             +GSSN+W+DHLSM  C DG+IDA++GSTA+TISNCHFT H+ V+LFGA++    D +MQI
Sbjct  200   YGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQI  259

Query  598   TVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPS  419
             TVAFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS+  TIISQGNR+IAPP  +
Sbjct  260   TVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQA  319

Query  418   YFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHA  242
               KE+T RD+ P   WK W W S+ D  +N AFF  SG P     +G+LD++   P +  
Sbjct  320   A-KEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKLDMIKAKPGTFV  378

Query  241   GKITRFAGALSCKYGKPC  188
              ++TRFAG+L+CK GK C
Sbjct  379   RRLTRFAGSLNCKVGKKC  396



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   468 bits (1204),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 310/452 (69%), Gaps = 9/452 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ +S L +   F  +IP++   +G     D  W  R  EA +YA K +  HPE+VT   
Sbjct  5     KIKYSFLFLCITFATIIPSLMAHIGHY---DEVWRRRAEEAKEYARKIYEPHPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               ++     E    +      N TRR L  KK+ GPC   NPID+CWRCD +W  NRK++
Sbjct  62    NQKLRDTMKELKKVKGTHN--NSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKL  119

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA+GFG+   GGKDG +YVVTD+SD +  +PKPGTLRHAVIQ  PLWIIF   M I L
Sbjct  120   ADCAMGFGSKAIGGKDGEFYVVTDNSD-DYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRL  178

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               E+++ SDKTID RG  V I  GAG T+Q++KNVII  L I  I   +GG++RD+  H 
Sbjct  179   HQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHI  238

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDGI+IFG+SN+WIDH+SM RC DG+IDAV+GST +TISN HFTDH++V+LFG
Sbjct  239   GIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFG  298

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  299   ASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTII  358

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             +QGNR+IAPP   + K++T R++ P   W  WTW S+ + F+N A+FT SGDP+ + K+ 
Sbjct  359   TQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHK  417

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +   P+     +TRFAG L CK GKPC
Sbjct  418   DLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 305/445 (69%), Gaps = 10/445 (2%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L++FF   ++I     E  +I + D +W  R+  A   A +A+   P  +T      VH+
Sbjct  8     LMLFFMLVSIIFLQHVE-ANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRVHN  66

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
             M              N  RR L   K++GPC+A NPIDRCWRCD +W K+R+++ADC +G
Sbjct  67    M-----GMNRTNRTNNYARRGL--GKYEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVG  119

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGGK G  YVVTD SDNE+ +PKPGTLRHAVIQDGPLWIIF   M I L+ ELLV
Sbjct  120   FGHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLV  179

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             +S+KTIDGRG +V I GGAG  +QFV NVII N+ I  IK   GG IRDS +H G RT  
Sbjct  180   SSNKTIDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTAS  239

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+IFGS+N+WIDH+SMS C DG+IDA++ STA+T+SNCHFTDH+ V+LFGA +   
Sbjct  240   DGDGISIFGSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSS  299

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D++MQ+T+AFNHFGKRL QRMPRCR+G FH++NNDYTHWEMYA+GGS   TII QGNR+
Sbjct  300   QDEIMQVTIAFNHFGKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRF  359

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP   + KE+T R++ P   WK W W S+ D  +N AFF  SGD      Y + D++ 
Sbjct  360   IAPPNI-FAKEVTKREYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSYAKKDMIK  418

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P S    +TRFAGAL+CK G  C
Sbjct  419   AKPGSEVTHLTRFAGALNCKEGTAC  443



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 308/449 (69%), Gaps = 8/449 (2%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGEL-GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             VF  F + +  VA ++ G++   D YW  R+++A+   + ++  HP +VT +    V+  
Sbjct  12    VFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIA  71

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                + +  D R  +   R   +  K  G C A NPID CWRCD++W  NRK++ADC LGF
Sbjct  72    VDASESRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGF  131

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGKDGP YVV D+SDN++  PKPGTLRHAV +DGPLWIIF+ SM I LQ EL++T
Sbjct  132   GRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMIT  191

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             SDKTIDGRGA V I+ GAG T+QFV NVII N+ +K I   +GG+IRDS  H GLRT  +
Sbjct  192   SDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSD  251

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI++ G++N+WIDH+SM+RC DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   I
Sbjct  252   GDGISLIGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVI  311

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             DK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+I
Sbjct  312   DKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFI  371

Query  436   APPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL---  269
             APP     K+IT R++ P  EWK W W S+ D F+N A+F  SG         +  L   
Sbjct  372   APPNEEA-KQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNK  430

Query  268   --LDPMPSSHAGKITRFAGALSCKYGKPC  188
               + P P +   K+T  AG L CK G+ C
Sbjct  431   FTIRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 306/432 (71%), Gaps = 20/432 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL--  1274
             D YW+ R+ +A+   + +F  +P +VT       H   H  +A  D  E +N TRR L  
Sbjct  35    DNYWLQRQGDALKQTIASFDPNPLNVTD------HLNYHVALAV-DATESINSTRRELSQ  87

Query  1273  --RGKKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
                G+K K  G C A NPIDRCWRC+ DW KNRK++ADC LGFG  TTGGKDGP YVV D
Sbjct  88    VRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVND  147

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
             +SD+++  PKPGTLRHAV +DGPLWIIF +SM I LQ EL++TSDKTIDGRGA V I+ G
Sbjct  148   ASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEG  207

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             AG T+QFV NVII N+ +K +   SGG+IRDS  H GLRT  +GDGI++FG++NVWIDH+
Sbjct  208   AGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHV  267

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SM+RC DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   IDK MQITVAFNHFGKRL
Sbjct  268   SMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRL  327

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-  389
             +QRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+IAPP     K+IT R++ 
Sbjct  328   DQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQA-KQITKREYT  386

Query  388   PNDEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGAVKYGRLDLLDPMPSSHAGKITRF  224
             P  +WK W W S+ D F+N A+F  SG      P+      +   + P P +   K+T  
Sbjct  387   PYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPKKFAIRPQPGTMVRKLTMD  446

Query  223   AGALSCKYGKPC  188
             AGAL CK G PC
Sbjct  447   AGALGCKPGTPC  458



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 251/461 (54%), Positives = 312/461 (68%), Gaps = 25/461 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV+ FA  +   A +   G +   D YW  R+ +A+   ++ +  +P +VT +    V+ 
Sbjct  9     LVILFAISSW--ASSSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNL  66

Query  1339  MRHETMAFEDDREVVNGTRRHL------RGKKFK-----GPCKALNPIDRCWRCDKDWVK  1193
                ETM   +     NGTRR L      RG+  K     G C A NPIDRCWRCD  W K
Sbjct  67    AVEETMKTGN-----NGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSK  121

Query  1192  NRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSAS  1013
             NRK++ADCALGFG  TTGGK GPYYVVTD+SD+++  PK GTLRHAV ++ PLWI+F+ S
Sbjct  122   NRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKS  181

Query  1012  MTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRD  833
             M I LQ EL++TSDKTIDGRG  V I GGAGFT+QFV NVII N+ IK I   +GG+IRD
Sbjct  182   MVIKLQQELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRD  241

Query  832   SATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSK  653
             S TH GLRT  +GDGI IFG++NVWIDH+SMS C DG+IDA++GST +TISNCH TDH +
Sbjct  242   SETHFGLRTRSDGDGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQE  301

Query  652   VLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSA  473
             V+LFG  + D IDK MQITVAFNHFGKRL QRMPRCR+GL H++NNDYTHWEMYA+GG+ 
Sbjct  302   VMLFGGTDKDVIDKKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNM  361

Query  472   GSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQG  296
               TIISQGNR+IAPP     K++T R++ P  EWK W W S+ D F+N A+F  SG    
Sbjct  362   NPTIISQGNRFIAPPNEEA-KQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANA  420

Query  295   AVKYGRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
                  +  +     + P P +   K+T  AG LSCK  KPC
Sbjct  421   LSAAPKNPVPSKFAIRPQPGTLVRKLTMDAGVLSCKKRKPC  461



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 315/452 (70%), Gaps = 11/452 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ ++ L +   F  +IP++   +G     D  W  R  EA +YA + + +HPE+VT   
Sbjct  5     KIKYTFLFLCITFATIIPSLMAHIG---HYDEVWRRRAEEAKEYARQIYERHPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               ++ +    TM    + +  N TRR L  KK+ GPC   NPIDRCWRCD +W  NRKR+
Sbjct  62    NQKLRN----TMKELKEVKGTNSTRRGLGTKKYCGPCIVTNPIDRCWRCDPNWADNRKRL  117

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA+GFG+  TGGK+G +YVVTD+SD +  +PKPGTLR+AVIQ  PLWIIF   M I L
Sbjct  118   ADCAMGFGSKVTGGKNGEFYVVTDNSD-DYNDPKPGTLRYAVIQKEPLWIIFKRGMNIRL  176

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               E+++ SDKTID RG  V I  GAG T+Q++KNVII  L I  I   +GG++RD+  H 
Sbjct  177   HQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHI  236

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDGI+IFG+SN+WIDH+SM RC DG+IDAV+GST +TISN HFTDH++V+LFG
Sbjct  237   GIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFG  296

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  297   ASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTII  356

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             +QGNR+IAPP   + K++T R++ P   W  WTW S+ + F+N A+FT SGDP  + K+ 
Sbjct  357   TQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKHK  415

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +   P+     +TRFAG L+CK GKPC
Sbjct  416   DLYDGISAAPAEDVTWMTRFAGVLACKPGKPC  447



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 317/460 (69%), Gaps = 25/460 (5%)
 Frame = -2

Query  1525  SLLVVFF--AFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             S + VF   +F  + P V     +I   D YW  R+ +A+   + +F  +P +VT     
Sbjct  10    SYIFVFLLSSFATLAPQVQA---NIAVFDDYWTQRQGDALKQTLASFDPYPLNVTN----  62

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHL----RGKKF--KGPCKALNPIDRCWRCDKDWVKN  1190
               H   H  +A  D  E +N TRR L    RG+K   +G C A NPID+CWRCD+DW KN
Sbjct  63    --HLNYHVALAL-DTTESINSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKN  119

Query  1189  RKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASM  1010
             RK++A CALGFG  TTGGKDGP YVVTD+SD+E+  P+PGTLRHAV +DGPLWIIF+ SM
Sbjct  120   RKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSM  179

Query  1009  TITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDS  830
              I LQ EL++TSDKTIDGRGA V I+GG+G T+QFV NVII N+ IK+I   +GG+IRDS
Sbjct  180   VIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDS  239

Query  829   ATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKV  650
               H GLRT  +GDGI +FG++NVWIDH+SM+RC DG+IDA+ GSTAVT+SN HFTDH +V
Sbjct  240   EQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEV  299

Query  649   LLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAG  470
             +LFGAN+   IDK MQITVAFNHFGKRLEQRMPR R+G  H++NNDYTHWEMYA+GG+  
Sbjct  300   MLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMN  359

Query  469   STIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGA  293
              TIIS GNR+IAPP     K+IT R++ +  +WK W W S+ D F+N A+F  SG P   
Sbjct  360   PTIISHGNRFIAPPNEQA-KQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAW  418

Query  292   VKYGRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
                 +  +     + P P +   K+T  AG L CK G+ C
Sbjct  419   SPKPKNPIPNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  458



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/424 (55%), Positives = 299/424 (71%), Gaps = 16/424 (4%)
 Frame = -2

Query  1450  SDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGT--RRH  1277
             SD YW  +   A     +A+T  P  V+ N+T+ +  M            ++ G   RR+
Sbjct  40    SDSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEM------------IIGGKKGRRN  87

Query  1276  LRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSD  1097
             LRG+K  GPC A NPIDRCWRCD +W  NRK++ADC  GFG  TTGGK GP+YVVTD SD
Sbjct  88    LRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPSD  147

Query  1096  NEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGF  917
             ++M  P+PGTLRHAV ++GPLWIIF+ SM I L  EL++TSDKTIDGRGA + I  GAG 
Sbjct  148   SDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAGI  207

Query  916   TVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMS  737
             T+Q+++NVII  +K+  I   SGG++RDS  H GLRT  +GDGI+IFGSSN+WIDH+SM 
Sbjct  208   TIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMR  267

Query  736   RCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQR  557
              C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    D+ MQITVAFNHFGKRL QR
Sbjct  268   NCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRLIQR  327

Query  556   MPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PND  380
             MPRCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IAP    Y KEIT R++ P  
Sbjct  328   MPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDN-GYAKEITKREYSPES  386

Query  379   EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKY  200
             EWK W W S  D ++N AFF   G       + + D++   P ++ G++TR++G+L C  
Sbjct  387   EWKNWQWRSINDVYMNGAFFRQGGSELTNRPFSKKDMITAKPGAYVGRLTRYSGSLKCIV  446

Query  199   GKPC  188
             GKPC
Sbjct  447   GKPC  450



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 250/459 (54%), Positives = 315/459 (69%), Gaps = 24/459 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             + V F +F A  P  +     +   D YW  R+ +A+   M ++  +P +VT       H
Sbjct  12    VFVFFLSFIATFPPES--RAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTD------H  63

Query  1342  SMRHETMAFEDDREVVNGTRRHL-----RGKKF---KGPCKALNPIDRCWRCDKDWVKNR  1187
                H ++A  D  E  NGTRR L      G+K     G C A N ID+CWRCD++W KNR
Sbjct  64    FNHHVSLAM-DATESNNGTRRELTQVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNR  122

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
             K++ DC LGFG  TTGGKDGP YVV D+SDN++  PKPGTLR+AV +DGPLWIIF+ SM 
Sbjct  123   KKLTDCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMI  182

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I LQ EL++TSDKTIDGRGA + I+ GAG T+Q+V NVII N+ +K I   +GG+IRDS 
Sbjct  183   IKLQQELMITSDKTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSE  242

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H GLRT  +GDGI++FG++NVWIDH+SM+RC DG+IDA++GSTAVTISN HFTDH +V+
Sbjct  243   HHLGLRTKSDGDGISLFGATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVM  302

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGA + D IDK MQITVAFNHFGKRLEQRMPRCR+GL H++NNDYTHWEMYA+GG+   
Sbjct  303   LFGARDEDVIDKKMQITVAFNHFGKRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNP  362

Query  466   TIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG-----D  305
             TIISQGNR+IAPP     K+IT R++ P  EWK W W S+ D F+N A+F  SG      
Sbjct  363   TIISQGNRFIAPPNEQA-KQITKREYTPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWS  421

Query  304   PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             P+          + P P +   K+T  AGAL CK+GK C
Sbjct  422   PKPVNPLPNKFRIRPKPGTMVRKLTMDAGALGCKHGKAC  460



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   466 bits (1199),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 302/445 (68%), Gaps = 24/445 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L++ F F  + P +   + D    D  W  R  EA   + +A+  HPE  T N   +VH 
Sbjct  13    LLMIFGFVMIFPTLKANIADF---DEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                         +  N TRRHLR  K+ GPC A NPIDRCWRCD++W +NRK++ADCALG
Sbjct  70    ----------SLDGGNNTRRHLR--KYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGGKDG  YVV DSSDN++  PKPGTLRHAVIQ+ PLWIIF+  M I L  EL+V
Sbjct  118   FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             T DKT+DGRGA V I  G   T+QFVKN+II NL I  IKA +GG+IRDS +H G RT  
Sbjct  178   TDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRS  237

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI++FG+S VWIDH+SMS C+DG+IDAV  STA+TISNCHFT H+ V+L GA+N   
Sbjct  238   DGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYS  297

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D++MQ+T+AFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS       QGNR+
Sbjct  298   NDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSH-----XQGNRF  352

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP P+  KE+T R + P  EW+ W W S+ D  +N AFF  SG+P    +Y + D++ 
Sbjct  353   IAPPNPNC-KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSKKDVIH  409

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRFAG L CK  +PC
Sbjct  410   SKPGTFVTRLTRFAGPLKCKKNQPC  434



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   466 bits (1200),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 304/432 (70%), Gaps = 20/432 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL--  1274
             D YW+ R+ +A+   + +F  +P +VT       H   H  +A  D  E  N TRR L  
Sbjct  35    DNYWLQRQGDALKQTIASFDPNPLNVTD------HLNYHVALAV-DATESTNSTRRELSQ  87

Query  1273  --RGKKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
                G+K K  G C A NPIDRCWRC+ DW KNRK++ADC LGFG  TTGGKDGP YVV D
Sbjct  88    VRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVND  147

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
             +SD+++  PKPGTLRHAV +DGPLWIIF +SM I LQ EL++TSDKTIDGRGA V I+ G
Sbjct  148   ASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEG  207

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             AG T+QFV NVII N+ +K +   SGG+IRDS  H GLRT  +GDGI++FG++NVWIDH+
Sbjct  208   AGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHV  267

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SM+RC DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   IDK MQITVAFNHFGKRL
Sbjct  268   SMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRL  327

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-  389
             +QRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+IAPP     K+IT R++ 
Sbjct  328   DQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQA-KQITKREYT  386

Query  388   PNDEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGAVKYGRLDLLDPMPSSHAGKITRF  224
             P   WK W W S+ D F+N A+F  SG      P+      +   + P P +   K+T  
Sbjct  387   PYVNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPINPVPKKFAIRPQPGTMVRKLTMD  446

Query  223   AGALSCKYGKPC  188
             AGAL CK G PC
Sbjct  447   AGALGCKPGTPC  458



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   466 bits (1200),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 304/432 (70%), Gaps = 20/432 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL--  1274
             D YW+ R+ +A+   + +F  +P +VT ++   V      T       E +N TRR L  
Sbjct  35    DNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVGAT-------ESINSTRRELSQ  87

Query  1273  --RGKKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
                G+K K  G C A NPIDRCWRC  DW KNRK++ADC LGFG  TTGGKDGP YVV D
Sbjct  88    VRNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVND  147

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
             +SD+++  PKPGTLRHAV +DGPLWIIF +SM I LQ EL++TSDKTIDGRGA V I+ G
Sbjct  148   ASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEG  207

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             AG T+QFV NVII N+ IK +   SGG+IRDS  H GLRT  +GDGI++FG++NVWIDH+
Sbjct  208   AGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHV  267

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SM+RC DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   IDK MQITVAFNHFGKRL
Sbjct  268   SMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRL  327

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-  389
             +QRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+IAPP     K+IT R++ 
Sbjct  328   DQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQA-KQITKREYT  386

Query  388   PNDEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGAVKYGRLDLLDPMPSSHAGKITRF  224
             P  +WK W W S+ D F+N A+F  SG      P+      R   + P P +   K+T  
Sbjct  387   PYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPRKFAIRPQPGTMVRKLTMD  446

Query  223   AGALSCKYGKPC  188
             AGAL CK G PC
Sbjct  447   AGALGCKPGTPC  458



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 319/466 (68%), Gaps = 26/466 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++ ++ V  +   V+P V   + +    D YW  R+ EA+   ++++   P +VT
Sbjct  1     MVNLGSYVIVFVSLSLAVVVPTVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR----GKKFKG-PCKALNPIDRCWRCDKD  1202
                    H   H  +A E    + N TRR LR    GKK +G   ++LN ID+CWR DK+
Sbjct  58    D------HFNYHAALAMETT-GIANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKN  110

Query  1201  WVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIF  1022
             W KNRK++ADC LGFG  TTGGK+GP YVVTD SDN++  PKPGTLRHAV +D PLWIIF
Sbjct  111   WDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIF  170

Query  1021  SASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGI  842
             +  M I LQ EL++T+DKTIDGRG  V I GGAG T+Q+V+NVII N+ IK+IK   GG+
Sbjct  171   ARHMIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGL  230

Query  841   IRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTD  662
             IRDS  H GLRT  +GDGI+IFG++N+WIDH+SM+ C DG+IDA+ GSTA+TISN HFTD
Sbjct  231   IRDSEHHFGLRTMSDGDGISIFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTD  290

Query  661   HSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVG  482
             H +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA+G
Sbjct  291   HDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIG  350

Query  481   GSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD  305
             G+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  SG 
Sbjct  351   GNMNPTIISQGNRFIAPPNEDS-KQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGK  409

Query  304   -------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                    P+  +   R   + P P +   ++T+ AGAL CK GK C
Sbjct  410   ANAWSTAPKNPIP--RKFAIRPQPGTKVRRLTKDAGALGCKAGKSC  453



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 303/432 (70%), Gaps = 13/432 (3%)
 Frame = -2

Query  1465  GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGT  1286
             G I   D  W  R  EA ++A+KA+   P +VT     E      E    ++ +  VNGT
Sbjct  22    GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKE---IKEAKLAVNGT  78

Query  1285  RRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVV  1112
             RR L+G  KK+ GPC   NPIDRCWRC  DW  NRKR+ADCA+GF  GTTGGK G  YVV
Sbjct  79    RRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEIYVV  138

Query  1111  TDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIV  932
             TDSSD +  +PKPGTLR+ VIQ  PLWIIF+ SMTI L  EL+V SDKTIDGRG  V I 
Sbjct  139   TDSSD-DTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIA  197

Query  931   GGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWID  752
              GAGF +Q+VKNVII  L+I  I   SGG+IRD+  H G RT  +GDGI+IFGSSN+W+D
Sbjct  198   NGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVD  257

Query  751   HLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGK  572
             H+SM  C DG++DA++GSTAVTISN HFTDH++V+LFGA++   ID+ MQITVA+NHFGK
Sbjct  258   HVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGK  317

Query  571   RLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRD  392
             RL QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP   + KE+T RD
Sbjct  318   RLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMFKKEVTKRD  376

Query  391   W-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGK---ITRF  224
             + P   WK W+W S  D F+N AFF  SGDP    K+  + L D + S+   +   ITRF
Sbjct  377   YSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKH--IQLFDGVVSASGDQVTWITRF  434

Query  223   AGALSCKYGKPC  188
             +GAL+CK G+ C
Sbjct  435   SGALNCKPGEAC  446



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 302/438 (69%), Gaps = 15/438 (3%)
 Frame = -2

Query  1498  GAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMA  1319
              A+IP +   +GD    D  W  R  EA   A++A+   P+ V  +    VH      +A
Sbjct  20    AAIIPTLRAHIGDF---DEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVH------LA  70

Query  1318  FEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttg  1139
               + R   + TRR LR K++KGPC A NPIDRCWRC   W KNRK++ADC LGFG  T G
Sbjct  71    TAEVRSGNSSTRRSLRNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTVG  130

Query  1138  gkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTID  959
             GK G +YVVTD SD++ME PKPGTLRHAVIQ  PLWIIF   M I L+ EL++TSDKT+D
Sbjct  131   GKYGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTLD  190

Query  958   GRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITI  779
             GRGA V I  GAG T+QF+KNVII NL    I A  GG+IRDS  H G RT  +GD I+I
Sbjct  191   GRGARVHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISI  250

Query  778   FGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQI  599
             FGS+NVWIDH SMS C+DG++DA+ GSTA+TISN H T H++V+LFGA++  P D  MQI
Sbjct  251   FGSTNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQI  310

Query  598   TVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPS  419
             TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TIISQGNR+IAPP  +
Sbjct  311   TVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEA  370

Query  418   YFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHA  242
               K++T+R++ P   WK WTW S+ D  +N A+F  SG P   +K  R D++     +  
Sbjct  371   A-KQVTNRNYAPESVWKHWTWRSEGDLMMNGAYFIQSGKP---IKKKR-DMITAKKGTFV  425

Query  241   GKITRFAGALSCKYGKPC  188
              ++ RF+GAL+CK GK C
Sbjct  426   KRLVRFSGALNCKVGKRC  443



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 247/461 (54%), Positives = 313/461 (68%), Gaps = 20/461 (4%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNIT  1355
             +N    +  F   ++         +I   D YW  R+ +A+   + +F  +P +VT    
Sbjct  6     LNIGSYIFVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTN---  62

Query  1354  AEVHSMRHETMAFEDDREVVNGTRRHL----RGKKF--KGPCKALNPIDRCWRCDKDWVK  1193
                H   H  +A  D  E  N TRR L    RG+K   +G C A NPID+CWRCD+DW K
Sbjct  63    ---HLNYHVALAL-DTTESTNSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEK  118

Query  1192  NRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSAS  1013
             NRK++A CALGFG  TTGGKDGP YVVTD+SD+E+  P+PGTLRHAV +DGPLWIIF+ S
Sbjct  119   NRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARS  178

Query  1012  MTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRD  833
             M I LQ EL++TSDKTIDGRGA V I+GG+G T+QFV NVII N+ IK+I   +GG+IRD
Sbjct  179   MVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRD  238

Query  832   SATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSK  653
             S  H GLRT  +GDGI +FG++NVWIDH+SM+RC DG+IDA+ GSTAVT+SN HFTDH +
Sbjct  239   SEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQE  298

Query  652   VLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSA  473
             V+LFGAN+   IDK MQITVAFNHFGKRLEQRMPR R+G  H++NNDYTHWEMYA+GG+ 
Sbjct  299   VMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNM  358

Query  472   GSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQG  296
               TIIS GNR+IAPP     K+IT R++ +  +WK W W S+ D F+N A+F  SG P  
Sbjct  359   NPTIISHGNRFIAPPNEQA-KQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNA  417

Query  295   AVKYGRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
                  +  +     + P P +   K+T  AG L CK G+ C
Sbjct  418   WSPKPKNPIPNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  458



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   464 bits (1195),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 248/434 (57%), Positives = 302/434 (70%), Gaps = 16/434 (4%)
 Frame = -2

Query  1480  VAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDRE  1301
             V  E   +   D YW  R  EA   A++++ K+PE VT     EV  +  +         
Sbjct  32    VPNEDTQVLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLMLKE--------  83

Query  1300  VVNGTRRHLRGKK-FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
               N TRR+LRG K +KGPC A NPID CWRCD  W  NRK++  CA GFG   TGGKDGP
Sbjct  84    --NTTRRNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDGP  141

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
             +YVVT  +D++++ PKPGTLRHAVIQ GPLWIIF+ SM I LQ EL+VTSDKTID RGA 
Sbjct  142   FYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGAN  201

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  GAG T+QFVKNVIITNL IK I    GG+IRDS  H GLRT  +GDGI++FG+SN
Sbjct  202   VVIEEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASN  261

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFN  584
             VWIDH+SMSRC DG+IDAV GST++TISN HFTDH + +LFGANN    DK+MQIT+AFN
Sbjct  262   VWIDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFN  321

Query  583   HFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEI  404
             HFG+ L QRMPR R G FH++NNDYTHW MYA+GG+   TIISQGNR+IAP      K++
Sbjct  322   HFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPIN-GVTKQV  380

Query  403   THRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-GRLDLLDPMPSSHAGKIT  230
             THR+  P  EWK W W S+ D  +N AFF  SG   GA K+  +LD++   P +    +T
Sbjct  381   THRENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDMMPFKPGTFVATLT  438

Query  229   RFAGALSCKYGKPC  188
             +F+GAL+C  GKPC
Sbjct  439   KFSGALNCAVGKPC  452



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   464 bits (1195),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 313/454 (69%), Gaps = 12/454 (3%)
 Frame = -2

Query  1525  SLLVVFF--AFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             S + VFF  +   + P V     +I   D YW  R+ +A+   + +F  +P +VT ++  
Sbjct  10    SYVFVFFLSSLATLAPQVQA---NIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNY  66

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              V      T +    R  ++  RR  + +  +G C A NPID+CWRCD+DW KNRK++A 
Sbjct  67    HVALALDTTGSINSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLAV  126

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CALGFG  T+GGKDGP YVVTD+SD+E+  P+PGTLRHAV +DGPLWIIF+ SM I LQ 
Sbjct  127   CALGFGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQ  186

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL++TSDKTIDGRGA V I+GG+G T+QFV NVI+ N+ IK+I   +GG+IRDS  H GL
Sbjct  187   ELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGL  246

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGI +FG++NVWIDH+SM+RC DG+IDA+ GSTAVT+SN HFTDH +V+LFGAN
Sbjct  247   RTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGAN  306

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +   IDK MQITVAFNHFGKRLEQRMPR R+G  H++NNDYTHWEMYA+GG+   TIIS 
Sbjct  307   DKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISH  366

Query  451   GNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAPP     K+IT R++ +  +WK W W S+ D F+N A+F  SG P       + 
Sbjct  367   GNRFIAPPNEQA-KQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKN  425

Query  274   DL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
              +     + P P +   K+T  AG L CK G+ C
Sbjct  426   PIPNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  459



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   464 bits (1193),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 300/447 (67%), Gaps = 17/447 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
                +F +  A +P + G +G+    D YW  +  EA+  A +AF   P +VT     +V+
Sbjct  10    FFSLFVSLAAFVPTLQGHIGEF---DEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVN  66

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
              +  ET          N TRR L  K+  G C A NPIDRCWRCD +W  +R+++ADC L
Sbjct  67    KVMTET----------NSTRRSLVSKR-GGRCMATNPIDRCWRCDPNWASHRQKLADCVL  115

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  T GGK G  YVVTD+SDN+M  PKPGTLRHAVIQ  PLWIIFS SM I L  EL+
Sbjct  116   GFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELM  175

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             V S+KTID RGA V I  GAG T+QFV+NVII  L+I  I   SGG++RDS  H G RT 
Sbjct  176   VASNKTIDSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTK  235

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+IFGSSN+WIDH+SMS C+DG+ID + GS A+TISN HFT H++V+LFGA++  
Sbjct  236   SDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSY  295

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR
Sbjct  296   SGDSIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNR  355

Query  442   YIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDP-QGAVKYGRLDL  269
             +IA P  ++ KE+T RD+    EWK W W SD D  +N AFF  SG P   + +  R  +
Sbjct  356   FIA-PNNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHV  414

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             +   P +   ++TRF+G+L C  GKPC
Sbjct  415   MKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   463 bits (1192),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 235/455 (52%), Positives = 304/455 (67%), Gaps = 11/455 (2%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M +KM   LL +  AF + +P+++    D    D YW+ R  +A +  ++++  HP  + 
Sbjct  1     MIHKM--GLLFLLIAFASALPSISANFADF---DDYWLKRSVQAWNNTLQSYESHPAKIV  55

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNR  1187
              ++   +HS R      +D   V N +RR L    ++GPC A NPIDRCWRC  +W  NR
Sbjct  56    SHL--NLHSKR-ALKEIKDINLVSNSSRRQL-AHGYEGPCMATNPIDRCWRCQANWADNR  111

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
              R+ADC LGFG    GGK G  YVV DSSD +M  PKPGTLRHAVIQ  PLWIIFS SM 
Sbjct  112   FRLADCGLGFGYKAKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMV  171

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I L  EL++ SDKTIDGRG  V I GGAG T+QFVKN+II  + I  I   +GG+IRDS 
Sbjct  172   IRLSQELIMQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSV  231

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H GLRT  +GDGI+I+G+ ++WIDH+SM++C DG+IDA+ GST +TISN HFTDH++ +
Sbjct  232   DHYGLRTRSDGDGISIYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAM  291

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGA++    D  MQITVAFNHFGKR+ QRMPRCR+G  H++NNDYTHW MYA+GGS   
Sbjct  292   LFGASDSHTQDVKMQITVAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNP  351

Query  466   TIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
              IISQGNR+IAPP   + KE+T R++ P   W  W W S+ D F+  AFF  SGD     
Sbjct  352   IIISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTS  411

Query  289   KY-GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             K+  + DL+    ++  G +T+FAGAL CK G+PC
Sbjct  412   KHPEKYDLIQAASATQVGIMTKFAGALGCKVGQPC  446



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   464 bits (1193),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 248/468 (53%), Positives = 321/468 (69%), Gaps = 28/468 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++  + V  +   V+P+V   + +    D YW  R+  A+   ++++  +PE+VT
Sbjct  1     MVNLGSYVFVFVALSLTVVVPSVQAHIAEY---DEYWTQRQTNALRETLESYDPNPENVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR----GKKFK---GPCKALNPIDRCWRCD  1208
                    H   H  +A E    +VN TRR LR    GKK     G  ++LN ID+CWR D
Sbjct  58    D------HFNYHAALAMETT-GIVNETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGD  110

Query  1207  KDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWI  1028
             K+W KNRK++ADC LGFG  TTGGK+GP YVVTD SDN++ +PKPGT+RHAV +D PLWI
Sbjct  111   KNWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWI  170

Query  1027  IFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSG  848
             IF+ SM I LQ EL++T+DKTIDGRGA + I GGAG T+QFV+NVII N+ IK+IK  +G
Sbjct  171   IFARSMIIKLQQELIITNDKTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAG  230

Query  847   GIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHF  668
             G+I DS  H GLRT  +GDGI IFG++NVWIDH+SM+ C DG+IDA+ GSTA+TISN HF
Sbjct  231   GLIIDSEQHFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHF  290

Query  667   TDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYA  488
             TDH +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA
Sbjct  291   TDHDEVMLFGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYA  350

Query  487   VGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPS  311
             +GG+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  S
Sbjct  351   IGGNMNPTIISQGNRFIAPPIEDS-KQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQS  409

Query  310   GD-------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             G        P+  +   R   + P P +   ++T+ AG L CK GK C
Sbjct  410   GKANAWSATPKNPIP--RKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   464 bits (1193),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 313/457 (68%), Gaps = 19/457 (4%)
 Frame = -2

Query  1525  SLLVVFFAFGAVI-PAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAE  1349
             +L V F +  A++ P V   +      D YW  R+++A+   M ++  +P +VT ++   
Sbjct  7     NLGVFFLSLLAIVAPQVKAHVAVF---DSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYH  63

Query  1348  VHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADC  1169
             V+       +F D R  +   R   R  K  G C A NPID+CWRCD++W  NRK++ADC
Sbjct  64    VNLAVDAAESFNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLADC  123

Query  1168  ALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHE  989
              LGFG  TTGGKDGP YVV D+SDN++  PKPGTLR+AV +DGPLWIIF+ SM I LQ E
Sbjct  124   VLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQE  183

Query  988   LLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLR  809
             L++ SDKTIDGRGA V I+ GAG T+Q+V NVII ++ +K I   +GG+IRDS  H GLR
Sbjct  184   LMIASDKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLR  243

Query  808   TFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANN  629
             T  +GDGI++FG++N+WIDH+SM+RC DG+IDA+ GSTAVTISN HFTDH +V+LFGA +
Sbjct  244   TKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARD  303

Query  628   WDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQG  449
                IDK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   TIISQG
Sbjct  304   EHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQG  363

Query  448   NRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG-------DPQGA  293
             NR+IAPP     K+IT R++ P  EWK W W S+ D F+N A+F  SG        PQ  
Sbjct  364   NRFIAPPSEQA-KQITKREYTPLAEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPQNP  422

Query  292   V--KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +  K+     + P P +   K+T  AGAL C+ G+ C
Sbjct  423   IPNKFA----IRPKPGTMVRKLTMEAGALGCRQGQAC  455



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/468 (53%), Positives = 319/468 (68%), Gaps = 28/468 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++  + V  +   V+P+V   +  +H  D YW  R+ EA+   ++A+   P +VT
Sbjct  1     MVNLGSYVFVFVSLSLAVVVPSVQAHIA-VH--DEYWTQRQTEALQQTLEAYDPEPLNVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR--GKKFKGPCK-----ALNPIDRCWRCD  1208
              +         H+         +VN TRR LR  G+  K P +     +LN ID+CWR D
Sbjct  58    DHFN-------HQAALAMVPTGIVNETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGD  110

Query  1207  KDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWI  1028
             K+W KNRK++ADC LGFG  TTGGK+GP+YVVTD SD ++  PKPGTLR+AV +D PLWI
Sbjct  111   KNWDKNRKKLADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWI  170

Query  1027  IFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSG  848
             IF+ SM I LQ EL++T+DKTIDGRGA V I GGAG T+QFV+NVII N+ IK+IK  +G
Sbjct  171   IFARSMIIKLQQELIITNDKTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAG  230

Query  847   GIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHF  668
             G+IRDS  H GLRT  +GDGI IFG++NVWIDH+SM+ C DG+IDA+ GSTA+TISN HF
Sbjct  231   GLIRDSEHHFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHF  290

Query  667   TDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYA  488
             TDH +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA
Sbjct  291   TDHDEVMLFGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYA  350

Query  487   VGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPS  311
             +GG+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  S
Sbjct  351   IGGNMNPTIISQGNRFIAPPIEDS-KQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQS  409

Query  310   GD-------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             G        P+  +   R   + P P +   ++T+ AG L CK GK C
Sbjct  410   GKANAWSTAPKNPIP--RKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 318/466 (68%), Gaps = 26/466 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++ ++ V  +    +P+V   + +    D YW  R+ EA+   ++++   P +VT
Sbjct  1     MVNLGSYVIVFVSLSLAVAVPSVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR----GKKFKG-PCKALNPIDRCWRCDKD  1202
                    H   H  +A E      N TRR LR    GKK +G   ++LN ID+CWR DK+
Sbjct  58    D------HFNYHAALAMETT-GTANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKN  110

Query  1201  WVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIF  1022
             W KNRK++ADC LGFG  TTGGK+GP YVVTD SDN++ +PKPGTLRHAV +D PLWIIF
Sbjct  111   WDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIF  170

Query  1021  SASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGI  842
             +  M I LQ EL++T+DKTIDGRG  V I GGAG T+Q+V+NVII N+ IK+IK   GG+
Sbjct  171   ARHMIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGL  230

Query  841   IRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTD  662
             IRDS  H GLRT  +GDGI IFG++NVWIDH+SM+ C DG+IDA+ GSTA+TISN HFTD
Sbjct  231   IRDSEHHFGLRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTD  290

Query  661   HSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVG  482
             H +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA+G
Sbjct  291   HDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIG  350

Query  481   GSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD  305
             G+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  SG 
Sbjct  351   GNMNPTIISQGNRFIAPPNEDS-KQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGK  409

Query  304   -------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                    P+  +   R   + P P +   ++T+ AGAL CK GK C
Sbjct  410   ANAWSTAPKNPIP--RKFAIRPQPGTKVRRLTKDAGALGCKPGKSC  453



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 307/438 (70%), Gaps = 16/438 (4%)
 Frame = -2

Query  1483  AVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDR  1304
             A+ G +G+    D  W  R  EA ++A+KA+   P +VT     +      E    ++ +
Sbjct  19    AINGHIGEF---DEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKE---IKEAK  72

Query  1303  EVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkd  1130
               +NGTRR L+G  KK+ GPC   NPIDRCWRC  +W  NRKR+ADCA+GF  GTTGGK 
Sbjct  73    LAINGTRRELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKA  132

Query  1129  GPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRG  950
             G  YVVTDSSD +  +PKPGTLR+ VIQ  PLWIIF+ SMTI L  EL+V SDKTIDGRG
Sbjct  133   GEIYVVTDSSD-DTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRG  191

Query  949   AYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGS  770
               V I  GAGF +Q+VKNVII  L+I  I   SGG+IRD+  H G RT  +GDGI+IFGS
Sbjct  192   VNVHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGS  251

Query  769   SNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVA  590
             SN+W+DH+SM  C DG++DAV+GSTAVTISN HFTDH++V+LFGA++   ID+ MQITVA
Sbjct  252   SNIWVDHVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVA  311

Query  589   FNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFK  410
             +NHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP   + K
Sbjct  312   YNHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMFKK  370

Query  409   EITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGK-  236
             E+T RD+ P   WK W+W S  D F+N AFF  SGDP    K+   +L D + S+   + 
Sbjct  371   EVTKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKH--TELFDGIVSASGDQV  428

Query  235   --ITRFAGALSCKYGKPC  188
               ITRF+GAL+CK G+ C
Sbjct  429   TWITRFSGALNCKPGEAC  446



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 239/422 (57%), Positives = 295/422 (70%), Gaps = 14/422 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R  +A +Y M+++  +PE VT    A+V  +              N TRR+L+G
Sbjct  34    DEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIMGK----------NETRRNLKG  83

Query  1267  -KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
              KK+ GPC   NPID CWRCD +W  NR ++ DC  GFG  TTGGK GP YVVTD SD +
Sbjct  84    QKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGD  143

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             +  P+PGTLRHAVIQ GPLWI F+ +M I LQ EL+V SDKTIDGRGA V I  GA  T+
Sbjct  144   LVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDGACITI  203

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFVKNVIITN+ IK+IKA  GG+IRDS  H G RT  +GDGI+I+GSSN+WIDH+SM  C
Sbjct  204   QFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSSNIWIDHVSMENC  263

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+ID + GST +TISN HFT H++V+LFGA+N    DK+MQITVAFNHFGK L QRMP
Sbjct  264   TDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQITVAFNHFGKGLVQRMP  323

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EW  374
             RCR G FH++NNDYTHW MYA+GGS   TIISQGNR+IA    S  KE+T R++  + EW
Sbjct  324   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLN-SAAKEVTKREYTAEAEW  382

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K W W S+ D F+N AFF  SG P   ++  +LD++   P ++  K+T+FAGAL C  GK
Sbjct  383   KNWLWKSEGDLFMNGAFFVESGSP-ANLRADKLDMIPFKPGTYVTKLTKFAGALDCFVGK  441

Query  193   PC  188
             PC
Sbjct  442   PC  443



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 307/452 (68%), Gaps = 9/452 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ +S L +   F  +IP++   +G     D  W  R  EA +YA   +  HPE+VT   
Sbjct  5     KIKYSFLFLCITFATIIPSLMAHIGHY---DEVWRRRAEEAKEYARNIYEPHPENVTLAF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               ++     E    +      N TRR L  KK+ GPC   NPID+CWRCD +W  NRK++
Sbjct  62    NQKLRDTMKELKKVKGTHN--NSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKL  119

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA+GFG+   GGKDG +YVVTD+SD +  +PKPGTLRHAVIQ  PLWIIF   M I L
Sbjct  120   ADCAMGFGSKAIGGKDGEFYVVTDNSD-DYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRL  178

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               E+++ SDKTID RG  V I  GAG T+Q++KNVII  L I  I   +GG++RD+  H 
Sbjct  179   HQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHI  238

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDGI+IFG+S +WIDH+SM RC DG+IDAV+GST +TISN HFTDH++V+LFG
Sbjct  239   GIRTKSDGDGISIFGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFG  298

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++   ID+VMQIT+AFNHFGKRL QRMPRCRWG  H++NNDYTHW MYA+GGS   TII
Sbjct  299   ASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTII  358

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
              QGNR+IAPP   + K++T R++ P   W  WTW S+ + F+N A+FT SGDP+ + K+ 
Sbjct  359   HQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHK  417

Query  280   RL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L D +   P+     +TRFAG L CK GKPC
Sbjct  418   DLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 309/446 (69%), Gaps = 14/446 (3%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             +++V  +   ++P +   + +    D + + +  EA   +++AF   P +VT +    VH
Sbjct  9     VVMVLVSMAVLMPTLRAGIAEF---DDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVH  65

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                   +A E   E  N TRR L   K+ GPC A NPIDRCWRCD +W KNRK++A C L
Sbjct  66    ------LALEGI-EGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVL  116

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGGK G  YVVTD SDN++  P+PGTLR+  +Q  PLWIIF+ SM I L  EL+
Sbjct  117   GFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELM  176

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             +TS KTID RGA V I  GAG ++QF +NVII  L+I  + +T GG+IRD+A H GLRT 
Sbjct  177   ITSHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTV  236

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+IFGS+N+W+DHLSMS C+DG+IDA++GSTA+TISN HFT H+ V+LFGA++  
Sbjct  237   SDGDGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSY  296

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  297   QGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNR  356

Query  442   YIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAPP P+  ++IT+R++  +  WK WTW S+ D  +N A+F  SG+P     Y R D++
Sbjct  357   FIAPPNPAA-RQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSRFDMI  415

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P +   ++TRF+G+L+C  G+PC
Sbjct  416   KAKPGTFVRRLTRFSGSLNCYVGRPC  441



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/456 (55%), Positives = 307/456 (67%), Gaps = 19/456 (4%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAG----ELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M +SL++   +F  ++P +      + G I   D     R+  A   A+KA+   PE VT
Sbjct  4     MKFSLVLFMCSFCVILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVT  63

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNR  1187
               +  +V          E   E  N TRRHL  KK K  C A NPIDRCWRC+ DW KNR
Sbjct  64    DELIKDV----------ETSIERSNTTRRHL-AKKIKAECTATNPIDRCWRCNPDWAKNR  112

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
             K++A+C LGFG  T GGK GP YVV DSSDN+M  PKPGTLRHAVIQ GPLWIIF  SMT
Sbjct  113   KQLANCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSMT  172

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I L  EL++TS KTIDGRGA V I  GAG T+QFV+NVII  + I  I +  GG+IRDS 
Sbjct  173   IKLNKELIMTSHKTIDGRGANVHIAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSL  232

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H GLR   +GDGIT+FGSS++W+DHLSM  C DG+ D V+GSTA+TISNCHFT H+ V+
Sbjct  233   DHIGLRGQSDGDGITVFGSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVM  292

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGAN+    D++MQITVAFNHFGK L QRMPRCR+G FH++NNDYTHW+MYA+GGS+  
Sbjct  293   LFGANDLYERDQIMQITVAFNHFGKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHP  352

Query  466   TIISQGNRYIAPPGPSYFKEITHRDW--PNDEWKGWTWVSDRDEFVNDAFFTPSGDP-QG  296
             TIISQGNRY+APP P   KEIT R +  P   WK W W S+ D   N A+F  SG+P +G
Sbjct  353   TIISQGNRYVAPPDPK-LKEITSRAYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKG  411

Query  295   AVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                + R D+++  P S   ++TRFAG L C+ GK C
Sbjct  412   RGHFSRFDVINAKPGSFVRRLTRFAGTLGCRVGKAC  447



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/426 (56%), Positives = 295/426 (69%), Gaps = 8/426 (2%)
 Frame = -2

Query  1465  GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGT  1286
              +I   D YW  R+ EA+ Y  +A+   P +VT +   +VH           + + +N T
Sbjct  27    ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVH-------LHARNMKKLNST  79

Query  1285  RRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
             RR L GK   GPC A NPID CWRC  +W +NRKR+ADCA+GFG GTTGGKDG  YVVTD
Sbjct  80    RRGLLGKGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVTD  139

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
             SSDN+M+ PKPGTLRHAVIQ  PLWIIF+ SM I L  EL++T DKTID RGA V I  G
Sbjct  140   SSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHIAHG  199

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             AG T+QF+KNVII  L I +I    GG+IRDSA H GLRT  +GD I+IFG+SN+WIDH+
Sbjct  200   AGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDHV  259

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SM+R  DG+ID ++GSTA+TISNCH TDH++V LFGA N    D+ MQ+TVAFNHFGK L
Sbjct  260   SMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFGKGL  319

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP  386
              QRMPR R+G  H++NNDYTHW+MYA+GGS   TIISQGNR++AP  P + KE+T R+ P
Sbjct  320   VQRMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVAPFNP-FAKEVTKREAP  378

Query  385   NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSC  206
               EWK WTW+SD+D F+N AFF  SG         +  +   M  +  G++TR +G   C
Sbjct  379   ESEWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKNKAQMFSAMAGTKVGELTRCSGPRKC  438

Query  205   KYGKPC  188
               GKPC
Sbjct  439   TPGKPC  444



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 246/466 (53%), Positives = 320/466 (69%), Gaps = 26/466 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++ ++ V  +   V+P+V   + +    D YW  R+ EA+   ++++   P +VT
Sbjct  1     MVNLGSYVIVFVSLSLAVVVPSVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR----GKKFKG-PCKALNPIDRCWRCDKD  1202
                    H   H  +A E    + N TRR LR    GKK +G   ++LN ID+CWR +K+
Sbjct  58    D------HFNYHAALAMETT-GISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKN  110

Query  1201  WVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIF  1022
             W KNRK++ADC LGFG  TTGGK+GP YVVTD SDN++  PKPGTLR+AV +D PLWIIF
Sbjct  111   WDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIF  170

Query  1021  SASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGI  842
             +  M I LQ EL++T+DKTIDGRG  V I GGAG T+Q+V+NVII N+ IK+IK   GG+
Sbjct  171   ARHMIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGL  230

Query  841   IRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTD  662
             IRDS  H GLRT  +GDGI+IFG++NVWIDH+SM+ C DG+IDA+ GSTA+TISN HFTD
Sbjct  231   IRDSEHHFGLRTMSDGDGISIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTD  290

Query  661   HSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVG  482
             H +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA+G
Sbjct  291   HDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIG  350

Query  481   GSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD  305
             G+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  SG 
Sbjct  351   GNMNPTIISQGNRFIAPPNEDS-KQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGK  409

Query  304   -------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                    P+  +   R   + P P +   ++T+ AGAL CK GK C
Sbjct  410   ANAWSTAPKNPIP--RKFAIRPQPGTKVRRLTKDAGALGCKPGKSC  453



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   460 bits (1184),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 307/444 (69%), Gaps = 14/444 (3%)
 Frame = -2

Query  1516  VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             +V  +   ++P +   + +    D + + +  EA   +++AF   P +VT +    VH  
Sbjct  1     MVLVSMAVLMPTLRAGIAEF---DDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVH--  55

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                 +A E   E  N TRR L   K+ GPC A NPIDRCWRCD +W KNRK++A C LGF
Sbjct  56    ----LALEGI-EGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGF  108

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGK G  YVVTD SDN++  P+PGTLR+  +Q  PLWIIF+ SM I L  EL++T
Sbjct  109   GRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMIT  168

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             S KTID RGA V I  GAG ++QF +NVII  L+I  + +T GG+IRD+A H GLRT  +
Sbjct  169   SHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSD  228

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI+IFGS+N+W+DHLSMS C+DG+IDA++GSTA+TISN HFT H+ V+LFGA++    
Sbjct  229   GDGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQG  288

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             D +MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR+I
Sbjct  289   DSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFI  348

Query  436   APPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDP  260
             APP P+  ++IT+R++  +  WK WTW S+ D  +N A+F  SG+P     Y R D++  
Sbjct  349   APPNPAA-RQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSRFDMIKA  407

Query  259   MPSSHAGKITRFAGALSCKYGKPC  188
              P +   ++TRF+G+L+C  G+PC
Sbjct  408   KPGTFVRRLTRFSGSLNCYVGRPC  431



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 258/471 (55%), Positives = 312/471 (66%), Gaps = 28/471 (6%)
 Frame = -2

Query  1522  LLVVFF-AFG-AVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHV--TRNIT  1355
             L+ VF  AF   V+P +    G   + + YW  R  EA ++ +KA+  +P  V    N  
Sbjct  8     LVCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNKQ  67

Query  1354  AEVHSMRHETMAFEDDREVVN---------------GTRRHLRGKKFKGPCKALNPIDRC  1220
             A  + M  +T A +D    +N                TRR LRGKK+ G C A NPIDRC
Sbjct  68    ASENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATNPIDRC  127

Query  1219  WRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDG  1040
             WRC  +W  NRKR+ADC +GFG GTTGGK+G +YVVTDSSD+ +  PKPGTLRHAVIQ  
Sbjct  128   WRCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKE  187

Query  1039  PLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIK  860
             PLWIIF   M I L  EL++  DKTIDGRG  V I  GAG T+QFVKNVII  L I  I 
Sbjct  188   PLWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDIH  247

Query  859   ATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTIS  680
               SGG++RDS  H G+RT  +GDGI+IFGSSNVWIDH+SM +C DG+IDAV+ STA+TIS
Sbjct  248   QGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDHVSMWKCYDGLIDAVEASTAITIS  307

Query  679   NCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHW  500
             N HFTDH++V+LFGA++    D VMQITVAFNHFGKRL QRMPRCRWG  H++NNDYTHW
Sbjct  308   NSHFTDHNEVMLFGASDSQSKDAVMQITVAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHW  367

Query  499   EMYAVGGSAGSTIISQGNRYIAPPGPSYFKE-----ITHRDWPND-EWKGWTWVSDRDEF  338
             EMYA+GGS    IISQGNR+IAP  P  FK+     +T RD+  +  WK WTW S+ D F
Sbjct  368   EMYAIGGSQHPIIISQGNRFIAP--PDIFKKEVRRTVTKRDYAEEARWKEWTWRSEGDLF  425

Query  337   VNDAFFTPSGDPQGAVKYGRL-DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +N AFF  SGDP    K+  + D + P  SS    ITRFAGAL C+ G PC
Sbjct  426   MNGAFFVQSGDPDFTKKHPEIFDGIAPADSSEVTWITRFAGALMCRPGSPC  476



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   461 bits (1185),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 306/463 (66%), Gaps = 30/463 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
              V+ F F ++          +   D YW  R+A A+   ++ +  +P +VT       H 
Sbjct  13    FVLCFLFSSISDVAQPVKAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTD------HF  66

Query  1339  MRHETMAFEDDREVVNGTRRHL-----RGKKFK----GPCKALNPIDRCWRCDKDWVKNR  1187
               H  +A E+  E  NGTRR L      GK  K    G C A NPIDRCWRC  +W K+R
Sbjct  67    NHHVNLAVEEATEASNGTRRELWQVGSGGKHLKRRNTGKCVAYNPIDRCWRCQPNWAKDR  126

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
             K++ADC LGFG  TTGGK G YYVVTD+SD ++  P+PGTLRHAV +D PLWI+F  SM 
Sbjct  127   KKLADCVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSMV  186

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I L  EL++TS+KTIDGRG  V I GGAG TVQFV NVII N+ IK I   +GG+IRDS 
Sbjct  187   IRLAQELIITSNKTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSE  246

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
             TH GLRT  +GDGI IFG++NVWIDH+SM+ C DG+IDA++GST +TISNCH TDH +V+
Sbjct  247   THFGLRTRSDGDGINIFGATNVWIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVM  306

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGA + D ID  MQITVAFNHFGKRL QRMPRCR+GL H++NNDYTHWEMYA+GG+   
Sbjct  307   LFGATDKDEIDTKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNP  366

Query  466   TIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD-----  305
             TIISQGNR+IAPP     K++T R++ P  EWK W W S+ D F+N A+F  SG      
Sbjct  367   TIISQGNRFIAPPNEQA-KQVTKREYTPYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWS  425

Query  304   --PQGAV--KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               P+  V  K+     + P P +   K+T  +G L CK GKPC
Sbjct  426   VAPKNPVPSKFA----IRPQPGTLVRKLTMNSGVLGCKKGKPC  464



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   459 bits (1182),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 312/453 (69%), Gaps = 25/453 (6%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N  LL++F    +++P +   + +    D Y   +  E ++ +++A+T +PE VT     
Sbjct  7     NSILLILFIWLASLVPHIHARIAEF---DAYLEKQALEDLNSSLEAYTHNPEEVTNAFNK  63

Query  1351  EVHS--MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
             EV +  ++++++            RR+L   K K  C A NPIDRCWRCDK+W +NR  +
Sbjct  64    EVGNALLKYKSL------------RRNL---KEKNKCMATNPIDRCWRCDKNWAENRMDL  108

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
              +CA GFG  TTGGK+G YYVVTD SD+ ++EPKPGTLRHAVIQ+ PLWIIF  SM I L
Sbjct  109   EECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKL  168

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             Q EL++TSDKTIDGRG  V I  GAG T+QFV NVII N++I+ I +T+GG+IRDS  H 
Sbjct  169   QQELMITSDKTIDGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHI  228

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI+IFGS+++WIDH ++S C DG++DA+  STA+TISNC F  H+ V+L G
Sbjct  229   GLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLG  288

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A +  P D +MQ+TVAFN FG+ L QRMPRCRWG FH++NNDYTHW+MYA+GGSA  TII
Sbjct  289   ATDAFPQDSIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTII  348

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+ A   P+  K++T RD+ P  EWK W WVS+ D F+N A+F  SG PQ   K  
Sbjct  349   SQGNRFKAADNPNT-KQVTKRDYAPESEWKKWQWVSEGDSFLNGAYFVESG-PQDKKKTA  406

Query  280   --RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               +   +   P SHAG++TRFAG L CK G PC
Sbjct  407   LTKNHKIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 242/458 (53%), Positives = 313/458 (68%), Gaps = 20/458 (4%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNIT  1355
             +N     + F    ++P V     ++   D YW  R+ +A+   + ++  +P +VT    
Sbjct  6     LNIGGYTLVFLLAILVPHVQS---NVAVFDNYWTQRQGDALKQTIASYDPNPLNVTD---  59

Query  1354  AEVHSMRHETMAFEDDREVVNGTRRHLRGKKFK---GPCKALNPIDRCWRCDKDWVKNRK  1184
                H   H  +A  D  E  N TRR L G+K +   G C A NPID+CWRCD +W KNRK
Sbjct  60    ---HLNYHVALAV-DATESTNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEKNRK  115

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             ++A+C LGFG  TTGGKDGP YVV DSSD+++  PKPGTLRHAV +DGPLWIIF+ SM I
Sbjct  116   KLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVI  175

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              LQ EL++TS+KTIDGRGA V I+ G G T+QFV NVII N+ +K I   +GG+IRDS  
Sbjct  176   KLQQELMITSNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEE  235

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H G+RT  +GDGI++FG++NVWIDH+SM+RC DG+IDA++GSTAVTISN HFTDH +V+L
Sbjct  236   HVGIRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVML  295

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA +   IDK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   T
Sbjct  296   FGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  355

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             IISQGNR+IAPP     KE+T R++ +  +WK W W S+ D F+N A+F  SG P     
Sbjct  356   IISQGNRFIAPPNEQA-KEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSP  414

Query  286   YGRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
               +  +     + P P +   ++T  AGAL C+ GK C
Sbjct  415   KPKNPVPSKFAIRPKPGTMVRELTMDAGALGCEAGKAC  452



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 307/451 (68%), Gaps = 18/451 (4%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+N  +L VF     +   V   + D    D +W  R AEA   A +A+   P  VT + 
Sbjct  7     KLNVVILCVFVIAITIPTTVRANIADF---DEHWQQRAAEAKKAAHEAYHDDPIAVTEHF  63

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               +V           D  +  N TRR+L  +K+KGPC A NPIDRCWRCD +W KNRKR+
Sbjct  64    NKQV----------LDTFDYANNTRRNL-NQKYKGPCMATNPIDRCWRCDPNWEKNRKRL  112

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCALGFG   TGGK GP YVVTD++D ++  PKPGTLRHAVIQ+GPLWIIF+  M I L
Sbjct  113   ADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKL  172

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               ELLV SDKTID RGA V I+ GA  ++QFVKNVIITNL I   K  +GG+IRDS  H 
Sbjct  173   TEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHF  232

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G RT  +GDGI++FG++NVWIDH+S+S C DG+IDA++GSTA+TISNCH T+H+ V+LFG
Sbjct  233   GQRTRSDGDGISMFGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFG  292

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             +++ +  D+VMQIT+AFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TII
Sbjct  293   SSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTII  352

Query  457   SQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+IAP   +  KE+THR+   + EW+ W W S+ D  +N AFF  SG P       
Sbjct  353   SQGNRFIAPSNQAT-KEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP--IRNLP  409

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + D++   P S   ++TRFAG L C   KPC
Sbjct  410   KADMIQAKPGSFVTRLTRFAGPLKCVKNKPC  440



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 307/445 (69%), Gaps = 17/445 (4%)
 Frame = -2

Query  1510  FFAFGAVIPAVAGELGDIHSSDL--YWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
              F F  V  A A    + H +D   YW  +   A   A  ++   PE VTR+    V   
Sbjct  7     LFFFSLVFLASAA-FANAHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAV---  62

Query  1336  RHETMAFEDDREVVNGTRRHLRG-KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                   +ED +   N TRR LRG K+  GPC A NPIDRCWRC+++W+ +RK++A CA G
Sbjct  63    ------YEDAQ--TNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCAKG  114

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  T GGK+G +YVVTD+SD+++  PK GTLR+ VIQD PLWI+F+  M I L  EL+V
Sbjct  115   FGRHTIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIV  174

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
              S KTIDGRGA V+I+GGAG T+Q+V NVI+ NL I+ IKA +GG+IRDS  H GLRT  
Sbjct  175   NSYKTIDGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRS  234

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+I+GSSN+WIDH+SMS C DG+IDA++GSTA+TISN HFT H++ +LFGA++   
Sbjct  235   DGDGISIYGSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYS  294

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D +MQITVAFNHFGK L QRMPRCRWG  H++NNDYTHWEMYAVGGS   TIISQGNRY
Sbjct  295   PDAIMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRY  354

Query  439   IAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAP  P + KE+T RD+  +  WK WTW S+ D  +N AFF  SG   G  KY + D++ 
Sbjct  355   IAPSNP-FAKEVTKRDYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKYDKTDIIK  413

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P S   ++TR++GAL C   +PC
Sbjct  414   AKPGSFVTRLTRYSGALDCFPQRPC  438



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   459 bits (1182),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/421 (55%), Positives = 295/421 (70%), Gaps = 13/421 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R   A      A+   P  V+ N+++ V     E +  +D        RR+L+G
Sbjct  39    DPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVS----ELIVGKD-------KRRNLKG  87

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
             +++ GPC A NPIDRCWRCD +W  NR+++ADC  GFG  T GGK GP+YVVTD SD+ M
Sbjct  88    QRYTGPCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDNM  147

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
              + KPGTLRHAV + GPLWIIF  SM I L+ EL++TSDKTIDGRG  V I  GAG TVQ
Sbjct  148   VDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYIASGAGITVQ  207

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             F++NVII  +K+  I+   GG+IRDS TH GLRT  +GDGI+IFGSSN+WIDH+SM  C 
Sbjct  208   FIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDHVSMRNCY  267

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA+ GSTA+TISN HFTDH++ +LFGA++    DK+MQIT+AFNHFGKRL QRMPR
Sbjct  268   DGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFGKRLVQRMPR  327

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWK  371
             CR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+I P    + KEIT R++ P  EW 
Sbjct  328   CRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDN-VHAKEITKREYSPESEWS  386

Query  370   GWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKP  191
              W W S  DE++N AFF  SG       + R D++   P S+ G++TR+AG+LSC+ G P
Sbjct  387   SWQWRSINDEYMNGAFFVQSGPELVDRPFSRQDMIKAKPGSYVGRLTRYAGSLSCRVGLP  446

Query  190   C  188
             C
Sbjct  447   C  447



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   459 bits (1181),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 298/456 (65%), Gaps = 11/456 (2%)
 Frame = -2

Query  1543  FNKMNWSLLVVF-FAFGAVIP-AVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHV  1370
              N  +  L V+F FAF + +P AV   + +    D  W  R  EA +  ++++   P  +
Sbjct  1     MNTAHICLSVLFLFAFASTLPGAVRAHIAEF---DEVWQRRAEEAWNRTLESYEPAPAKI  57

Query  1369  TRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKN  1190
               ++   VH    E    +++   +N TRR L    + GPC+  NPIDRCWRC  +W +N
Sbjct  58    VSHLNLNVHRALKEV---KEEELSLNSTRRQL-SHGYDGPCRVTNPIDRCWRCQANWAQN  113

Query  1189  RKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASM  1010
             R R+ADC LGFG    GGK+G  YVVTD SDN+M  PKPGTLRHAVIQ  PLWIIF   M
Sbjct  114   RFRLADCVLGFGYKAKGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDM  173

Query  1009  TITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDS  830
              I L  EL+V SDKTIDGRGA V I  GAG T+QFVKNVII  +KI  I    GG+IRD+
Sbjct  174   LIRLSQELIVQSDKTIDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDA  233

Query  829   ATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKV  650
               H GLRT  +GDGI+IFGS ++WIDH+SM  C DG+ID + GST VT+SN HFTDH++ 
Sbjct  234   VDHYGLRTRSDGDGISIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEA  293

Query  649   LLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAG  470
             +LFGA++    D  MQ+TVAFNHFGKR+ QRMPR R+G  H++NNDYTHW MYAVGGS  
Sbjct  294   MLFGASDSHTQDVKMQVTVAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKN  353

Query  469   STIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGA  293
               IISQGNRYIAPP   Y KE+T R++ P   WK W W S+ D F   AFF  SGDP   
Sbjct  354   PIIISQGNRYIAPPTNPYAKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYT  413

Query  292   VKY-GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              K+  + DL+   P+ +  +IT+FAGAL CK G PC
Sbjct  414   SKHPEKYDLIQAAPAQNVAEITKFAGALGCKVGVPC  449



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   459 bits (1180),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 306/445 (69%), Gaps = 11/445 (2%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             +++  AF   IP + G +G+    D +   +  EA + A++++   P ++T ++   VH 
Sbjct  10    IIILVAFAITIPCLEGGIGEF---DDFLKGQALEAHEIALESYVPDPVNMTDDLNINVHG  66

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                E       +E  N TRR L+ +K+ GPC ALNPIDRCWRC K W KNR ++A CA G
Sbjct  67    ALTEVF-----KEESNHTRRELK-QKYGGPCLALNPIDRCWRCKKGWAKNRFKLAHCAKG  120

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG   TGG +G  Y+V D SD++   PKPGTLR  V+Q  PLWIIF+ SM I L +ELL+
Sbjct  121   FGRKATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLNYELLI  180

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             +SDKTIDGRGA V I  G+G T+QFV NVII  L+++ IK+T GG IRDS  H G+RT  
Sbjct  181   SSDKTIDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKA  240

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GD I+IFGSSN+WIDHLS+S CEDG++D ++GST +TISNCH T H+ V+LFGA++   
Sbjct  241   DGDAISIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFT  300

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              DK+MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TI+SQGNR+
Sbjct  301   GDKIMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRF  360

Query  439   IAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAP   +  KE+THRD+     W+ W W S+ D F+N A F  SG P G + + +  L+ 
Sbjct  361   IAPNNNAA-KEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPFNKGFLMK  419

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
             P   S A ++TRFAGAL+CK   PC
Sbjct  420   PRHGSQANRLTRFAGALNCKANSPC  444



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   459 bits (1180),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 305/445 (69%), Gaps = 15/445 (3%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
              +   AF   IP +   + +    D +   +  EA + A++++   P     N+TAE + 
Sbjct  10    FIFLVAFAISIPCLEAGIAEF---DDFLKAQADEAHEIALRSYEPDP----INVTAEFNI  62

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
               H  +  E      N TRR L+ +K++GPC A NPIDRCWRC KDW ++R R+A C  G
Sbjct  63    HVHRALMEES-----NDTRRELK-QKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKG  116

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG    GG  G  YVVTDSSD+E   P+PGTLR+ V+Q  PLWIIF+ SM ITL+ ELL+
Sbjct  117   FGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLI  176

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             +SDKTIDGRGA V I GGAG  +QFV N+II  ++I +IK+  G ++RD   H G+RT  
Sbjct  177   SSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRC  236

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GD ++IFGSSN+W+DHLS+S CEDG+ID V+GST +TISNCH T H+ V+LFGA++   
Sbjct  237   DGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYA  296

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              DK+MQ+TVAFNHFG+ L QRMPRCRWG  H+INNDYTHW MYA+GGS+  TI+SQGNR+
Sbjct  297   GDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRF  356

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAP   +  KEITHRD+ P +EW  W W S+ D F+N A F  SG P G + + +  ++ 
Sbjct  357   IAPNNNAA-KEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGSPLGKLPFNKGLMMK  415

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
             P P + A ++TRFAGAL+CK GKPC
Sbjct  416   PRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 307/451 (68%), Gaps = 18/451 (4%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+N  +L VF     +   V   + D    D +W  R AEA   A +A+   P  VT + 
Sbjct  5     KLNVVILCVFVTAITIPTTVRANIADF---DEHWQQRAAEAKKAAHEAYHDDPIAVTEHF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
               +V           D  +  N TRR+L  +K+KGPC A NPIDRCWRCD +W KNRKR+
Sbjct  62    NKQV----------LDTFDYANNTRRNL-NQKYKGPCMATNPIDRCWRCDPNWEKNRKRL  110

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCALGFG   TGGK GP YVVTD++D ++  PKPGTLRHAVIQ+GPLWIIF+  M I L
Sbjct  111   ADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKL  170

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               ELLV SDKTID RGA V I+ GA  ++QFVKNVIITNL I   K  +GG+IRDS  H 
Sbjct  171   TEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHF  230

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G RT  +GDGI+++G++NVWIDH+S+S C DG+IDA++GSTA+TISNCH T+H+ V+LFG
Sbjct  231   GQRTRSDGDGISMYGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFG  290

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             +++ +  D+VMQIT+AFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TII
Sbjct  291   SSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTII  350

Query  457   SQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+IAP   +  KE+THR+   + EW+ W W S+ D  +N AFF  SG P       
Sbjct  351   SQGNRFIAPSNQAT-KEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP--IRNLP  407

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + D++   P S   ++TRFAG L C   KPC
Sbjct  408   KADMIQAKPGSFVTRLTRFAGPLKCIKNKPC  438



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   458 bits (1179),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 246/451 (55%), Positives = 317/451 (70%), Gaps = 10/451 (2%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+NW L ++FF   +++P +   + +    D  W  R AEA +  ++A+   P  V  + 
Sbjct  5     KVNW-LPILFFVVASILPVLRANIAEY---DEVWRRRAAEAYNRTLQAYEPDPLKVVMHF  60

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
                VH  RH   +   D  ++N TRR L GKK++GPCK  NPID CWRCD +W  NR ++
Sbjct  61    NENVH--RHIKESGGVDMMMLNSTRRRL-GKKYRGPCKVTNPIDACWRCDPNWHLNRFKL  117

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADC+LGFG   TGGK G  YVVTD SD+++  PKPGTLRHAVIQ+ PLWI F  SM ITL
Sbjct  118   ADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSMVITL  177

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
               EL++TSDKTIDGRG  V+I  GAG TVQ+V+N+II N+KI  I    GGIIRDS TH 
Sbjct  178   AQELIMTSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHS  237

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI+IFG+ ++WIDH+SM+RC+DG+IDA++GSTA+TISN HFTDH   +LFG
Sbjct  238   GLRTQSDGDGISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFG  297

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             AN+  P D+ MQITVAFNHFGKR+ QRMPRCR+G FH++NNDYTHW+MYA+GGS+  TII
Sbjct  298   ANDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTII  357

Query  457   SQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY-G  281
             SQGNRYIA     Y K++T R+ P  EW+ WTWV+D D F+N A+F  SGD     K+  
Sbjct  358   SQGNRYIA--DHPYAKQVTKRECPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKHPE  415

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + D + P P++   ++T+FAG L CK    C
Sbjct  416   KSDGIKPGPATLVAQMTQFAGRLDCKKKYAC  446



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   458 bits (1178),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 305/445 (69%), Gaps = 15/445 (3%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
              +   AF   IP +   + +    D +   +  EA + A++++   P     N+TAE + 
Sbjct  10    FIFLVAFAISIPCLEAGIAEF---DDFLKAQADEAHEIALRSYEPDP----INVTAEFNI  62

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
               H  +  E      N TRR L+ +K++GPC A NPIDRCWRC KDW ++R R+A C  G
Sbjct  63    HVHRALMEES-----NDTRRELK-QKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKG  116

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG    GG  G  YVVTDSSD+E   P+PGTLR+ V+Q  PLWIIF+ SM ITL+ ELL+
Sbjct  117   FGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLI  176

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             +SDKTIDGRGA V I GGAG  +QFV N+II  ++I +IK+  G ++RD   H G+RT  
Sbjct  177   SSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRC  236

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GD ++IFGSSN+W+DHLS+S CEDG+ID V+GST +TISNCH T H+ V+LFGA++   
Sbjct  237   DGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYA  296

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              DK+MQ+TVAFNHFG+ L QRMPRCRWG  H+INNDYTHW MYA+GGS+  TI+SQGNR+
Sbjct  297   GDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRF  356

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAP   +  KEITHRD+ P +EW  W W S+ D F+N A F  SG P G + + +  ++ 
Sbjct  357   IAPNNNAA-KEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGAPLGKLPFNKGLMMK  415

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
             P P + A ++TRFAGAL+CK GKPC
Sbjct  416   PRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   458 bits (1178),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 298/447 (67%), Gaps = 17/447 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
                +F +    +P + G +G+    D YW  +  EA   A +AF   P +VT     +V+
Sbjct  10    FFSLFVSLAVFVPTLQGHIGEF---DEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVN  66

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
              +  ET          N TRR L  K+  G C A NPIDRCWRCD +W  +R+++ADC L
Sbjct  67    KVLTET----------NSTRRSLVRKR-GGRCIATNPIDRCWRCDPNWASHRQKLADCVL  115

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  T GGK G  YVVTD+SDN+M  PKPGTLRHAVIQ  PLWIIFS SM I L  EL+
Sbjct  116   GFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELM  175

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             V S+KTID RG  V I  GAG T+QF +NVII  L+I  I + SGG+IRDS  H G RT 
Sbjct  176   VASNKTIDSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTK  235

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+IFGSSN+WIDH+SMS C+DG+ID + GS A+TISN HFT H++V+LFGA++  
Sbjct  236   SDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSY  295

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQITV+FNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR
Sbjct  296   SGDSIMQITVSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNR  355

Query  442   YIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDP-QGAVKYGRLDL  269
             +IA PG ++ KE+T RD+    EWK W W SD D  +N AFF  SG P   + +  R  +
Sbjct  356   FIA-PGNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHV  414

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             +   P +   ++TRF+G+L C  GKPC
Sbjct  415   MKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   457 bits (1176),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 243/423 (57%), Positives = 298/423 (70%), Gaps = 14/423 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW +R  +A   A++A+  HPE VT  +  +V          E+   V N TRR LRG
Sbjct  10    DDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDV----------EEALTVKNSTRRVLRG  59

Query  1267  KKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
             KK K  GPC A NPIDRCWRCD +W  NRKR+ADCA GFG  + GGK G YYVVTDSSD 
Sbjct  60    KKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYYVVTDSSDT  119

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             ++  PKPGTLRHAVIQ  PLWIIF+ SM I L  EL++T DKTIDGRGA V+I  GAG T
Sbjct  120   DLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVRIAYGAGIT  179

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +QFVKNVII N+ I  I A SGG IRDS  H G RT  +GDGI+IFGSS++WIDH+SMS 
Sbjct  180   IQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIWIDHVSMSN  239

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             C+DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+ MQ+TVAFNHFG+ L QRM
Sbjct  240   CQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHFGQGLVQRM  299

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDE  377
             PRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR+IAP   +  K++T RD+ P  +
Sbjct  300   PRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNA-KQVTKRDYAPESD  358

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             WK W W S+ D  +N AFF  SG      +Y R  ++   P +   ++TR+AG L C  G
Sbjct  359   WKNWRWRSEGDLLMNGAFFVQSGKRLSKRRYSRPGMIKYKPGTFVTRLTRYAGTLVCGIG  418

Query  196   KPC  188
             +PC
Sbjct  419   RPC  421



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   457 bits (1177),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 231/421 (55%), Positives = 291/421 (69%), Gaps = 14/421 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R + A     +A+T  P  +T+N+T  V  +            ++         
Sbjct  26    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEI------------IIGEKNGRRNL  73

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
             +   G C A NPIDRCWRCD +W  NRK++ADC  GFG  T GGK+GP+YVV  S DN+M
Sbjct  74    RGRGGKCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDM  133

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
               P PGTLRHAV + GPLWIIF+ SM I L  EL++TSDKTIDGRG  V I  GAG T+Q
Sbjct  134   VNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQ  193

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             F+KNVII  +KI  I+  +GG+IRDS TH G RT+ +GDGI+IFGSSNVWIDH+SM  C+
Sbjct  194   FIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCK  253

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+AFNHFGKRL QRMPR
Sbjct  254   DGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPR  313

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWK  371
             CR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IA P   Y KEIT R++ P  EWK
Sbjct  314   CRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PNNVYAKEITKREYSPEQEWK  372

Query  370   GWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKP  191
              W W S  DE++N AFF   G       + R D++   P S+ G++TR+AG+L C  GKP
Sbjct  373   NWQWRSINDEYMNGAFFREGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKP  432

Query  190   C  188
             C
Sbjct  433   C  433



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 310/460 (67%), Gaps = 21/460 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH-  1343
              +  F FG + P +   + D+   D  W  R  EA    M+A+   P  VT  +  +V+ 
Sbjct  8     FMFVFWFGFITPNL---MADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNH  64

Query  1342  ----------SMRHE--TMAFEDDREVVNGTRRHLRGKK--FKGPCKALNPIDRCWRCDK  1205
                       ++ H   T  FE   E  N TRR L+ KK  + GPC+A NPID+CWRC K
Sbjct  65    QIDGNAKTNSTINHTKGTNNFETGAEA-NNTRRSLKQKKQKYNGPCQANNPIDKCWRCRK  123

Query  1204  DWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWII  1025
             +WVK+R+R+A CALGFG  TTGGK G  YVVTD+SD++  EPKPGTLRHAVIQ  PLWII
Sbjct  124   NWVKDRQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWII  183

Query  1024  FSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGG  845
             F+  M I L  EL++  +KTIDGRG  V I  GAG T+QFV N+II  L+I  I +T GG
Sbjct  184   FACDMNIKLSQELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGG  243

Query  844   IIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFT  665
             +IRDS  H GLRT  +GDGI+IFGS+NVWIDH+SMS C+DG+IDA++GSTA+TISNCHF+
Sbjct  244   MIRDSVDHVGLRTASDGDGISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFS  303

Query  664   DHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAV  485
             +H+  +L GA++    D+ MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW +YA+
Sbjct  304   NHNDAILLGASDSFSGDQFMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAI  363

Query  484   GGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG  308
             GGS   TI+SQGN+++AP    Y KE+T RD+ P  EWK W W S+ D  VN AFF  SG
Sbjct  364   GGSMHPTIVSQGNQFVAPD-DKYIKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESG  422

Query  307   DPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +P   ++  +  ++       A ++TRFAGAL CKYGK C
Sbjct  423   EPALHLRPSKKFMIKAKHGRFATQMTRFAGALDCKYGKKC  462



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   455 bits (1170),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 281/376 (75%), Gaps = 4/376 (1%)
 Frame = -2

Query  1306  REVVNGT--RRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggk  1133
             R ++ G   RR+LRG+K  GPC A NPIDRCWRCD +W  NRK++ADC  GFG  TTGGK
Sbjct  2     RMIIGGKKGRRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGK  61

Query  1132  dGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGR  953
              GP+YVVTD SD++M  P+PGTLRHAV ++GPLWIIF+ SM I L  EL++TSDKTIDGR
Sbjct  62    AGPFYVVTDPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGR  121

Query  952   GAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFG  773
             GA + I  GAG T+Q+++NVII  +K+  I   SGG++RDS  H GLRT  +GDGI+IFG
Sbjct  122   GADIVIANGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFG  181

Query  772   SSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITV  593
             SSN+WIDH+SM  C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    D+ MQITV
Sbjct  182   SSNIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITV  241

Query  592   AFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYF  413
             AFNHFGKRL QRMPRCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IAP    Y 
Sbjct  242   AFNHFGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDN-GYA  300

Query  412   KEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGK  236
             KEIT R++ P  EWK W W S  D ++N AFF   G       + + D++   P ++ G+
Sbjct  301   KEITKREYSPESEWKNWQWRSINDVYMNGAFFRQGGSELTNRPFSKKDMITAKPGAYVGR  360

Query  235   ITRFAGALSCKYGKPC  188
             +TR++G+L C  GKPC
Sbjct  361   LTRYSGSLKCIVGKPC  376



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 301/458 (66%), Gaps = 17/458 (4%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M  KM   LL +  AF   +P+++    D   SD YWV R  +A +  ++++  HP  + 
Sbjct  1     MVRKM--GLLFLSIAFAYALPSISANFLD---SDEYWVKRSVQAWNNTLESYEPHPAKIV  55

Query  1366  RNITAEVHSMRHETMAFED--DREVV-NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWV  1196
              ++        H T A E+  D E+V N +RRHL    + GPC A NPIDRCWRC  +W 
Sbjct  56    SHLNL------HSTRALEEIKDLELVSNSSRRHL-AHGYDGPCMATNPIDRCWRCQANWA  108

Query  1195  KNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSA  1016
              NR R+ADC LGFG    GGK G  YVV DSSD++M  P PGTLRHAVIQ  PLWIIFS 
Sbjct  109   DNRFRLADCGLGFGYKAKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSR  168

Query  1015  SMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIR  836
             SM I L  EL++ SDKTIDGRG  V I GGAG T+QFVKN+II  L I  I    GG+IR
Sbjct  169   SMVIRLSQELIMQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIR  228

Query  835   DSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHS  656
             DS  H G RT  +GDGI+I+G+ ++WIDH+SM+ C DG+IDA+ GST +TISN HFTDH+
Sbjct  229   DSVDHYGFRTRSDGDGISIYGAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHN  288

Query  655   KVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGS  476
             + +LFGA++    D  MQITVAFNHFGKRL QRMPRCR+G  H++NNDYTHW MYA+GGS
Sbjct  289   EAMLFGASDSHTQDVKMQITVAFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGS  348

Query  475   AGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQ  299
                 IISQGNR+IAPP   + KE+T R++ P   W  W W S+ D F+  AFF  SGDP 
Sbjct  349   KNPIIISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPT  408

Query  298   GAVKY-GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                K+  + DL+    ++    +T+FAGAL CK G+ C
Sbjct  409   YTSKHPEKYDLIQAASATQVEIMTKFAGALGCKIGQVC  446



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/421 (55%), Positives = 291/421 (69%), Gaps = 14/421 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R + A     +A+T  P  +T+N+T  V  +            ++         
Sbjct  41    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEI------------IIGEKSGRRNL  88

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
             +   G C A NPIDRCWRCD +W  NRK++ADC  GFG  T GGK+GP+YVV  S DN+M
Sbjct  89    RGRGGKCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDM  148

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
               P PGTLRHAV + GPLWIIF+ SM I L  EL++TSDKTIDGRG  V I  GAG T+Q
Sbjct  149   VNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQ  208

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             F+KNVII  +KI  I+  +GG+IRDS TH G RT+ +GDGI+IFGSSNVWIDH+SM  C+
Sbjct  209   FIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCK  268

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+AFNHFGKRL QRMPR
Sbjct  269   DGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPR  328

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWK  371
             CR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IA P   Y KEIT R++ P  EWK
Sbjct  329   CRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PNNVYAKEITKREYSPEQEWK  387

Query  370   GWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKP  191
              W W S  DE++N AFF   G       + R D++   P S+ G++TR+AG+L C  GKP
Sbjct  388   NWQWRSINDEYMNGAFFREGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKP  447

Query  190   C  188
             C
Sbjct  448   C  448



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   457 bits (1176),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 247/468 (53%), Positives = 317/468 (68%), Gaps = 28/468 (6%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M N  ++  + V  +   V+P+V      I   D YW  R+  A+   ++++  +P++VT
Sbjct  1     MLNLGSYVFVFVSLSLTVVVPSVQAH---IAVYDDYWTQRQTIALRQTLESYDPNPDNVT  57

Query  1366  RNITAEVHSMRHETMAFEDDREVVNGTRRHLR----GKKFK---GPCKALNPIDRCWRCD  1208
                    H   H  +A E    +VN TRR LR    GKK     G  ++LN ID+CWR D
Sbjct  58    D------HFNYHAALAMETT-GIVNETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGD  110

Query  1207  KDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWI  1028
             K+W KNRK++ADC LGFG  TTGGK+GP YVVTD SDN++  PKPGT+RHAV +D PLWI
Sbjct  111   KNWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWI  170

Query  1027  IFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSG  848
             +F+ SM I LQ EL++T+DKTIDGRGA + I GGAG T+QFV+NVII N+ IK IK   G
Sbjct  171   VFARSMIIKLQQELIITNDKTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVG  230

Query  847   GIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHF  668
             G+IRDS  H G RT  +GDGI IFG++NVWIDH+SM+ C DG+IDA+ GSTA+TISN HF
Sbjct  231   GVIRDSEHHYGHRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHF  290

Query  667   TDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYA  488
             TDH +V+LFG  N D IDK MQITVAFNHFGKRL+QRMPR R+GL H++NNDYTHWEMYA
Sbjct  291   TDHDEVMLFGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYA  350

Query  487   VGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPS  311
             +GG+   TIISQGNR+IAPP     K++T R++ P  EWK W W S++D F+N A+F  S
Sbjct  351   IGGNMNPTIISQGNRFIAPPIEDS-KQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQS  409

Query  310   GD-------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             G        P+  +   R   + P P +   ++T+ AG L CK GK C
Sbjct  410   GKANAWSSTPKNPIP--RKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   457 bits (1176),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 313/465 (67%), Gaps = 26/465 (6%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
              N  ++ ++ V  +   V P+V   +      D YW  R+A A+   M+++  +P +VT 
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTN  62

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHL----RGKKFKGP-CKALNPIDRCWRCDKDW  1199
                   H   H  +A E      NGTRR L     G+K +G   K+LN IDRCWR DK+W
Sbjct  63    ------HFNYHAALAMETT-GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNW  115

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
              KNRK++ADC LGFG  TTGGK+GP YVVTD+SD+++  PKPGTLRHAV +D PLWIIF+
Sbjct  116   AKNRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFA  175

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              +M I LQ EL++T+DKTIDGRG  V I GGAGFT+QFVKNVII N+ +K IK   GG+I
Sbjct  176   RTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLI  235

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS  H GLRT  +GDGI IFG++N+WIDH+SM  C DG+IDA+ GSTA+TISN HFTDH
Sbjct  236   RDSEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDH  295

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
              +V+LFGA N D  DK MQITVAFNHFGKRL QRMPR R+G+ H++NNDYTHWEMYA+GG
Sbjct  296   KEVMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGG  355

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGD-  305
             +   TIISQGNR+IAPP     K++T R++    EWK W W S+RD F+N A+F  SG  
Sbjct  356   NMNPTIISQGNRFIAPPKED-CKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKS  414

Query  304   ------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                   P+  +   +   + P P +    +T+ AG L C+ GK C
Sbjct  415   NAWSAAPKNPIP--KEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   456 bits (1172),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 238/426 (56%), Positives = 296/426 (69%), Gaps = 18/426 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I + D YW  R  EA + + +A+  +PE V ++   EVH             E  N TRR
Sbjct  10    IANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHK----------SLEGGNSTRR  59

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
             +L   K+KGPC A NPIDRCWRCDK+W KNRK++  CALGFG  T GGK+G YY VTD S
Sbjct  60    NL--GKYKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRVTDPS  117

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DN+M  PKPGTLR+ VIQD PLWIIF+  M I L  EL+V S+KTIDGRG  V I  GA 
Sbjct  118   DNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGAQ  177

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              T+QFVKNVII  + I   KA +GG+IRDS  H G R+  +GDGI+IFGS+++WIDH+S+
Sbjct  178   ITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHISL  237

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S CEDG+IDAV GS A+TISNCHFT H+ V+LFGA++    D VMQITVAFNHFG+ L Q
Sbjct  238   SNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGRGLVQ  297

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND  380
             RMPR RWG  H++NNDYTHWEMYA+GGS   TIISQGNR+IAPP  +  KE+T RD+  +
Sbjct  298   RMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLA-CKEVTKRDYAVE  356

Query  379   E-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVK-YGRLDLLDPMPSSHAGKITRFAGALSC  206
               WK W W S+ D  +N AFF  SG+   A+K   +  +++ MP  H  ++TRF+GAL C
Sbjct  357   SVWKSWNWRSEGDLMLNGAFFVQSGN---AIKTMNKQGVINAMPGRHVSRLTRFSGALDC  413

Query  205   KYGKPC  188
               G+PC
Sbjct  414   VRGRPC  419



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   457 bits (1175),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 242/459 (53%), Positives = 304/459 (66%), Gaps = 17/459 (4%)
 Frame = -2

Query  1552  IEMFNKMNWSLLVVFFAFGAVIPAV-AGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPE  1376
             +E   K+ + LLV F      IP + A  +      D +   R  EA   A++ +   PE
Sbjct  8     VESSTKIAFILLVTF---AITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYVPIPE  64

Query  1375  HVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLR--GKKFKGPCKALNPIDRCWRCDKD  1202
              V  ++   VH      M+ E +    N TRR +R  GKK  GPC+A NPID CWRC  D
Sbjct  65    GVAHDLNVAVH------MSMEAEE---NNTRREMRQKGKKHDGPCEATNPIDSCWRCKAD  115

Query  1201  WVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIF  1022
             W  NR ++A C+ GFG  TTGG  GP YVVTD SDN+M  PKPGTLR   +Q GPLWI F
Sbjct  116   WAANRFQLAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQKGPLWITF  175

Query  1021  SASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGI  842
             + SM I L  EL+V+SDKTIDGRGA V+I  GAG T+QFV NVII  L I+ IKA  GG+
Sbjct  176   ARSMVIRLNQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNIKAKPGGL  235

Query  841   IRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTD  662
             IRDS  H G RT  +GD I+I+GSSN+WIDHLS+S CEDG++D ++GST +TISNCH T 
Sbjct  236   IRDSFDHTGQRTRSDGDAISIYGSSNIWIDHLSLSECEDGLVDIIQGSTGITISNCHMTK  295

Query  661   HSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVG  482
             H+ V+LFGA++    DK+MQITVAFNHFG+ L QRMPRCR+G  H++NNDYTHW MYA+G
Sbjct  296   HNDVMLFGASDSYTGDKLMQITVAFNHFGQGLIQRMPRCRYGFVHVLNNDYTHWIMYAIG  355

Query  481   GSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD  305
             GS+  TI+SQGNR+IAP   +  KE+THRD+ P D WK W W S+ D F+N A F PSG 
Sbjct  356   GSSSPTILSQGNRFIAPDNGAA-KEVTHRDYAPPDVWKNWQWSSELDVFMNGAKFVPSGA  414

Query  304   PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             P     + +  ++ P   SH  ++TR AGAL+C  GKPC
Sbjct  415   PINRKPFKKAYMMQPRDGSHVSRLTRNAGALNCVVGKPC  453



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   457 bits (1176),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 302/469 (64%), Gaps = 26/469 (6%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             S L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     
Sbjct  7     SKLMFTFCIAVLIPTIRGNISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  1345  HSMRHETMAFEDDREV----------------VNGTRRHLRGK------KFKGPCKALNP  1232
             +    +    E+D +                  N TRR LRGK      K KGPC A NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW K RK++  C  GFG  TTGGK G  YVVT + D +M  PKPGTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWIIF   M+I L  ELL+ S KTID RGA V +  GAG T+QFVKNV+I  L I
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHI  243

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNND  363

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ + DEWK W W SD+D F+
Sbjct  364   YTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFM  423

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N A+F  SG+PQ    + R  ++ P       K+T++AGAL C+ G+ C
Sbjct  424   NGAYFRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   457 bits (1175),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 313/465 (67%), Gaps = 26/465 (6%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
              N  ++ ++ V  +   V P+V   +      D YW  R+A A+   M+++  +P +VT 
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTN  62

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHL----RGKKFKGP-CKALNPIDRCWRCDKDW  1199
                   H   H  +A E      NGTRR L     G+K +G   K+LN IDRCWR DK+W
Sbjct  63    ------HFNYHAALAMETT-GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNW  115

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
              KNRK++ADC LGFG  TTGGK+GP YVVTD+SD+++  PKPGTLRHAV +D PLWIIF+
Sbjct  116   AKNRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFA  175

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              +M I LQ EL++T+DKTIDGRG  V I GGAGFT+QFVKNVII N+ +K IK   GG+I
Sbjct  176   RTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLI  235

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS  H GLRT  +GDGI IFG++N+WIDH+SM  C DG+IDA+ GSTA+TISN HFTDH
Sbjct  236   RDSEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDH  295

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
              +V+LFGA N D  DK MQITVAFNHFGKRL QRMPR R+G+ H++NNDYTHWEMYA+GG
Sbjct  296   KEVMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGG  355

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGD-  305
             +   TIISQGNR+IAPP     K++T R++    EWK W W S+RD F+N A+F  SG  
Sbjct  356   NMNPTIISQGNRFIAPPKED-CKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKS  414

Query  304   ------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                   P+  +   +   + P P +    +T+ AG L C+ GK C
Sbjct  415   NAWSAAPKNPIP--KEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   457 bits (1176),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 302/469 (64%), Gaps = 26/469 (6%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             S L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     
Sbjct  7     SKLMFTFCIAVLIPTIRGNISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  1345  HSMRHETMAFEDDREV----------------VNGTRRHLRGK------KFKGPCKALNP  1232
             +    +    E+D +                  N TRR LRGK      K KGPC A NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW K RK++  C  GFG  TTGGK G  YVVT + D +M  PKPGTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWIIF   M+I L  ELL+ S KTID RGA V +  GAG T+QFVKNV+I  L I
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHI  243

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNND  363

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ + DEWK W W SD+D F+
Sbjct  364   YTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFM  423

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N A+F  SG+PQ    + R  ++ P       K+T++AGAL C+ G+ C
Sbjct  424   NGAYFRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   455 bits (1171),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 300/452 (66%), Gaps = 19/452 (4%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNIT  1355
             M + L  +F++    + + A    +I   D YWV R+AEA+   M+A+   PE V  +  
Sbjct  1     MEFCLGYLFYSL-LFLASAASSNTNITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFN  59

Query  1354  AEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKG-PCKALNPIDRCWRCDKDWVKNRKRM  1178
                           D  +V N TRR LR  K KG  C A NPIDRCWRC  DW  NRK +
Sbjct  60    TP------------DIFQVFNSTRRSLRHGKGKGRKCVATNPIDRCWRCRSDWASNRKLL  107

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             A CA GFG    GG  G  YVVT+ SD+ + +P+PGTLR+ V +D PLWIIF+  M I L
Sbjct  108   AKCAKGFGRHAEGGLSGSIYVVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMVIKL  167

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             Q EL++ + KTIDGRGA V I  GAG T+QFVK+VI+ NL I  IK  +GG IRDS  H 
Sbjct  168   QQELMINNYKTIDGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHW  227

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             G+RT  +GDG++IFG+S+VW+DHLSMS C DG+IDAVK STA+TISNCH T H+ V+L G
Sbjct  228   GIRTRSDGDGVSIFGASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLG  287

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A++    D VMQ+TVA+NHFGK L QRMPRCRWG FH++NNDYTHW MYAVGGS   TII
Sbjct  288   ASDKSQEDAVMQVTVAYNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTII  347

Query  457   SQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDP-QGAVKY  284
             SQGNR++ PP   + KE+THR++ P  EWK W W S+ DEF + AFF  SG   QG  K+
Sbjct  348   SQGNRFVGPP-IQFAKEVTHREYAPESEWKNWIWTSEDDEFKSGAFFIQSGHKYQG--KH  404

Query  283   GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              R D++   P S AG++TRF+GAL C   +PC
Sbjct  405   SRYDVIKAKPGSIAGRLTRFSGALQCSPNRPC  436



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   456 bits (1172),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 244/422 (58%), Positives = 294/422 (70%), Gaps = 15/422 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  +   A D A  ++   PE VT++    V            D E  N TRR LRG
Sbjct  29    DEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAV----------SKDLEG-NVTRRSLRG  77

Query  1267  K-KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
             K KF GPC A NPIDRCWRC KDW++NRKR+A CA GFG  T GGK+G  YVVTD+SDN+
Sbjct  78    KHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLYVVTDASDND  137

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             +  PK GTLR+ VIQD PLWI+F++ M I L  ELLVTSDKTID RG+ V I+GGAG  +
Sbjct  138   LISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVHIMGGAGIML  197

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QFV NVII  L I  IKA +GG+IRDS  H GLRT  +GDGI+I+GSSN+WIDH+SMS C
Sbjct  198   QFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWIDHVSMSNC  257

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
              DG+ID ++GSTA+TISN HFT H+ V+LFGA++    D +MQITVAFNHFGK L QRMP
Sbjct  258   MDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHFGKGLVQRMP  317

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEW  374
             RCRWG  H++NNDYTHW MYAVGGS   TI+SQGNRYIAP   +  KE+T RD+ P   W
Sbjct  318   RCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAA-KEVTKRDYAPQAVW  376

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K WTW S+ D   N AFF  SG P   +K+   DL+   P S   ++TRF+GAL+C  G+
Sbjct  377   KDWTWRSEGDLMQNGAFFVESGPPN-RMKFNTKDLIKAKPGSFVTRLTRFSGALNCFPGR  435

Query  193   PC  188
             PC
Sbjct  436   PC  437



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 299/447 (67%), Gaps = 18/447 (4%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             S L++ FA  A++  +   + +    D  W  R  EA   A +A+  +PE+VT +   EV
Sbjct  6     SSLILAFALIALVYTIEAHIAEF---DEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEV  62

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             H            R +     R     K+ GPC A NPID+CWRC K+W KNR ++ADCA
Sbjct  63    H------------RSIDGHNSRRRDLHKYNGPCTATNPIDQCWRCQKNWRKNRMKLADCA  110

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG   TGGK G  Y VTD SDN++  PKPGTLRHA+IQ  PLW+IF+ +M I L  EL
Sbjct  111   LGFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQEL  170

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             ++TS+KTIDGRG  V I  GAGFT+QFV N+II NL I  IK+ +GG+IRDS  H G+R+
Sbjct  171   IMTSNKTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRS  230

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+I+GS+N+WIDH+SMS C DG+IDAV+ STA+TISN HFT H++ +LFGA++ 
Sbjct  231   RSDGDGISIYGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDS  290

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D +MQIT+AFNHFG+ +EQRMPR RWG  H++NNDYTHW MYA+GGS   TI+SQGN
Sbjct  291   YSDDSIMQITLAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQGN  350

Query  445   RYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL  269
             R+IAP  P Y KE+T RD+ P   WK W W S  D  +N AFF  SGDP         DL
Sbjct  351   RFIAPENP-YAKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPNHNFG-SNADL  408

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             + P P   A ++TRFAGAL+C   +PC
Sbjct  409   IGPKPGEFANRLTRFAGALNCIAKRPC  435



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 312/453 (69%), Gaps = 25/453 (6%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N  LLV+F    +++P +   + +    D Y   +  EA++ +++A+T +PE +T     
Sbjct  7     NSILLVLFIWLASLVPHLHARIAEF---DPYLEKQALEALNSSLEAYTNNPEEITNAFNK  63

Query  1351  EVHS--MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRM  1178
             EV +  ++++++            RRHL   K K  C A NPIDRCWRCDK+W +NR  +
Sbjct  64    EVGNALLKYKSL------------RRHL---KEKDKCMATNPIDRCWRCDKNWAENRMDL  108

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
              +CA GFG  TTGGK+G YYVVTD SD+ ++EPKPGTLRHAVIQ+ PLWIIF  SM I L
Sbjct  109   EECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKL  168

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             + EL++TSDKTIDGRG  V I  GAG  +QFV NVII N++I+ I +T+GG+IRDS  H 
Sbjct  169   RQELMITSDKTIDGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHI  228

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GDGI+IFGS+++WIDH ++S C DG+IDA+  STA+TISNC F  H+ V+L G
Sbjct  229   GLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLG  288

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             A +  P D +MQ+TVAFN FG+ L QRMPRCRWG FH++NNDYTHW+MYA+GGSA  TII
Sbjct  289   ATDAFPQDAIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTII  348

Query  457   SQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+ A   P+  K++T RD+  + EWK W WVS+ D F+N A+F  SG PQ   K  
Sbjct  349   SQGNRFKASDNPNT-KQVTKRDYATESEWKKWQWVSEGDSFLNGAYFVESG-PQDKKKTA  406

Query  280   --RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               +   +   P SHAG++TRFAG L CK G PC
Sbjct  407   LTKNHKIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   456 bits (1172),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 312/465 (67%), Gaps = 26/465 (6%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
              N  ++ ++ V  +   V P+V   +      D YW  R+A A+   M+++  +P +VT 
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTN  62

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHL----RGKKFKG-PCKALNPIDRCWRCDKDW  1199
                   H   H  +A E      NG RR L     G+K +G   ++LN IDRCWR DK+W
Sbjct  63    ------HFNYHAALAMETT-GADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNW  115

Query  1198  VKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFS  1019
              KNRK++ADC LGFG  T GGK+GP YVVTD+SD+++  PKPGTLRHAV +D PLWIIF+
Sbjct  116   AKNRKKLADCVLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFA  175

Query  1018  ASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGII  839
              +M I LQ EL++T+DKTIDGRG  V I GGAGFT+QFVKNVII N+ +K IK   GG+I
Sbjct  176   RTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLI  235

Query  838   RDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH  659
             RDS  H GLRT  +GDGI IFG++N+WIDH+SM  C DG+IDA+ GSTA+TISN HFTDH
Sbjct  236   RDSEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDH  295

Query  658   SKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGG  479
              +V+LFGA N D  DK MQITVAFNHFGKRL QRMPR R+G+ H++NNDYTHWEMYA+GG
Sbjct  296   KEVMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGG  355

Query  478   SAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGD-  305
             +   TIISQGNR+IAPP     K++T R++ P  EWK W W S+RD F+N A+F  SG  
Sbjct  356   NMNPTIISQGNRFIAPPKED-CKQVTKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKS  414

Query  304   ------PQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                   P+  +   +   + P P +    +T+ AG L C+ GK C
Sbjct  415   NAWSAAPKNPIP--KEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/454 (52%), Positives = 310/454 (68%), Gaps = 11/454 (2%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             +  V    F + IP + G++G+    D Y   ++AEA + A++A+    +   +      
Sbjct  8     ACYVFLVCFVSQIPNLRGKIGEY---DDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHND  64

Query  1345  HSMRHETMAFEDD---REVVNGTRRHLRG----KKFKGPCKALNPIDRCWRCDKDWVKNR  1187
              S ++ T++ +      +    TRR LRG    KK  GPCKA NP+D+CWRC  DW +NR
Sbjct  65    PSHQNATISIKGGYRPNKNTTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQNR  124

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
             KR+  C  GFG  TTGG  G +Y VTD SD++M+ PKPGT+RHAVIQ  PLWIIF+ SM 
Sbjct  125   KRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSMH  184

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             I L+ EL++TS+KTID RGA V I  GAG T+QF +NVII  L I  I  ++GG+IRDS 
Sbjct  185   IRLKQELMITSNKTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSV  244

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H G+RT  +GDGI++FGSSNVW+DHLSMSRC+DG+ID ++GSTA+TISNCHFT H+ V+
Sbjct  245   DHIGIRTQADGDGISVFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVI  304

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             L GA++    D +MQ+T+A+NHFGK L QRMPRCRWG  H++NNDYTHWEMYA+GGS   
Sbjct  305   LLGASDQFSGDSIMQVTIAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHP  364

Query  466   TIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
             TI+SQGNR+IAPP  S+ K++T RD+    EWK WTW S+ D F+N A+F  SGDP    
Sbjct  365   TILSQGNRFIAPPHISWAKQVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKH  424

Query  289   KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             K+ R D++       A  +TR+AG+L C  GKPC
Sbjct  425   KFTRQDIIRAKHGMAASMLTRYAGSLHCFAGKPC  458



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 298/422 (71%), Gaps = 14/422 (3%)
 Frame = -2

Query  1450  SDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLR  1271
             +D YW  + + A     +A+T  P  +T+N+T  V     E +  E      NG RR+L+
Sbjct  36    NDSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVS----EIIVGEQ-----NG-RRNLK  85

Query  1270  GKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
             GK   G C A NPIDRCWRCD +W  NRK++A+C  GFG  T GGK+GP+YVVT + DN+
Sbjct  86    GKG--GNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDND  143

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             M  P PGTLRHAV + GPLWIIF+ SM I L  EL++ SDKTIDGRG  V + GGAG T+
Sbjct  144   MVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITI  203

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QF+KNVII  +KI  I+  +GG+I DS  H GLRT  +GDGI+IFGSSN+WIDH+SM +C
Sbjct  204   QFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKC  263

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
             +DG+IDA++GSTA+TISN HFTDH++V+LFGA++    D +MQIT+AFNHFGKRL QRMP
Sbjct  264   KDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMP  323

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEW  374
             RCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IAP   +  KEIT R++ P  EW
Sbjct  324   RCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINA-KEITKREYSPEQEW  382

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K W W S  DE++N  FF   G       Y R D++   P S+ G++TR+AG+L C  GK
Sbjct  383   KSWQWRSINDEYLNGGFFREGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGK  442

Query  193   PC  188
             PC
Sbjct  443   PC  444



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   455 bits (1170),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 298/422 (71%), Gaps = 14/422 (3%)
 Frame = -2

Query  1450  SDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLR  1271
             +D YW  + + A     +A+T  P  +T+N+T  V     E +  E      NG RR+L+
Sbjct  39    NDSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVS----EIIVGEQ-----NG-RRNLK  88

Query  1270  GKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNE  1091
             GK   G C A NPIDRCWRCD +W  NRK++A+C  GFG  T GGK+GP+YVVT + DN+
Sbjct  89    GKG--GNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDND  146

Query  1090  MEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTV  911
             M  P PGTLRHAV + GPLWIIF+ SM I L  EL++ SDKTIDGRG  V + GGAG T+
Sbjct  147   MVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITI  206

Query  910   QFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRC  731
             QF+KNVII  +KI  I+  +GG+I DS  H GLRT  +GDGI+IFGSSN+WIDH+SM +C
Sbjct  207   QFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKC  266

Query  730   EDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMP  551
             +DG+IDA++GSTA+TISN HFTDH++V+LFGA++    D +MQIT+AFNHFGKRL QRMP
Sbjct  267   KDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMP  326

Query  550   RCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEW  374
             RCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IAP   +  KEIT R++ P  EW
Sbjct  327   RCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINA-KEITKREYSPEQEW  385

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGK  194
             K W W S  DE++N  FF   G       Y R D++   P S+ G++TR+AG+L C  GK
Sbjct  386   KSWQWRSINDEYLNGGFFREGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGK  445

Query  193   PC  188
             PC
Sbjct  446   PC  447



>ref|XP_004234780.1| PREDICTED: probable pectate lyase P56 [Solanum lycopersicum]
 sp|P15721.2|PLY56_SOLLC RecName: Full=Probable pectate lyase P56; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33524.1| P56 protein [Solanum lycopersicum]
Length=398

 Score =   452 bits (1164),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 222/373 (60%), Positives = 281/373 (75%), Gaps = 5/373 (1%)
 Frame = -2

Query  1297  VNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYY  1118
             +N  RR L  KK++GPC A+N ID+CWRCD  W ++R++MADCALGFG    GGK GPYY
Sbjct  28    INAPRRKLT-KKYRGPCMAVNSIDKCWRCDPFWAEDRQKMADCALGFGINAMGGKYGPYY  86

Query  1117  VVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVK  938
             +VTD+SD+++ +PKPGTLR  VIQ GPLWI F+ SM I L  EL+V+S+KTIDGRG YV 
Sbjct  87    IVTDNSDDDVVDPKPGTLRFGVIQKGPLWITFARSMRIRLTRELIVSSNKTIDGRGKYVH  146

Query  937   IVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVW  758
             I  GAG  +Q   NVII+NL+I  I  T+GG++R+S  H GLR  DEGD I+IF S ++W
Sbjct  147   IANGAGIKIQSASNVIISNLRIHNIVPTAGGLLRESDDHLGLRGADEGDAISIFNSHDIW  206

Query  757   IDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHF  578
             IDH+SMSR  DG+IDAV GST +TISNCHFTDH KV+LFGAN+    D+ M+IT+A+NHF
Sbjct  207   IDHISMSRATDGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHAEEDRGMKITLAYNHF  266

Query  577   GKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITH  398
             GKRL+QRMPRCR+G FH++NNDYTHWE YA+GGS+G+TIISQGNR+IA       KE+T+
Sbjct  267   GKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-KLLVKEVTY  325

Query  397   RDWPN---DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITR  227
             R+      +EW  WTW++D D+F N A FTPSGD     K   L+L+ P PSS  G +T+
Sbjct  326   REKSTSSVEEWMKWTWITDGDDFENGATFTPSGDQNLLSKIDHLNLIQPEPSSKVGLLTK  385

Query  226   FAGALSCKYGKPC  188
             F+GALSCK  +PC
Sbjct  386   FSGALSCKIRRPC  398



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 301/447 (67%), Gaps = 21/447 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             +L+VFFA       +   + +    D YW  R  EA + + +A+  +P  VT++   EVH
Sbjct  8     MLLVFFALAMQTSTLKAGIANF---DEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVH  64

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                          E  N TRR+L   K KGPC A NPIDRCWRCDK+W KNRK++  CAL
Sbjct  65    K----------SLEGGNSTRRNL--GKNKGPCLATNPIDRCWRCDKNWAKNRKKLGGCAL  112

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  T GGK G YY VTD SDN+M  PK GTLR+ VIQD PLWIIF+  M I L  EL+
Sbjct  113   GFGRKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEELM  172

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             V S+KTIDGRG  V I  GA  T+QFVKNVII  + I   KA +GG+IRDS  H G R+ 
Sbjct  173   VASNKTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSR  232

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+IFGS+++WIDH+S+S CEDG+IDA+ GS A+TISNCHFT H+ V+LFGA++  
Sbjct  233   SDGDGISIFGSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSY  292

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D VMQITVAFNHFG+ L QRMPR RWG  H++NNDYTHWEMYA+GGS   TIISQGNR
Sbjct  293   SGDSVMQITVAFNHFGRGLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGNR  352

Query  442   YIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVK-YGRLDL  269
             ++APP P+  KE+T RD+  +  WK W W S+ D  +N AFF  SG+   A+K   +  +
Sbjct  353   FVAPPDPA-CKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGN---AIKTMNKQAV  408

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             +   P  +  ++TRF+GAL+C  G+PC
Sbjct  409   ISAKPGRYVSRLTRFSGALNCVRGRPC  435



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 296/443 (67%), Gaps = 18/443 (4%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             +FF    ++ ++   + +    D  W  R  +A   A  ++  HPE V  N+   VH+  
Sbjct  9     IFFVSVTLVLSIEANISEF---DEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHT--  63

Query  1333  HETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfg  1154
                       E  N TRR L   K+ GPC + NPIDRCWRCD +W K R ++ADC LGFG
Sbjct  64    --------SEEGSNSTRRDLH--KYNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFG  113

Query  1153  agttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTS  974
               TTGGK G  YVVTD SD++M  PKPGTLRHAVIQ  PLWIIF   M I L  EL++TS
Sbjct  114   HHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTS  173

Query  973   DKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEG  794
             +KTID RG  V I  GA F +QF+ NVII  L I  IKA +GG+IRDS  H G R+  +G
Sbjct  174   NKTIDARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDG  233

Query  793   DGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPID  614
             DGI+IFGS+N+WIDH+SMS C+DG+IDAV+ STA+TISNCHFT+H+ V+LFGA++    D
Sbjct  234   DGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSED  293

Query  613   KVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIA  434
              ++QIT+AFNHFG+ L QRMPR RWG  H +NNDYTHW MYA+GGS   TI+SQGNR+IA
Sbjct  294   SILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIA  353

Query  433   PPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPM  257
             PP P+  KE+T R++ P   WK W W S  D  +N AFF  SG+P      G  D++ P 
Sbjct  354   PPNPNA-KEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGP-DMIHPR  411

Query  256   PSSHAGKITRFAGALSCKYGKPC  188
             P S+A ++TRF+G+L+C  GKPC
Sbjct  412   PGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   454 bits (1168),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 310/453 (68%), Gaps = 17/453 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+       +IP   G L DI   D  W  R  EA    + ++  +PE  T +   EV++
Sbjct  8     LIFAITLATLIP---GLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNN  64

Query  1339  MRHETMAFEDDRE------VVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
                  + F+DDR         N TRR+L+   KK+ GPCK  NPID+CWRC ++W +NRK
Sbjct  65    T---LVDFDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRK  121

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A CALGFG   TGG  G  YVVT++SD+++  PKPGTLRHAVIQ GPLWIIFS +M I
Sbjct  122   RLAKCALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNI  181

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL++TS KTIDGRG ++ I  GAG T+QF++NVII  ++I  I ATSGG IRDS  
Sbjct  182   RLSKELIMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVE  241

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H G+RT  +GDGI+IFGSSN+WIDH+SMSRC DG+IDA+ GSTA+TISN HFT H+  +L
Sbjct  242   HYGIRTNSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAIL  301

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
              GA++    D++MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   T
Sbjct  302   LGASDSFSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPT  361

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             IISQGNR+IAPP   + K++T RD+  + EWK WTW S+ D  +N AFF  SG P+    
Sbjct  362   IISQGNRFIAPP-ELHLKQVTKRDYATESEWKTWTWRSENDLMMNGAFFIESGKPRTKRP  420

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + +  ++   P S A ++T FAGAL CK G+ C
Sbjct  421   HKKF-MITAKPGSLATRMTLFAGALDCKSGRKC  452



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   453 bits (1166),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 237/456 (52%), Positives = 301/456 (66%), Gaps = 23/456 (5%)
 Frame = -2

Query  1552  IEMFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEH  1373
             + + N++++ +++    F   I A  GE  ++      W  R  +A   A +++  HPE 
Sbjct  2     VTLKNRLSFFVILCTLVFS--IEANIGEFDEV------WRTRATQANKNAKESYNPHPEK  53

Query  1372  VTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVK  1193
             V  N+   VH             E  N TRR L   K+ GPC A NPIDRCWRCD  W K
Sbjct  54    VAANLNKHVHR----------SEEGSNSTRRDLH--KYNGPCVATNPIDRCWRCDPHWAK  101

Query  1192  NRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSAS  1013
             NR+++ADC LGFG  TTGGK G  Y+VTD  DN+M  PKPGTLRHAVIQ GPLWIIF+  
Sbjct  102   NRQKLADCVLGFGHHTTGGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHH  161

Query  1012  MTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRD  833
             M I L  EL++T DKTID RG  V I GGA   +Q++ NVII  L I  IK+ +GG+IRD
Sbjct  162   MVIKLNQELIMTGDKTIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRD  221

Query  832   SATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSK  653
             S  H G RT  +GDGI+IFGS+N+WIDH+SMS C+DG+IDAV+ STA+TISNCHFT H+ 
Sbjct  222   SINHYGFRTRSDGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHND  281

Query  652   VLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSA  473
             V+LFGA++    D ++QIT+AFNHFG+ L QRMPR RWG  H +NNDYTHW MYA+GGS 
Sbjct  282   VMLFGASDSYKQDAILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQ  341

Query  472   GSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQG  296
               TI+SQGNR+IAPP P+  KE+T RD+ P   WK W W S  D  +N AFF  SG+   
Sbjct  342   HPTILSQGNRFIAPPNPNA-KEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRNH  400

Query  295   AVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 G  D++ P   S AG++TRF+G+L+C  GKPC
Sbjct  401   KFMTGP-DMIHPRAGSDAGRLTRFSGSLNCIEGKPC  435



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   453 bits (1166),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 302/449 (67%), Gaps = 16/449 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             +  +       IP +   + +    D Y   +   A   A+K++  +PE    NIT E++
Sbjct  8     ITFIVLILAITIPCLEAGIAEF---DDYLKEQADLARQIALKSYVPNPE----NITTELN  60

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKG---PCKALNPIDRCWRCDKDWVKNRKRMAD  1172
                H  MA E+     N TRR LR ++  G    C + NPID CWRC KDW +NR+++A 
Sbjct  61    --LHVNMAMEE--AYSNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLAQ  116

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             C  GFG    GG  G +YVVTD SDN++  PK GTLR+  +Q GPLWIIF+ SM I L  
Sbjct  117   CGKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFARSMIIRLNQ  176

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             ELLV+SDKTIDGRGA V I  GAG T+QFV NVII  L I+ IKA SGG+IRDS  H GL
Sbjct  177   ELLVSSDKTIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGL  236

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GD +++FGSSN+WIDH+S+S  EDG+ID ++GSTA+TISNCH T H+ V+LFGA+
Sbjct  237   RTRSDGDALSVFGSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGAS  296

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    DK+MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+G TI+SQ
Sbjct  297   DSYSDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQ  356

Query  451   GNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAP   +  K ITHRD+ + D W  W W S+ D F+N A F  SG P   + + + 
Sbjct  357   GNRFIAPNNNAA-KTITHRDYASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPFKKG  415

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L+ P P + A ++TR+AGAL+C+ G+PC
Sbjct  416   YLMKPRPGTQANRLTRYAGALNCQIGRPC  444



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   454 bits (1167),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 232/427 (54%), Positives = 290/427 (68%), Gaps = 19/427 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R   A +    A+   P  V+ N TA V  +     A           RR LRG
Sbjct  40    DSYWQERAKVAKEANQAAYFVDPYAVSGNFTATVSEIIAAKSA-----------RRSLRG  88

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
                 G C A NPIDRCWRCD +W  NR+++ADC  GFG  T GGK GP+YVVTD SDNE+
Sbjct  89    NN-NGTCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGKGGPFYVVTDPSDNEL  147

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
              +PKPGTLRHAV ++GPLWI F+ SM ITLQ EL+++SDKTIDGRG  V I  GAG TVQ
Sbjct  148   LDPKPGTLRHAVTRNGPLWITFARSMVITLQQELIMSSDKTIDGRGVEVYIANGAGITVQ  207

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             FVKN+II  +KI  IK   GG+IRDS +H G RT  +GDGI+IFG+SNVWIDH+SM  C 
Sbjct  208   FVKNIIIHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWIDHVSMRNCT  267

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+AFNHFGKRL QRMPR
Sbjct  268   DGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQITLAFNHFGKRLVQRMPR  327

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSY------FKEITHRDWP  386
              R+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+I P            KE+T R++ 
Sbjct  328   ARFGFVHVVNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMVGGNQLNLKEVTKREYT  387

Query  385   NDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALS  209
             ++  WK W W S  DEF+N A+F  SG       + + D++   P S+ G++TR++G L 
Sbjct  388   DESVWKNWQWRSINDEFLNGAYFIQSGPELKNRPFSKKDMITAKPGSYVGRLTRYSGNLQ  447

Query  208   CKYGKPC  188
             C+ GKPC
Sbjct  448   CRVGKPC  454



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   453 bits (1165),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 297/444 (67%), Gaps = 18/444 (4%)
 Frame = -2

Query  1516  VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             ++FF    ++ ++   + +    D  W  R  +A   A  ++  HPE V  N+   VH  
Sbjct  8     LIFFVLVTLVLSIEANISEF---DEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHKW  64

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                        E  N TRR L   K+ GPC + NPIDRCWRCD +WVKNR ++ADC LGF
Sbjct  65    E----------EGSNSTRRDLH--KYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGF  112

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGK G  YVVTD SD++M  PKPGTLRHAVIQ  PLWIIF   M I L  EL++T
Sbjct  113   GHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMT  172

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             S+KTID RG  V I  GA F +QF+ NVII  L I  IKA +GG+IRDS  H G R+  +
Sbjct  173   SNKTIDARGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSD  232

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI+IFGS+N+WIDH+SMS C+DG+IDAV+ STA+TISN HFT+H+ V+LFGA++    
Sbjct  233   GDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSE  292

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             D ++QIT+AFNHFG+ L QRMPR RWG  H +NNDYTHW MYA+GGS   TI+SQGNR+I
Sbjct  293   DSILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFI  352

Query  436   APPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDP  260
             APP P+  KE+T R++ P   WK W W S  D  +N AFF  SG+P      G  D++ P
Sbjct  353   APPNPNA-KEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGP-DMIHP  410

Query  259   MPSSHAGKITRFAGALSCKYGKPC  188
              P S+A ++TRF+G+L+C  GKPC
Sbjct  411   RPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   452 bits (1164),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 304/453 (67%), Gaps = 23/453 (5%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ ++LL  F     VIP +   + +    D +   +  EA   A+ ++   P  V   +
Sbjct  11    KVAFTLLATF---AIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHEL  64

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKG--PCKALNPIDRCWRCDKDWVKNRK  1184
                VH      MA E      N TRR LR +K +G   C+A NPID CWRC+KDW  +R 
Sbjct  65    NFHVH------MALE------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRF  112

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A C  GFG   TGG  GP YVVTD+SD++M  PKPGT+RHAV Q GPLWIIF  SM I
Sbjct  113   RLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMII  172

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
             +L+ EL+++SDKTIDGRGA V+  GGAG T+QFV NVII  ++IK I    GG+IRDSA 
Sbjct  173   SLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSAD  232

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GD I+IFGS+N+WIDH+S+S C DG+ID ++GSTA+TISNCH T H+ V L
Sbjct  233   HYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFL  292

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA++    DK+MQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS+G T
Sbjct  293   FGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPT  352

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             I+SQGNR+IAP   +  KEITHRD+   D WK W W S+ D F+N A F  SG P   + 
Sbjct  353   ILSQGNRFIAPNNDNA-KEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPI-KMT  410

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             Y +  ++ P   +H  ++TR AGAL+C  GKPC
Sbjct  411   YKKGLIMKPRDGTHVSRLTRHAGALNCFVGKPC  443



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 295/446 (66%), Gaps = 19/446 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             +++V  +    +P     + D    D  W NR A A   A++A+   P +VT ++   VH
Sbjct  11    VVLVLASSSFTVPKAEAHIADF---DETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVH  67

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                    A E      N TRRHL   K+ G C A NPIDRCWRC ++W ++RKR+A CAL
Sbjct  68    K------ALEG-----NSTRRHL--GKYTGACMATNPIDRCWRCQRNWARDRKRLAKCAL  114

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGG  G +YVVTD+SD  + +PKPGTLRHAVIQD PLWI F   M I L  ELL
Sbjct  115   GFGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELL  174

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             V S KTIDGRG  V I  GAG T+Q+ KNVII  L I  IKA +GG+IRDS  H GLRT 
Sbjct  175   VNSHKTIDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTK  234

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GD I+IF SS VWIDH SMS C DG+IDA+ GSTA+TISN HFT+H++V L GA++  
Sbjct  235   SDGDAISIFASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSF  294

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               DK+MQ+T AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYAVGGS   TIISQGNR
Sbjct  295   SDDKIMQVTFAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGNR  354

Query  442   YIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             YIAP   +Y KE+T RD+ + D WK WTW S+ D   N AFF  SG P    KY R D +
Sbjct  355   YIAPTA-NYAKEVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESGPPS-TDKYTRQDKI  412

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P +  G++TRFAGAL CK   PC
Sbjct  413   TAKPGTFVGRLTRFAGALVCKRKSPC  438



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 303/449 (67%), Gaps = 25/449 (6%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             ++L+  F    +IP++   L DI   D  W  R  +A    ++A+   PE  T     EV
Sbjct  6     AMLIFVFTLATLIPSL---LADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV  62

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
                              N TRR+LR   KK+ GPC+  NPIDRCWRC ++W KNRK++A 
Sbjct  63    -----------------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAK  105

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CALGFG  TTGG  G  YVVTDSSDN + +PKPGTLRHAVIQ  PLWIIFS +M I L  
Sbjct  106   CALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSK  165

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL+++S KTIDGRG +V I  G G T+QF+ NVII  ++I  I ATSGG IRDS  H G+
Sbjct  166   ELIMSSHKTIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGI  225

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGI+IFGS++VWIDH+SMSRC DG+IDA+ GSTA+TISNCHFT H+  +L GA+
Sbjct  226   RTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGAS  285

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    D +MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW +YA+GGS   TIISQ
Sbjct  286   DSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQ  345

Query  451   GNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAPP  S+ K++T RD+    EW  WTW S+ D  +N AFF  SG P+   K  R 
Sbjct  346   GNRFIAPP-ESHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQPR-TKKPNRK  403

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              ++   P + A ++TRFAGAL CK G+ C
Sbjct  404   FMIKAKPGAVATRMTRFAGALDCKPGRKC  432



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   452 bits (1164),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 298/449 (66%), Gaps = 16/449 (4%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             +       IP + G +G+    D Y   +   A   A K++  +PE++T  I   VH   
Sbjct  11    ILLVLAITIPCLEGRIGEF---DDYLKAQADLARQIAFKSYVPNPENITTEINIHVH---  64

Query  1333  HETMAFEDDREVVNGTRRHLRGKKFKG------PCKALNPIDRCWRCDKDWVKNRKRMAD  1172
                      +   N TRR L  +K +G       C A NPID CWRC KDW +NR+ +A 
Sbjct  65    --LAMEAAMKAEANDTRRELMSQKSRGGKGRRARCMATNPIDSCWRCRKDWAENRQLLAK  122

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA GFG  TTGG  G  YVVTD SDN+M  P+PGTLR   +Q GPLWIIF  SM ITL  
Sbjct  123   CAKGFGRRTTGGLGGRIYVVTDPSDNDMVNPRPGTLRFGAVQRGPLWIIFQRSMVITLTQ  182

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL+V+SDKTIDGRGA V+I  GAG T+QFV NVII  L+IK IKA +GG+IRDS  H G+
Sbjct  183   ELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFDHIGV  242

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GD I++FGSSN+WIDH+S+S CEDG++D ++GSTAVTISNCH T H+ V+LFGA+
Sbjct  243   RTRSDGDAISVFGSSNIWIDHISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGAS  302

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    DK+MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TI+SQ
Sbjct  303   DTYQDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQ  362

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAP   +  K +THRD+ P   W  W W S+ D F+N A F  SG P   + + + 
Sbjct  363   GNRFIAPHNNAA-KTVTHRDYAPESVWSKWQWRSEGDHFMNGATFIQSGPPIKNLPFKKG  421

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              L+ P   S A ++TRF+GAL+C  G+PC
Sbjct  422   FLMKPRHGSQANRLTRFSGALNCVVGRPC  450



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   452 bits (1164),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 310/453 (68%), Gaps = 17/453 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+       +IPA+   L DI   D  W  R  EA    + ++  +PE  T +   EV++
Sbjct  8     LIFAITLATLIPAL---LADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNN  64

Query  1339  MRHETMAFEDD------REVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
                  + F+DD        + N TRR+L+   KK+ GPCK  NPID+CWRC ++W +NRK
Sbjct  65    T---LVDFDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRK  121

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A CALGFG   TGG  G  YVVT++SD+++  PKPGTLRHAVIQ  PLWIIFS +M I
Sbjct  122   RLAKCALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNI  181

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL++TS KTIDGRG ++ I  GAG T+QF++NVII  ++I  I ATSGG IRDS  
Sbjct  182   RLSKELIMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVG  241

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H G+RT  +GDGI+IFGSSN+WIDH+SMSRC DG+IDA+ GSTA+TISN HFT H+  +L
Sbjct  242   HYGIRTNSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAIL  301

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
              GA++    D++MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   T
Sbjct  302   LGASDSFSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPT  361

Query  463   IISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             I+SQGNR+IAPP   + K++T RD+ P  EWK WTW S+ D  +N AFF  SG P+    
Sbjct  362   IVSQGNRFIAPP-ELHLKQVTKRDYAPESEWKTWTWRSENDLMMNGAFFIESGKPRTKRP  420

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + +  ++   P S A ++T FAGAL CK G+ C
Sbjct  421   HKKF-MITAKPGSLATRMTLFAGALDCKSGRKC  452



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   452 bits (1162),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 304/449 (68%), Gaps = 17/449 (4%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N  +L+  F   ++ P +     +IH  D  W  R   A  +A++A+  +PE V  +   
Sbjct  5     NAGILLTLFGLASISPILKA---NIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              VH      M FE+     N TRR+LRG+ + G C A NPID+CWRCD++W  NRKR+AD
Sbjct  62    HVH------MMFENG----NSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLAD  111

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA GFG GT GGK+GP+YVVT+ +D+++  PKPGTLRHAVIQ+ PLWI F+  M I L  
Sbjct  112   CAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSE  171

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             ELL+TSDKTID RG+ V+I  GA  T+QFVKN+II  L I++ KA  GG+IRDS +H G 
Sbjct  172   ELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGF  231

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             R+  +GDGI++FG+S++WIDH+SMS C+DG+IDAV GSTA+T+SN HFT    V+L GA+
Sbjct  232   RSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGAS  291

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +  P D +MQ+TVAFNHFGK+L QRMPR R+G  H++NNDYTHW MYA+GGS   TI+SQ
Sbjct  292   DGHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQ  351

Query  451   GNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR++A     + KE+T RD  P   WK W W S+ D  +N AFF  SG     V   R 
Sbjct  352   GNRFLA-SNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVN--RQ  408

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P   A ++TRF+GAL+C   KPC
Sbjct  409   DVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   454 bits (1168),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 310/453 (68%), Gaps = 20/453 (4%)
 Frame = -2

Query  1534  MNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNIT  1355
             +N     + F    ++P V     ++   D YW  R+ +A+   + ++  +P +VT    
Sbjct  6     LNTGGYALVFLLAILVPHVQA---NVAVFDNYWTQRQGDALKQTIASYDPNPLNVTD---  59

Query  1354  AEVHSMRHETMAFEDDREVVNGTRRHLRGKKFK---GPCKALNPIDRCWRCDKDWVKNRK  1184
                H   H  +A  D  E  N TRR L G+K +   G C A NPID+CWRCD +W KNRK
Sbjct  60    ---HLNYHVALAV-DATESTNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRK  115

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             ++A+C LGFG  TTGGKDGP YVV DSSD+++  PKPGTLRHAV +DGPLWIIF+ SM I
Sbjct  116   KLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVI  175

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              LQ EL++TS+KTIDGRGA V I+ G G T+QFV NVII N+ +K I   +GG+IRDS  
Sbjct  176   KLQQELMITSNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEE  235

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GDGI++FG++NVWIDH+SM+RC DG+IDA++GSTAVTISN HFTDH +V+L
Sbjct  236   HVGLRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVML  295

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA +   IDK MQITVAFNHFGKRLEQRMPRCR+G  H++NNDYTHWEMYA+GG+   T
Sbjct  296   FGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  355

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             IISQGNR+IAPP     KE+T R++ +  +WK W W S+ D F+N A+F  SG P     
Sbjct  356   IISQGNRFIAPPNEQA-KEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSP  414

Query  286   YGRLDL-----LDPMPSSHAGKITRFAGALSCK  203
               +  +     + P P +   ++T  AGAL C+
Sbjct  415   KPKNPVPSKFAIRPKPGTMVRELTMDAGALGCE  447



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   452 bits (1162),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/446 (55%), Positives = 299/446 (67%), Gaps = 20/446 (4%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             LL     F A++P     +  +H  D YW NR  +A   A +A+  +P+ +T N+   VH
Sbjct  8     LLFGCVFFLAIVPIFEANI--VHF-DQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVH  64

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                  +          N TRR L   K+KGPC A NPID CWRCD +W KNRK++ADC L
Sbjct  65    KALSGS----------NSTRREL--AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVL  112

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG GTTGGK G  YVVTDSSDN++  PKPGTLR A IQ  PLWIIF  +M I L+ ELL
Sbjct  113   GFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELL  172

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             +TSDKTID RGA V I  GA  T+Q+VKN+II  L I   K TSGG IRDS  H G R+ 
Sbjct  173   LTSDKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSA  232

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GD I++FG+S+VWIDH+SM  C DG++DAV GSTA+TISNCH T H+ V+LFGAN+  
Sbjct  233   SDGDAISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGF  292

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D++ QITVAFNHFGK L QRMPRCRWG FHI+NNDYTHW MYA+GGS   TI+SQGNR
Sbjct  293   SGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNR  352

Query  442   YIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAPP P+  KE+T RD+ P   WK W+W S+ D  +N AFF  SG    A  + + D +
Sbjct  353   FIAPPNPNA-KEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTK--AANFPKSD-I  408

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P S A  +TRF+G L C+ GKPC
Sbjct  409   KAKPGSFAAALTRFSGCLKCEVGKPC  434



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   451 bits (1160),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 234/434 (54%), Positives = 296/434 (68%), Gaps = 19/434 (4%)
 Frame = -2

Query  1486  PAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDD  1307
             P V   +G+    D  W  R  EA   A++A+  +PE VT N+  E       +      
Sbjct  19    PIVKANIGEF---DEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALKGS------  69

Query  1306  REVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdG  1127
                 N TRR+L   +++GPC A NPIDRCWRCD  W +NRK++A C LGFG  TTGGKDG
Sbjct  70    ----NSTRRNL--GRYRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKDG  123

Query  1126  PYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGA  947
              +YVVTD SDN+M  PKPGT+RHAVIQ  PLWIIF+  M I L  EL++TSDKTIDGRGA
Sbjct  124   RFYVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRGA  183

Query  946   YVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSS  767
              V    GA  T+Q+++NVII  + I+     +GG+IRDS  H G RT  +GDGI+IFGS 
Sbjct  184   NVHFFRGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSH  243

Query  766   NVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAF  587
             N+WIDH+SMSRC DG+ID ++ STA+TISNCHFTDH+ V+LFGA++    DK+MQ+TVAF
Sbjct  244   NIWIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVAF  303

Query  586   NHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKE  407
             NHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS   TI+SQGNR+IAPP  +  KE
Sbjct  304   NHFGQGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIAC-KE  362

Query  406   ITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKIT  230
             +T R++ P  EWK W W S+ D  +N AFF  SG P G  +  R D++   P +   ++T
Sbjct  363   VTKREYAPESEWKSWNWRSENDLMMNGAFFVQSGSPIG--RGNRQDVIKAKPGTFVTRLT  420

Query  229   RFAGALSCKYGKPC  188
             RF+GAL C   KPC
Sbjct  421   RFSGALHCFKNKPC  434



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   448 bits (1153),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 286/396 (72%), Gaps = 16/396 (4%)
 Frame = -2

Query  1372  VTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVK  1193
             VT N   +VH             +  N TRRHLR  K+ GPC A NPIDRCWRCD++W +
Sbjct  1     VTNNFNKQVHR----------SLDGANNTRRHLR--KYTGPCLATNPIDRCWRCDRNWAR  48

Query  1192  NRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSAS  1013
             NRK++ADCALGFG GTTGGKDG  YVV DSSDN++  PKPGTLRHAVIQ+ PLWIIF+  
Sbjct  49    NRKKLADCALGFGRGTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHD  108

Query  1012  MTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRD  833
             M I L  EL++T +KT+DGRGA V I  G   T+QFV+N+II NL I  IKA +GG IRD
Sbjct  109   MVIRLSEELIMTDNKTLDGRGANVHIANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRD  168

Query  832   SATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSK  653
             S +H G RT  +GDGI++FGSS VWIDH+SMS C+DG+IDAV  STA+TISNCHFT H+ 
Sbjct  169   SVSHYGYRTQSDGDGISMFGSSRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHND  228

Query  652   VLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSA  473
             V+L GA++    DK+MQ+T+AFNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS 
Sbjct  229   VILLGASDSYSNDKIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSH  288

Query  472   GSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQG  296
               TIISQGNR+IAPP P+  KE+T R + ++ EW+ W W S+ D  +N AFF  SG+P  
Sbjct  289   NPTIISQGNRFIAPPNPNS-KEVTKRVYASEREWRSWNWRSEGDLMMNGAFFIQSGNP--  345

Query  295   AVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               +Y + D++   P +   ++TRFAG L CK  +PC
Sbjct  346   IRRYSKKDVIHSKPGTFVTRLTRFAGPLKCKMNQPC  381



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   451 bits (1159),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 238/453 (53%), Positives = 303/453 (67%), Gaps = 23/453 (5%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ ++LL  F     VIP +   + +    D +   +  EA   A+ ++   P  V   +
Sbjct  11    KVAFTLLATF---AIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHEL  64

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKG--PCKALNPIDRCWRCDKDWVKNRK  1184
                VH      MA E      N TRR LR +K +G   C+A NPID CWRC+KDW  +R 
Sbjct  65    NFHVH------MALE------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRF  112

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A C  GFG   TGG  GP Y VTD+SD++M  PKPGT+RHAV Q GPLWIIF  SM I
Sbjct  113   RLAKCGKGFGRRATGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMII  172

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
             +L+ EL+++SDKTIDGRGA V+  GGAG T+QFV NVII  ++IK I    GG+IRDSA 
Sbjct  173   SLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSAD  232

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GD I+IFGS+N+WIDH+S+S C DG+ID ++GSTA+TISNCH T H+ V L
Sbjct  233   HYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFL  292

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA++    DK+MQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS+G T
Sbjct  293   FGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPT  352

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             I+SQGNR+IAP   +  KEITHRD+   D WK W W S+ D F+N A F  SG P   + 
Sbjct  353   ILSQGNRFIAPNNDNA-KEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPI-KMT  410

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             Y +  ++ P   +H  ++TR AGAL+C  GKPC
Sbjct  411   YKKGLIMKPRDGTHVSRLTRHAGALNCFVGKPC  443



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 310/474 (65%), Gaps = 33/474 (7%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             ++L+  F    +IP++  +LG     D  W  R  EA    ++A+   PE  T     EV
Sbjct  6     AMLIFVFTLATLIPSLLADLGIF---DDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEV  62

Query  1345  --HSMRHETMAFEDD-----------------------REVVNGTRRHLRG--KKFKGPC  1247
               +S+   + +                            +  N TRR+LR   KK+ GPC
Sbjct  63    NKYSLAKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPC  122

Query  1246  KALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGT  1067
             +  NPIDRCWRC ++W KNRK++A CALGFG  TTGG  G  YVVTDSSDN + +PKPGT
Sbjct  123   QVTNPIDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGT  182

Query  1066  LRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVII  887
             LRHAVIQ  PLWIIFS +M I L  EL+++S KTIDGRG +V I  GAG T+QF+ NVII
Sbjct  183   LRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVII  242

Query  886   TNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAV  707
               ++I  I ATSGG IRDS  H G+RT  +GDGI+IFGS++VWIDH+SMSRC DG+IDA+
Sbjct  243   HGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAI  302

Query  706   KGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFH  527
              GSTA+TISNCHFT H+  +L GA++    D +MQ+TVAFNHFG+ L QRMPRCRWG FH
Sbjct  303   MGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFH  362

Query  526   IINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSD  350
             ++NNDYTHW +YA+GGS   TIISQGNR+IAPP  S+ K++T RD+    EW  WTW S+
Sbjct  363   VVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPP-ESHLKQVTKRDYATKGEWSKWTWRSE  421

Query  349   RDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              D  +N AFF  SG P+   K  R  ++   P + A ++TRFAGAL CK G+ C
Sbjct  422   NDLMMNGAFFVQSGQPR-TKKPNRKFMIKAKPGAVATRMTRFAGALDCKPGREC  474



>ref|XP_006361836.1| PREDICTED: probable pectate lyase P56-like [Solanum tuberosum]
Length=398

 Score =   448 bits (1152),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/372 (59%), Positives = 277/372 (74%), Gaps = 5/372 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N  RR L  KK+KGPC A+N ID+CWRCD  W ++R++MADCALGFG    GGK GPYY+
Sbjct  29    NAPRRKLT-KKYKGPCMAVNSIDKCWRCDPFWAEDRQKMADCALGFGINAMGGKYGPYYI  87

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             VTD+SD+++ +PKPGTLR  VIQ GPLWI F+ SM I L  EL+V+S+KTIDGRG YV I
Sbjct  88    VTDNSDDDVIDPKPGTLRFGVIQKGPLWITFAKSMRIELSRELIVSSNKTIDGRGKYVHI  147

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q   NVII+NL+I  I  T+GG++R+S  H GLR  DEGD I+IF S ++WI
Sbjct  148   ANGAGIKIQSASNVIISNLRIHHIVPTAGGLLRESDDHLGLRGGDEGDAISIFNSHDIWI  207

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAV GST +TISNCHFTDH KV+LFGAN+    D+ M+IT+ +NHFG
Sbjct  208   DHISMSRAADGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHSVEDRGMKITLVYNHFG  267

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPRCR+G FH++NNDYTHWE YA+GGS+G+TIISQGNR+IA       KE+T+R
Sbjct  268   KRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-KLLVKEVTYR  326

Query  394   DWPN---DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRF  224
             +      +EW  WTW+SD D+  N A FTPSGD     K   L+L+ P PSS  G +T+F
Sbjct  327   EKSTSSVEEWMKWTWISDGDDLENGATFTPSGDQNLLSKIDHLNLIQPEPSSKVGLLTKF  386

Query  223   AGALSCKYGKPC  188
             +GALSC   +PC
Sbjct  387   SGALSCNIRRPC  398



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 303/449 (67%), Gaps = 17/449 (4%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N  +L+  F   ++ P +     + H  D  W  R   A  +A++A+  +PE V  +   
Sbjct  5     NAGILLTLFGLASISPILKA---NTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              VH      M FE+     + TRR+LRG+ + G C A NPID+CWRCD++W  NRKR+AD
Sbjct  62    HVH------MMFENG----SSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLAD  111

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA GFG GT GGK+GP+YVVT+ +D+++  PKPGTLRHAVIQ+ PLWI F+  M I L  
Sbjct  112   CAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSE  171

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             ELL+TSDKTID RG+ V+I  GA  T+QFVKN+II  L I++ KA  GG+IRDS +H G 
Sbjct  172   ELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGF  231

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             R+  +GDGI++FG+S++WIDH+SMS C+DG+IDAV GSTA+T+SN HFT    V+L GA+
Sbjct  232   RSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGAS  291

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +  P D +MQ+TVAFNHFGK+L QRMPR R+G  H++NNDYTHW MYA+GGS   TI+SQ
Sbjct  292   DGHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQ  351

Query  451   GNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR++A     + KE+T RD  P   WK W W S+ D  +N AFF  SG     V   R 
Sbjct  352   GNRFLA-SNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVN--RQ  408

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P   A ++TRF+GAL+C   KPC
Sbjct  409   DVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 303/449 (67%), Gaps = 17/449 (4%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N  +L+  F   ++ P +     + H  D  W  R   A  +A++A+  +PE V  +   
Sbjct  5     NAGILLTLFGLASISPILKA---NTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
              VH      M FE+     + TRR+LRG+ + G C A NPID+CWRCD++W  NRKR+AD
Sbjct  62    HVH------MMFENG----SSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLAD  111

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA GFG GT GGK+GP+YVVT+ +D+++  PKPGTLRHAVIQ+ PLWI F+  M I L  
Sbjct  112   CAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSE  171

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             ELL+TSDKTID RG+ V+I  GA  T+QFVKN+II  L I++ KA  GG+IRDS +H G 
Sbjct  172   ELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGF  231

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             R+  +GDGI++FG+S++WIDH+SMS C+DG+IDAV GSTA+T+SN HFT    V+L GA+
Sbjct  232   RSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGAS  291

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +  P D +MQ+TVAFNHFGK+L QRMPR R+G  H++NNDYTHW MYA+GGS   TI+SQ
Sbjct  292   DSHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQ  351

Query  451   GNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR++A     + KE+T RD  P   WK W W S+ D  +N AFF  SG     V   R 
Sbjct  352   GNRFLA-SNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVN--RQ  408

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P   A ++TRF+GAL+C   KPC
Sbjct  409   DVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   447 bits (1150),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 279/382 (73%), Gaps = 4/382 (1%)
 Frame = -2

Query  1324  MAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagt  1145
             + F       N  RR L  KK+KGPC+A N ID+CWRCD +W +NR++MADCALGFG+  
Sbjct  17    LTFAALTTATNIPRRQLSNKKYKGPCRAENAIDKCWRCDPNWAENRQKMADCALGFGSNA  76

Query  1144  tggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKT  965
              GGK G  YVVTD+SD+++ +PKPGTLR+ VIQ  PLWIIF  +M I L  EL+VTS+KT
Sbjct  77    IGGKLGRIYVVTDNSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKT  136

Query  964   IDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGI  785
             IDGRG  V I  GAG  +Q   N+II+NL+I  I  T GG++R+S  H GLR  DEGDGI
Sbjct  137   IDGRGFNVHIQNGAGIKIQSASNIIISNLRIHNIVPTPGGLLRESEDHVGLRGSDEGDGI  196

Query  784   TIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVM  605
             +IF S ++WIDH+SMSR  DG+IDAV  ST +TISNCHFTDH KV+LFGAN+   +DK M
Sbjct  197   SIFSSHDIWIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDHYVLDKDM  256

Query  604   QITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPG  425
             +IT+A+NHFGKRL+QRMPRCR+G FH++NNDYTHWE YA+GGS+G+TIISQGNR+IA   
Sbjct  257   KITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-  315

Query  424   PSYFKEITHRDWPN---DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMP  254
                 KE+T+R+       EW  WTW+SD D+  N A FTPSGD     K   L+L+ P P
Sbjct  316   ELLVKEVTYREKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLDKIDHLNLIKPEP  375

Query  253   SSHAGKITRFAGALSCKYGKPC  188
             SS  G +T+F+GALSC  G+PC
Sbjct  376   SSKVGILTKFSGALSCVKGRPC  397



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   449 bits (1154),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 232/450 (52%), Positives = 297/450 (66%), Gaps = 17/450 (4%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             +       IP + G +G+    D Y   +   A   A K++  +PE++T  I   VH   
Sbjct  11    ILLVLAITIPCLEGRIGEF---DDYLKAQAEMARQIAFKSYVPNPENITTEINIHVH---  64

Query  1333  HETMAFEDDREVVNGTRRHLRGKK-------FKGPCKALNPIDRCWRCDKDWVKNRKRMA  1175
                      +   N TRR L  +K        +  C A NPID CWRC  DW KNR+ +A
Sbjct  65    --LAMEAAMKAEANDTRRELMSQKSRGGKGRRRARCMATNPIDSCWRCRNDWAKNRQLLA  122

Query  1174  DCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQ  995
              CA GFG  TTGG  G  YVVTD SDN++  P+PGTLR   +Q GPLWIIF  +M ITL 
Sbjct  123   TCAKGFGRRTTGGLGGRIYVVTDPSDNDLVNPRPGTLRFGAVQKGPLWIIFQRNMVITLT  182

Query  994   HELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKG  815
              EL+V+SDKTIDGRGA V+I  GAG T+QFV NVII  L+IK IKA +GG+IRDS  H G
Sbjct  183   QELMVSSDKTIDGRGANVQIREGAGITMQFVNNVIIHGLRIKNIKAKNGGLIRDSFDHLG  242

Query  814   LRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA  635
             +RT  +GD I++FGSSN+WIDH+S+S CEDG++D ++GSTAVTISNCH T H+ V+LFGA
Sbjct  243   VRTRSDGDAISVFGSSNIWIDHISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGA  302

Query  634   NNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIIS  455
             ++    DK+MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TI+S
Sbjct  303   SDTYQDDKIMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILS  362

Query  454   QGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGR  278
             QGNR+IAP   +  K ITHRD+ P   W  W W S+ D F+N A F  SG P  ++ + +
Sbjct  363   QGNRFIAPHNNAA-KTITHRDYAPEAVWSKWQWRSEGDHFMNGANFIQSGPPIKSLPFKK  421

Query  277   LDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               L+ P   S A ++TRF+GAL+C  G+PC
Sbjct  422   GFLMKPRHGSQANRLTRFSGALNCVVGRPC  451



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   448 bits (1152),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 232/449 (52%), Positives = 309/449 (69%), Gaps = 15/449 (3%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N S  ++ F F A+IPA+ G +G+    D  W  R+ EA +   +A+  +PE VT+++  
Sbjct  6     NRSFKLLLFLFAAIIPALQGHIGEY---DENWKQRELEAKENTEQAYNPNPEEVTQHVN-  61

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
               H +    M        +N TRRHLR +K  GPC   NPID+CWRCD++W KNR+R+AD
Sbjct  62    --HLVSRSLMG-------LNSTRRHLRARKKGGPCDPTNPIDQCWRCDRNWEKNRQRLAD  112

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA+GF  GT GGK G  YVVTD SD+++  PKPGTLRHAVIQ  PLWIIF+ +M I L+ 
Sbjct  113   CAIGFARGTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKE  172

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL+++ +KTID RGA V +  GAG T+Q+V+NVII  L I  I   +GG+IRDS  H G 
Sbjct  173   ELIMSGNKTIDARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGF  232

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGI++FG++NVW+DHLSM +C DG+IDA++GSTA+TISNCHFT H +V+LFGAN
Sbjct  233   RTKSDGDGISLFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGAN  292

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +   +D+ MQIT+ FNHFGK L QRMPRCRWG  H++NNDYTHW MYA+GGS+  T+ISQ
Sbjct  293   DNHKMDEKMQITLVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQ  352

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNRYIA    +  KE+T RD+ P + WK W W S+ D  +N AFF+ SGDP+ + K+   
Sbjct  353   GNRYIARRHVAS-KEVTKRDYAPPEVWKTWNWRSEGDLLLNGAFFSQSGDPKASSKFKGD  411

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               +   P+     +T+ +G L C  G+ C
Sbjct  412   TKVSAKPAYKVDLLTKDSGTLICIRGRAC  440



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   449 bits (1154),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 303/469 (65%), Gaps = 26/469 (6%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             S L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     
Sbjct  7     SKLMFMFCIAVLIPTIRGNISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  1345  HSMRHETMAFEDDREV----------------VNGTRRHLRGK------KFKGPCKALNP  1232
             +    +    E++ +                  N TRR LRGK      K KGPC A NP
Sbjct  64    YDNSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW K RKR+  C  GFG  TTGGK G  YVVT + D++M  PKPGTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAV  183

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWIIF   M+I L  ELL+ S KTID RGA V +  GAG T+QFVKNVII  L I
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHI  243

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNND  363

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ + DEWK W W S++D F+
Sbjct  364   YTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDVFM  423

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N A+F  SG+PQ    + R  ++ P       K+T++AGAL C+ GK C
Sbjct  424   NGAYFRQSGNPQYKCAHTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   448 bits (1152),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 297/427 (70%), Gaps = 14/427 (3%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             ++  D YW  R   A   +  A+ + P  V+ N T+ V  +   T+  +D        RR
Sbjct  36    VYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNFTSSVSEL---TIGKKD-------LRR  85

Query  1279  HLRGK-KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDS  1103
             +L+GK +  GPC A NPIDRCWRCD +W  NR+++ADC  GFG  T GGK GP+YVVTD 
Sbjct  86    NLKGKYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDP  145

Query  1102  SDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGA  923
             SD++M  PKPGTLRHAV +DGPLWIIF+ SM ITLQ EL++ S+KTIDGRG  V I  GA
Sbjct  146   SDDDMVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGA  205

Query  922   GFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLS  743
             G TVQFVKN+II  +K+  I    GG+IRDS TH G RT  +GDGI+IFGSSNVWIDH+S
Sbjct  206   GITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWIDHVS  265

Query  742   MSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLE  563
             M  C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+AFNHFGKRL 
Sbjct  266   MRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLV  325

Query  562   QRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-P  386
             QRMPR R+G  H +NNDYTHWEMYA+GGS   TIIS+GNR+IAP    + K+IT R++ P
Sbjct  326   QRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDN-QFAKQITKREYAP  384

Query  385   NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG-ALS  209
              + W  W W S  D ++N AFF  SG    +  + R D++     ++ G++TR++G  L 
Sbjct  385   ENVWANWQWRSINDVYMNGAFFVQSGPELASRPFSREDMITAKVGNYVGRLTRYSGNLLK  444

Query  208   CKYGKPC  188
             C+ G+PC
Sbjct  445   CRVGRPC  451



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 292/423 (69%), Gaps = 12/423 (3%)
 Frame = -2

Query  1453  SSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL  1274
             S D YW  RK  A     +A+   P   T N+T  +  +    +  E+        RR+L
Sbjct  37    SFDGYWKGRKQVAEKQNQEAYITDPYSFTINMTNNISDL----ITGEEK------GRRNL  86

Query  1273  RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
              GK+ +  C A NPIDRCWRCD  W +NRK++ADC  GFG  T GGK GP+YVVT + DN
Sbjct  87    AGKQSQDSCLATNPIDRCWRCDPKWSENRKKLADCVQGFGRDTIGGKKGPFYVVTSNLDN  146

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             +M  P PGTLRHAV ++GPLWIIF+ SM I L  EL+V  DKTIDGRGA + IV GAGFT
Sbjct  147   DMVNPVPGTLRHAVTRNGPLWIIFAHSMNIRLSQELIVAGDKTIDGRGADIYIVNGAGFT  206

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +QFVKNVII  +KI  I A  GG+IRDS +H GLRT  +GDGI+IFGSS +WIDH+SM  
Sbjct  207   IQFVKNVIIHGIKIFDINAGQGGLIRDSESHYGLRTQSDGDGISIFGSSYIWIDHVSMRN  266

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
               DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+ FNHFGKRL QRM
Sbjct  267   ARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQITLVFNHFGKRLVQRM  326

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-E  377
             PRCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR++AP      K+IT R++  + E
Sbjct  327   PRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKDA-KQITKREYSLEPE  385

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             WK W W S +DE +N AFF  SG       + R D++   P ++ G++TR AG+L C  G
Sbjct  386   WKKWQWRSIKDEVINGAFFIESGPDLTNRPFTRKDMISSRPGTYVGRLTRHAGSLRCIVG  445

Query  196   KPC  188
             KPC
Sbjct  446   KPC  448



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 302/453 (67%), Gaps = 23/453 (5%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ ++LLV    F  VIP +   + +    D +   +  EA   A++A+   PE VT  +
Sbjct  11    KVAFNLLV---TFAIVIPCLEAGIAEF---DDFLKAQADEAQKIALEAYVPVPEDVTDEL  64

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKG--PCKALNPIDRCWRCDKDWVKNRK  1184
                VH      ++ E      N TRR LR +K +    C A NPID CWRC+K+W  +R 
Sbjct  65    NFHVH------LSLE------NSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRY  112

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A C  GFG   TGG  GP YVVTD+SD++M  PKPGT+RHAV Q GPLWIIF  SM I
Sbjct  113   RLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMI  172

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL+++SDKTIDGRGA V    GAG T+QFV NVII  ++IK I    GG+IRDS  
Sbjct  173   KLNQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYN  232

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GD I+IFG+SNVWIDH+S+S C DG+ID ++GSTA+TISNCH T H+ V+L
Sbjct  233   HVGLRTKSDGDAISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVML  292

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA++    DK+MQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS+G T
Sbjct  293   FGASDSYSGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPT  352

Query  463   IISQGNRYIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             I+SQGNR+IAP   +  K ITHRD+   + WK W W S+ D F+N A F PSG P     
Sbjct  353   ILSQGNRFIAPNNNAA-KLITHRDYAEPQVWKNWQWQSEMDLFINGAQFIPSGSPI-KTT  410

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             Y +  L+ P   +HA ++TR +GAL+C  G+PC
Sbjct  411   YKKGLLMKPRDGTHASRLTRNSGALNCIVGRPC  443



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   446 bits (1147),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 299/453 (66%), Gaps = 22/453 (5%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
             F K N  L V+F     ++ ++   +G+    D  W  R  +A   A  A+  +P+ V  
Sbjct  3     FTKNNLFLFVMF----VLVLSIEAHIGEF---DEVWRKRAQQAKKAARHAYHPNPKIVAD  55

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
             ++  +V            D+ V     R     ++ G CKA NPID+CWRCD +W +NR 
Sbjct  56    HLNNQV------------DKAVRGSNSRRRDLHRYNGQCKATNPIDQCWRCDPNWARNRM  103

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             ++ADC LGFG  TTGGK G  YVVTD+SDN++  PKPGTLRHAVIQ  PLWIIF+ +M I
Sbjct  104   KLADCVLGFGRKTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVI  163

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL++TS+KTID RG  V I  G G  +QF+ NVII+NL+I   KA +GG+IRDS  
Sbjct  164   RLNEELIMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVN  223

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H G RT  +GDGI+IFGS+NVWIDH+SMS C+DG+IDAV+ STA+TISNCHFT H++V+L
Sbjct  224   HYGYRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVML  283

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
             FGA++    D +MQIT+AFNHFG+ L QRMPR RWG  H +NNDYTHW MYA+GGS   T
Sbjct  284   FGASDSSSRDSIMQITLAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPT  343

Query  463   IISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             I+SQGNR+IAPP P+  KE+T RD+ P   WK W W S  D  +N AFF  SG+P  A  
Sbjct  344   ILSQGNRFIAPPNPNA-KEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFL  402

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 D++   P S    +TRF+G+L+C  GKPC
Sbjct  403   RSP-DMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 297/424 (70%), Gaps = 17/424 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R+ +A+   + ++  +P +VT       H   H  +A  D  E  N TRR L G
Sbjct  32    DNYWKQRQGDALKQTIASYDPNPLNVTD------HLNYHVALAV-DATESTNNTRRELIG  84

Query  1267  KKFK---GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSD  1097
             ++ +   G C A NPID+CWRCD +W KNRK++ +C LGFG  TTGGKDGP YVV DSSD
Sbjct  85    RETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLVECVLGFGRKTTGGKDGPIYVVNDSSD  144

Query  1096  NEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGF  917
              ++  PKPGTLRHAV +DGPLWIIF+ SM I LQ EL++TS+KTIDGRGA V I+ GAG 
Sbjct  145   EDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTIDGRGARVYIMEGAGL  204

Query  916   TVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMS  737
             T QFV NVII N+ +K I   +GG+IRDS  H GLRT  +GDGI++FG++NVWIDH+SM+
Sbjct  205   TQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDHVSMT  264

Query  736   RCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQR  557
             RC DG+IDA++GSTAVTISN HFTDH +V+LFGA +   IDK MQITVAFNHFGKRLEQR
Sbjct  265   RCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGKRLEQR  324

Query  556   MPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-D  380
             MPRCR+G  H++NNDYTHWEMYA+GG+   TIISQGNR+IAPP     KE+T R++ +  
Sbjct  325   MPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPN-EQAKEVTKREYTSYT  383

Query  379   EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL-----LDPMPSSHAGKITRFAGA  215
             +WK W W S+ D F+N A+F  SG P       +  +     + P P +   ++T  AG 
Sbjct  384   DWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTMDAGV  443

Query  214   LSCK  203
             L C+
Sbjct  444   LGCE  447



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 302/469 (64%), Gaps = 26/469 (6%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             S L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     
Sbjct  7     SKLMFTFCIAVLIPTIRGNISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  1345  HSMRHETMAFEDDREV----------------VNGTRRHLRGK------KFKGPCKALNP  1232
             +    +    E+D +                  N TRR LRGK      K KGPC A NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW K RK++  C  GFG  TTGGK G  YVVT + D +M  PKPGTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWIIF   M+I L  ELL+ S KTID RGA V +  GAG T+QFVKNVII  L I
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHI  243

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNND  363

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ + DEWK W W SD+D F+
Sbjct  364   YTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFM  423

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N A+F  SG+PQ    + R  ++ P       K+T++AGAL C+ G+ C
Sbjct  424   NGAYFRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   446 bits (1148),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 302/454 (67%), Gaps = 5/454 (1%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+  + LV  F+F  +IP + G  G+I   D  W  R  +A    + A+   PE+VT   
Sbjct  2     KITKAQLVFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKF  61

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRK  1184
                VH       + +      +  RR+LRGK  K+ GPC A NPIDRCWRC  DW +NRK
Sbjct  62    NENVHKALVANKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRK  121

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+  C +GFG  T GG+ G YY VTD+SD++   PKPGTLR AVIQ  PLWIIF+  M I
Sbjct  122   RLTQCVIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHI  181

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L  EL+V S KTIDGRGA V I  GAG T+QFV +VII ++ I  I  +  G+IRDS  
Sbjct  182   KLSRELIVQSKKTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVD  241

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H GLRT  +GDGI IFGS+N+W+DHLSMS C+DG+IDA++GSTA+TISNCHFT H+ V+L
Sbjct  242   HIGLRTTGDGDGINIFGSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVIL  301

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
              GA++    DK+MQ+TVAFNHFGK L QRMPRCRWG FH++NNDYTHW+MYA+GGS   T
Sbjct  302   LGASDTYERDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPT  361

Query  463   IISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG-DPQGAV  290
             IISQGNR+IAP  P   KEIT+R++ P  EW  W W S+ D  +N A FT SG D     
Sbjct  362   IISQGNRFIAPDDPKA-KEITNRNYAPQSEWSKWVWRSEGDLLLNGARFTKSGPDKSPQF  420

Query  289   KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              + ++ ++   P++   ++TRFAGAL C+ G  C
Sbjct  421   DFTKMQMIKAKPATFVRRLTRFAGALDCEKGNKC  454



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   443 bits (1140),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 283/388 (73%), Gaps = 7/388 (2%)
 Frame = -2

Query  1339  MRHETMAFEDDREVVNGTRRHLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             M ++ + F+D   + N TRR LRGK  K+ GPC A+NPIDRCWRC K+W KNRKR+A C 
Sbjct  1     MSNQPLEFKD--VITNSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCV  58

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG  T GGK G YY+VTD+SD+++  PKPGTLRHAVIQ  PLWIIF+  M I L  EL
Sbjct  59    LGFGHKTRGGKKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKEL  118

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             +V S KTIDGRG  V I  G G T+QFV NVII N+ I R+  +SGG+IRDS  H G RT
Sbjct  119   MVQSHKTIDGRGVNVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRT  178

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSS +W+DH+SMS C+DG+IDA++GSTA+TISNCHFT H  V+L GA++ 
Sbjct  179   VGDGDGISIFGSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDT  238

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D+ MQ+T+AFNHFGK L QRMPRCRWG FH++NNDYTHW++YA+GGS   TIISQGN
Sbjct  239   YSKDQYMQVTLAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGN  298

Query  445   RYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGA-VKYGRLD  272
             R+IAP  P   KEITHR++ P  EW+ W W S+ D F+N AFF  SG P    +K  + D
Sbjct  299   RFIAPDDP-LTKEITHRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKD  357

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
             ++   P+   G++T+F+G L CK G  C
Sbjct  358   IIKAKPAIFVGRLTKFSGTLKCKEGVKC  385



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   445 bits (1145),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/433 (53%), Positives = 299/433 (69%), Gaps = 14/433 (3%)
 Frame = -2

Query  1480  VAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDRE  1301
             V+G+   +   D YW  R A+AM  A  +    PE+VT    A+VH      M       
Sbjct  23    VSGQNDTVELEDEYWKQRAADAMRIANASVHPDPENVTEEFNAKVH---EHIMG------  73

Query  1300  VVNGTRRHLRG-KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
               N TRR LRG K+++GPC+A NPID CWRCD +W  NR+++ DC++GFG  TTGGK GP
Sbjct  74    -QNRTRRTLRGFKRYEGPCRATNPIDACWRCDPEWADNRQKLVDCSMGFGKKTTGGKGGP  132

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVTD SD+++  PK GTLR+AV +  PLWIIF+ SM I LQ EL+VT DKTIDGRGA 
Sbjct  133   IYVVTDGSDDDIVNPKEGTLRYAVTRKRPLWIIFAHSMVIRLQQELMVTCDKTIDGRGAN  192

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             + I  G G T+Q+V NVIITN+K+K I++  GG++RD+  H GLRT  +GDGI++F +SN
Sbjct  193   IVIAYGGGITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISLFSASN  252

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFN  584
             +WIDH+SM+R  DG+ID + GSTAVTISN HFTDH++ +LFGA N    DK MQIT+AFN
Sbjct  253   IWIDHVSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQITLAFN  312

Query  583   HFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEI  404
             HFG+ L QRMPRCR+G FH++NNDYT W MYA+GG+   TIISQGNR+IAP      KE+
Sbjct  313   HFGQGLVQRMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIAPES-HVAKEV  371

Query  403   THRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITR  227
             T R++ ++ EWK W W S+ D   N AFF  SG+P  A K   ++++   P   A ++T 
Sbjct  372   TKREYTDESEWKNWNWRSEGDVMENGAFFVESGNPNCA-KSTNIEMMPFKPGKLAPQLTS  430

Query  226   FAGALSCKYGKPC  188
             FAGAL C  G+PC
Sbjct  431   FAGALECFVGRPC  443



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   446 bits (1148),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 301/469 (64%), Gaps = 27/469 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             LV      ++IP +   + D   +D YWVN+  EA  + + A+   P  +  +       
Sbjct  9     LVCVICIASLIPTIRANVAD--ETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  1357  -TAEVHSMRHETMAFEDDREVV-------NGTRRHLRGK----------KFKGPCKALNP  1232
              + +V     E     ++ +V+       N TRR L G+          K  GPC A NP
Sbjct  67    NSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW + RK++  C  GFG  TTGGK G  YVVT   D++M  P+PGTLRHAV
Sbjct  127   IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWI+F   M+I L  EL++TSDKTID RGA V I  GAG T+Q+V N+II  L +
Sbjct  187   IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHV  246

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GSTA
Sbjct  247   HHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTA  306

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  307   ITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNND  366

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ ++ EWK W W S++D F+
Sbjct  367   YTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFM  426

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N+A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  427   NNAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   443 bits (1140),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/370 (60%), Positives = 273/370 (74%), Gaps = 3/370 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N TRRHL  KK+KGPC A N ID+CWRCD  W  NR++ ADCA+GFG+  TGGK G  YV
Sbjct  30    NSTRRHL-AKKYKGPCMATNLIDKCWRCDPQWADNREKYADCAMGFGSKATGGKGGRVYV  88

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             V+D+SD+++E P PGTLRHAVIQ  PLWIIF   M I LQ ELL+   KTIDGRG  + I
Sbjct  89    VSDNSDSDVENPAPGTLRHAVIQTEPLWIIFERHMHIKLQRELLMQGHKTIDGRGFNIHI  148

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q V NVII+NL +  I  T GG+IRDSA H G+R+ DEGDGI++F ++++WI
Sbjct  149   EKGAGLKMQGVSNVIISNLHVHNIVITPGGMIRDSAEHVGIRSEDEGDGISLFSATDIWI  208

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAVKGST +TISNCHFTDH KV+LFGAN+    DK MQIT+A+NHFG
Sbjct  209   DHVSMSRATDGLIDAVKGSTGITISNCHFTDHDKVMLFGANDNHVEDKKMQITLAYNHFG  268

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPR R+G FHI+NNDYTHW  YA+GG+ G+TIISQGNR+IA   P   KE+THR
Sbjct  269   KRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNNGATIISQGNRFIAQASP-LIKEVTHR  327

Query  394   DWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG  218
             +   + EWK WTW+S  D+  N AFF  SGD     K   L+L+   PS   G IT+FAG
Sbjct  328   EKVEESEWKNWTWLSIDDDMQNGAFFKTSGDQDALSKLQDLNLIPAEPSYKVGIITKFAG  387

Query  217   ALSCKYGKPC  188
             +L+C  G+PC
Sbjct  388   SLACTAGRPC  397



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   446 bits (1148),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 285/406 (70%), Gaps = 15/406 (4%)
 Frame = -2

Query  1405  AMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPID  1226
             A  A+   PE V+RN+T  VH           +    N  RR L G+++ GPC A NPID
Sbjct  89    AQAAYEPDPEAVSRNLTHLVHM----------ELPSGNHMRRQL-GRRWHGPCVATNPID  137

Query  1225  RCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQ  1046
             RCWRCD+ W  NRK++ADCA+GFG    GGK G YYVVTD SDN++  PKPGTLRHAVIQ
Sbjct  138   RCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDNDLLNPKPGTLRHAVIQ  197

Query  1045  DGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKR  866
             + PLWIIF   M I L  EL+V S KT+DGRGA V I  GA  T+Q+VKNVII  L I  
Sbjct  198   NEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGACITIQYVKNVIIHGLHIHD  257

Query  865   IKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVT  686
              KA +GG+IRDS  H G+RT  +GDGI+I+GS+NVW+DH ++S+C+DG++DA+ GSTA+T
Sbjct  258   CKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDHNTLSKCQDGLVDAIMGSTAIT  317

Query  685   ISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYT  506
             ISN HF+ H +VLL G ++  P+DKVMQ+TVAFNHFGK L QRMPRCR+G FH++NNDYT
Sbjct  318   ISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKGLSQRMPRCRFGYFHVVNNDYT  377

Query  505   HWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDA  326
             HW  YA+GGS   TI+SQGNR++AP  P YFKEIT R  P+ +W  W W S+ D F N A
Sbjct  378   HWGKYAIGGSMNPTILSQGNRFVAPLDP-YFKEITKRFGPDLDWGSWNWKSEGDLFKNGA  436

Query  325   FFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              FT SG+ +   KY R   +   P S+ G +TRF+GAL CK G PC
Sbjct  437   IFTQSGNGR---KYERKISIRAKPGSYVGILTRFSGALKCKTGTPC  479



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   445 bits (1144),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 245/457 (54%), Positives = 299/457 (65%), Gaps = 31/457 (7%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             LL     F A++P     +  +H  D YW NR  +A   A +A+  +P+ +T N+   VH
Sbjct  8     LLFGCVFFLAIVPIFEANI--VHF-DQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVH  64

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                  +          N TRR L   K+KGPC A NPID CWRCD +W KNRK++ADC L
Sbjct  65    KALSGS----------NSTRREL--AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVL  112

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG GTTGGK G  YVVTDSSDN++  PKPGTLR A IQ  PLWIIF  +M I L+ ELL
Sbjct  113   GFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELL  172

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             +TSDKTID RGA V I  GA  T+Q+VKN+II  L I   K TSGG IRDS  H G R+ 
Sbjct  173   LTSDKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSA  232

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDH-----------S  656
              +GD I++FG+S+VWIDH+SM  C DG++DAV GSTA+TISNCH T H           S
Sbjct  233   SDGDAISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYS  292

Query  655   KVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGS  476
              V+LFGAN+    D++ QITVAFNHFGK L QRMPRCRWG FHI+NNDYTHW MYA+GGS
Sbjct  293   FVMLFGANDGFSGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGS  352

Query  475   AGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQ  299
                TI+SQGNR+IAPP P+  KE+T RD+ P   WK W+W S+ D  +N AFF  SG   
Sbjct  353   THPTILSQGNRFIAPPNPNA-KEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTK-  410

Query  298   GAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              A  + + D +   P S A  +TRF+G L C+ GKPC
Sbjct  411   -AANFPKSD-IKAKPGSFAAALTRFSGCLKCEVGKPC  445



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 233/446 (52%), Positives = 297/446 (67%), Gaps = 19/446 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV   +   V   VAG +G +H  D  W  R+  A   A +A+  +P  V  ++   VH 
Sbjct  8     LVFLISLFVVFTTVAGNIG-VH--DAVWQERREAAKKAARQAYQPNPGEVLDHLNENVH-  63

Query  1339  MRHETMAFEDDREVVNGTRRHLRG-KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                         + V G+    RG  K+KG C A NPID+CWRC  +W  NRK++ DCAL
Sbjct  64    ------------KSVEGSNNQRRGLSKYKGSCLATNPIDQCWRCQPNWANNRKKLVDCAL  111

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGGK G  YVVTD SD+++  PK GTLRHAVIQ  PLWIIF  +M I L  EL+
Sbjct  112   GFGRHTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELI  171

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             +TS+KTIDGRGA V I  GAG T+Q++ NVII N+++  IK  +GG+IRDSATH G RT 
Sbjct  172   MTSNKTIDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTR  231

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI++FGS+N+WIDH+S+SRC+DG+IDA++ STA+TISNCHF  H+ VLLFGA++  
Sbjct  232   SDGDGISLFGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSR  291

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQITVAFNHFGK L QRMPR RWG  HI+NNDYT W+MYA+GGS   TI+SQGNR
Sbjct  292   SEDHIMQITVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGNR  351

Query  442   YIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             ++AP  P + KE+T RD+  +  WK W W S+ D   N AFF  SGD          D++
Sbjct  352   FVAPDNP-FAKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDVAHHKFAKGPDMV  410

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
              P P   A K+++FAG L+C  GKPC
Sbjct  411   TPKPGGFASKLSQFAGPLNCIPGKPC  436



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   445 bits (1144),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 302/447 (68%), Gaps = 19/447 (4%)
 Frame = -2

Query  1513  VFFAFGAVIPAVAGELGDIHSSDLY---WVNRK-AEAMDYAMKAFTKHPEHVTRNITAEV  1346
             +F A   +     G +G+  + D     W  RK AEA + ++ A+   P  V  +    V
Sbjct  18    IFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHDPIEVMNHFNYHV  77

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             H             E  N TRR L   K++G CKA NPIDRCWRC  DW  +RK++ADC 
Sbjct  78    HRAL----------EGTNSTRRGL--NKYQGECKAQNPIDRCWRCKADWAVDRKKLADCV  125

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
              GFG  TTGGK G YY VTD SDN++  PKPGTLR AV+Q  PLWIIF+  MTI L+ EL
Sbjct  126   KGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPLWIIFAKDMTIKLKAEL  185

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             ++TSDKTIDGRGA V+I  GAG T+QF  NVII N+KI  I  ++GG+IRD+  H G+R 
Sbjct  186   MITSDKTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIRG  245

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
              D+GDGI +F SSN+W+DHLSM  C+DG+ID VK STA+T+SN HFT H  VLLFGA++ 
Sbjct  246   ADDGDGINVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADDK  305

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
             DP D++MQI++AFNHFGK L QRMPRCR+G FH++NNDYTHW MYA+GG++  TIISQGN
Sbjct  306   DPADEIMQISLAFNHFGKGLVQRMPRCRFGFFHVLNNDYTHWIMYAIGGTSHPTIISQGN  365

Query  445   RYIAPPGPSYFKEITHR-DWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL  269
             R+IAPP P+  K IT+R +   D+WK W W S+ D+FVN A+F  SG P    ++ + D 
Sbjct  366   RFIAPPNPTA-KMITNRNNVVGDDWKKWIWRSENDQFVNGAYFVESGHPLDETRFKK-DF  423

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             +   P ++  ++TRF+G L C+ G+ C
Sbjct  424   IKAKPGTYVRRLTRFSGQLRCRVGQSC  450



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/402 (59%), Positives = 286/402 (71%), Gaps = 19/402 (5%)
 Frame = -2

Query  1339  MRHETMAFEDDREV-VNGTRRHL------RGKKFK-----GPCKALNPIDRCWRCDKDWV  1196
             +RH   A E+  +   NGTRR L      RG+  K     G C A NPIDRCWRCD  W 
Sbjct  309   LRHVNKAVEETMKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWS  368

Query  1195  KNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSA  1016
             KNRK++ADCALGFG  TTGGK GPYYVVTD+SD+++  PK GTLRHAV ++ PLWI+F+ 
Sbjct  369   KNRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAK  428

Query  1015  SMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIR  836
             SM I LQ EL++TSDKTIDGRG  V I GGAGFT+QFV NVII N+ IK I   +GG+IR
Sbjct  429   SMVIKLQQELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIR  488

Query  835   DSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHS  656
             DS TH GLRT  +GDGI IFG++NVWIDH+SMS C DG+IDA++GST +TISNCH TDH 
Sbjct  489   DSETHFGLRTRSDGDGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQ  548

Query  655   KVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGS  476
             +V+LFG  + D IDK MQITVAFNHFGKRL QRMPRCR+GL H++NNDYTHWEMYA+GG+
Sbjct  549   EVMLFGGTDKDVIDKKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGN  608

Query  475   AGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQ  299
                TIISQGNR+IAPP     K++T R++ P  EWK W W S+ D F+N A+F  SG   
Sbjct  609   MNPTIISQGNRFIAPPNEEA-KQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRAN  667

Query  298   GAVKYGRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
                   +  +     + P P +   K+T  AG LSCK  KPC
Sbjct  668   ALSAAPKNPVPSKFAIRPQPGTLVRKLTMDAGVLSCKKRKPC  709



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 236/427 (55%), Positives = 295/427 (69%), Gaps = 17/427 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D YW  ++A A      A+  +PE VT+          H   A   D E  N TRR
Sbjct  11    IAEFDEYWQKKEAMARANVQNAYNPNPESVTK----------HFNDAVLKDLEK-NNTRR  59

Query  1279  HLRGKK-FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDS  1103
              LRGK+ + GPC A NPIDRCWRC ++W  +RKR+A CA GFG   TGGK+G +YVVTD 
Sbjct  60    GLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFYVVTDP  119

Query  1102  SDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGA  923
             SD ++  P+ GTLR+ VIQD PLWI+F+  M I L  EL+V S+KTIDGRG  V+I+ GA
Sbjct  120   SDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQIMNGA  179

Query  922   GFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLS  743
             G T+Q+V N+II NL+I  IKA +GG+IRDS  H GLRT  +GDGI+IFG+SNVWIDH+S
Sbjct  180   GITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWIDHVS  239

Query  742   MSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLE  563
             MS C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D VMQITVAFNHFGK L 
Sbjct  240   MSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHFGKGLV  299

Query  562   QRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-P  386
             QRMPRCRWG  H++NNDYTHW MYA+GGS   TI+SQGNR+IAPP   + KE+T R++ P
Sbjct  300   QRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPP-TLFAKEVTKREYSP  358

Query  385   NDEWKGWTWVSDRDEFVNDAFFTPSGDPQ-GAVKYGRLDLLDPMPSSHAGKITRFAGALS  209
              + WK W W S+ D   N AFF PSG  + G V Y   DL+   P +   ++TRF+GAL 
Sbjct  359   EEVWKSWQWRSEGDLLKNGAFFVPSGAGKLGNVSYK--DLIKAKPGTFVTRLTRFSGALK  416

Query  208   CKYGKPC  188
             C   +PC
Sbjct  417   CVPNRPC  423



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   444 bits (1141),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 294/446 (66%), Gaps = 16/446 (4%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L++   F   IP +   + +    D +   +  EA   A+ ++   P  V  ++   VH 
Sbjct  16    LILLVTFTITIPCLEAGIAEF---DDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHVH-  71

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKG-PCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                  +A E      N TRR L+ K   G  C+A NPID CWRC KDW  +R ++A C+ 
Sbjct  72    -----LALEG----ANDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDRFKLAKCSK  122

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG   TGG  GP YVVTD SDN+M+ PKPGTLR+  +Q GPLWI F  SM I L  ELL
Sbjct  123   GFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMIIRLNQELL  182

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             V+SDKTIDGRGA V+I  G G T+QFV NVII  L I  IK+  G +IRDS  H G RT 
Sbjct  183   VSSDKTIDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTR  242

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GD ++IFGSSN+WIDH+S+S+CEDG+ID ++GSTA+TISNCH T H+ V+LFGA++  
Sbjct  243   SDGDALSIFGSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTY  302

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               DK+MQITVAFNHFG+ L QRMPRCR+G  H++NNDYTHW+MYA+GGS+G TI+SQGNR
Sbjct  303   NGDKLMQITVAFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNR  362

Query  442   YIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAP   +  KEITHRD+   E WK W W S+ D F+N A F  SG P     + +  ++
Sbjct  363   FIAPDNDAA-KEITHRDYAEPEVWKNWQWQSEMDLFMNGAKFVTSGSPINKAPFKKGFIM  421

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
              P   SH  ++TR +GAL+C  GKPC
Sbjct  422   KPRDGSHVSRLTRHSGALNCVVGKPC  447



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 301/469 (64%), Gaps = 27/469 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             LV      ++IP +   + +   +D YWVN+  EA  + + A+   P  +  +       
Sbjct  9     LVCVICIASLIPTIRANVAE--ETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  1357  -TAEVHSMRHETMAFEDDREVV-------NGTRRHLRGK----------KFKGPCKALNP  1232
              + +V     E     ++ +V+       N TRR L G+          K  GPC A NP
Sbjct  67    NSTDVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  1231  IDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAV  1052
             ID+CWRC  DW + RK++  C  GFG  TTGGK G  YVVT   D++M  P+PGTLRHAV
Sbjct  127   IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  1051  IQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKI  872
             IQ  PLWI+F   M+I L  EL++TSDKTID RGA V I  GAG T+Q+V N+II  L +
Sbjct  187   IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHV  246

Query  871   KRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTA  692
               I  +SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GSTA
Sbjct  247   HHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTA  306

Query  691   VTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINND  512
             +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NND
Sbjct  307   ITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNND  366

Query  511   YTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFV  335
             YTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ ++ EWK W W S++D F+
Sbjct  367   YTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFM  426

Query  334   NDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             N+A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  427   NNAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   443 bits (1140),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 237/448 (53%), Positives = 301/448 (67%), Gaps = 11/448 (2%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKH-PEHVTRNITAEVH  1343
              V+F+    +  AV+ E  +I   D YW  RK  A D A +A  KH P  VT  +   VH
Sbjct  14    FVLFYLVLFLSAAVSSE-ANIGDFDDYWRQRKLMA-DAAAEATYKHDPLEVTNQLNRAVH  71

Query  1342  -SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
              S+  E M+    R  + G   H +GK   GPC+A NPIDRCWRC +DW  +RKR+A CA
Sbjct  72    RSVEKEDMSTR--RRAMMG---HKKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLARCA  126

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
              GFG  TTGG  G +YVVTD +D+++  P+PGTLR AVIQ  PLWI F+ +M ITL+ EL
Sbjct  127   QGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIITLKEEL  186

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATS--GGIIRDSATHKGL  812
             ++  DKTIDGRGA V+I  GA  TVQF  NVII N+ I  I +++  GG IRDS  H G 
Sbjct  187   IIQGDKTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDSPDHFGW  246

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             RT  +GDGIT+FGS+NVW+DHLS+S C+DG+ID +  ST VTISNCH T+H+ V+LF ++
Sbjct  247   RTVSDGDGITLFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDVMLFSSS  306

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +  P D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQ
Sbjct  307   DKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQ  366

Query  451   GNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLD  272
             GNRYIAPP  +      H D P  EWK W W S+ D F+  A FT SG  +    + + D
Sbjct  367   GNRYIAPPNLAAKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQKINRNFHKKD  426

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
             L+ P   S+  ++TR+AGAL+C+ GKPC
Sbjct  427   LIKPKNGSYVTRLTRYAGALACRPGKPC  454



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   443 bits (1140),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 298/450 (66%), Gaps = 21/450 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             L VVFF   A  P     +GD    D +W  RKA A   A   +   P  V  ++   VH
Sbjct  15    LYVVFFFLSASAPVSQANIGDF---DEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVH  71

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADC  1169
                 E  A         GTRR + GK  KF GPC+A NPIDRCWRC KDW  +RKR+A C
Sbjct  72    RATKEDDA---------GTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWATDRKRLARC  122

Query  1168  ALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHE  989
             A GFG   TGG  G +Y+VTD SD+++  P+PGTLR AVIQ  PLWIIF+ SM I L+ E
Sbjct  123   AQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSMLIKLKEE  182

Query  988   LLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLR  809
             LL+ SDKTIDGRGA V+I  GA  TVQ+  NVII N+ I  +    GG+IRDS  H G R
Sbjct  183   LLIGSDKTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFR  242

Query  808   TFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANN  629
             T  +GDG+ +FGS++VW+DHLS++ C+DG+ID +  ST VTISNCH T+H+ V+LFG+++
Sbjct  243   TQSDGDGVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSD  302

Query  628   WDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQG  449
              +P D +MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQG
Sbjct  303   SNPKDVIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQG  362

Query  448   NRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGR  278
             NRYIAPP  +  K+IT +    + EWK W W S  D  +N AFFT +G   G +  K+ +
Sbjct  363   NRYIAPPNLAA-KQITKQIGAAEPEWKNWVWHSQEDLLMNGAFFTETG---GDIKRKFDK  418

Query  277   LDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              DL+ P P ++  ++TR+AG + C+ GKPC
Sbjct  419   DDLIKPKPGTYVTRLTRYAGCIPCRPGKPC  448



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   443 bits (1139),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 289/428 (68%), Gaps = 16/428 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D YW  R+ EA   A+ AF   PE V  +    V     E   F       NGTRR
Sbjct  28    IAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNV-----EKSIFGK-----NGTRR  77

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
             +L  K  KGPCKA NPIDRCWRC ++W  +R+R+ADC LGFG  T GGK G  Y+VTD S
Sbjct  78    NL--KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTDPS  135

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DN+M  PKPGTLR+AVIQ  PLWI+F  SM I L+ EL+VTSDKTIDGRG  V I  GAG
Sbjct  136   DNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYGAG  195

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              T+QF +NVII  L I  I +  GG+IRDS  H GLRT  +GDGI+IFGSS+VWIDH SM
Sbjct  196   ITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDHNSM  255

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S+CEDG++DA++GSTA+TISN HFT H++ +L GA++    D +MQ+TVAFNHFG+ L Q
Sbjct  256   SKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRGLIQ  315

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPP--GPSY-FKEITHRDW  389
             RMPRCRWG FH++NNDYTHW MYAVGGSA  TI+SQGNRY+A P   P +  KE+T RD 
Sbjct  316   RMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDH  375

Query  388   PND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
                 EW  WTW S+ D  VN AFF  SG P     + R D++   P     ++TR++GAL
Sbjct  376   ATKAEWSKWTWRSEGDLMVNGAFFVQSGVPFKKKPFSRYDMIKAKPGKFVPRLTRYSGAL  435

Query  211   SCKYGKPC  188
             +C    PC
Sbjct  436   TCWRTSPC  443



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   442 bits (1138),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 289/428 (68%), Gaps = 16/428 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D YW  R+ EA   A+ AF   PE V  +    V     E   F       NGTRR
Sbjct  28    IAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNV-----EKSIFGK-----NGTRR  77

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
             +L  K  KGPCKA NPIDRCWRC ++W  +R+R+ADC LGFG  T GGK G  Y+VTD S
Sbjct  78    NL--KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTDPS  135

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DN+M  PKPGTLR+AVIQ  PLWI+F  SM I L+ EL+VTSDKTIDGRG  V I  GAG
Sbjct  136   DNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYGAG  195

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              T+QF +NVII  L I  I +  GG+IRDS  H GLRT  +GDGI+IFGSS+VWIDH SM
Sbjct  196   ITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDHNSM  255

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S+CEDG++DA++GSTA+TISN HFT H++ +L GA++    D +MQ+TVAFNHFG+ L Q
Sbjct  256   SKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRGLIQ  315

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPP--GPSY-FKEITHRDW  389
             RMPRCRWG FH++NNDYTHW MYAVGGSA  TI+SQGNRY+A P   P +  KE+T RD 
Sbjct  316   RMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDH  375

Query  388   PND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGAL  212
                 EW  WTW S+ D  VN AFF  SG P     + R D++   P     ++TR++GAL
Sbjct  376   ATKAEWSKWTWRSEGDLMVNGAFFVQSGVPFKKKPFSRYDMIKAKPGKFVPRLTRYSGAL  435

Query  211   SCKYGKPC  188
             +C    PC
Sbjct  436   TCWRTSPC  443



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   442 bits (1138),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 295/446 (66%), Gaps = 16/446 (4%)
 Frame = -2

Query  1510  FFAFGAVIPAVAGELG-DIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             FF    +  A A   G DI   D +W  +  EA+  +  A+   PE VT +    VH   
Sbjct  10    FFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVH---  66

Query  1333  HETMAFEDDREVVNGTRRHLRG---KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                +A  + R   N TRR LR    KKFKG C A NPIDRCWRC K+W+K+RK++A C  
Sbjct  67    ---LALAEAR---NSTRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGK  120

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG   TGGK G +YVVTD SD+++  PK GTLR  VIQD PLWI+F+  M I L  EL+
Sbjct  121   GFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELM  180

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             + S+KTID RGA V I  GA  T+QFV NVII  L I  IK ++GG+IRDS  H GLRT 
Sbjct  181   INSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTK  240

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+I+GSS+VWIDH SM  C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +
Sbjct  241   SDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSN  300

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQ TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  301   ENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNR  360

Query  442   YIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAPP   + KE+T RD+   D WK WTW S+ D   N AFF  SG P     + R D +
Sbjct  361   FIAPP-LRFAKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGTPNTRT-FHRKDFI  418

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P +   ++TRFAG L CK G+ C
Sbjct  419   RAKPGTWVRRLTRFAGPLGCKAGRAC  444



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   443 bits (1139),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 241/455 (53%), Positives = 304/455 (67%), Gaps = 23/455 (5%)
 Frame = -2

Query  1507  FAFGAVIPAVAGELGDIHSS--DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             FAF ++  AV       H +  D YW  R+A A+   ++++  +P +VT       H   
Sbjct  13    FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTD------HLNY  66

Query  1333  HETMAFEDDREVVNGTRRHL-------RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMA  1175
             H  +A E      NGTRR L       + K+  G   +LN ID+CWR  ++W KNRK++A
Sbjct  67    HAALAMETT-GADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLA  125

Query  1174  DCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQ  995
             DC LGFG  TTGGK GP YVVTD+SD+++  PKPGTLR+AV +D PLWIIF  SM I LQ
Sbjct  126   DCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQ  185

Query  994   HELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKG  815
              EL++ SDKTIDGRGA + I GGAG T+QFVKNVII N+ IK I   +GG+IRDS  H G
Sbjct  186   QELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFG  245

Query  814   LRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA  635
              RT  +GDGI IFGS+NVWIDH+SM+ C DG+ID + GSTA+TISNCH TDH++V+LFGA
Sbjct  246   HRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGA  305

Query  634   NNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIIS  455
                D IDK MQITVAFNHFGKRL QRMPR R+GL H++NNDYTHWEMYA+GG+   TIIS
Sbjct  306   REEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIIS  365

Query  454   QGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGA  293
             QGNR+IAPP  +  K++T R++    EWK W W S+RD F+N A+F  SG      P   
Sbjct  366   QGNRFIAPPKENS-KQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPE  424

Query  292   VKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 R   + P P +   ++T+ AG L C+ GK C
Sbjct  425   NPIPRHFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/468 (48%), Positives = 297/468 (63%), Gaps = 27/468 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV      ++IP +   L ++  +D YWVN+  EA  + + A+   P  +  +     + 
Sbjct  9     LVCVICIASLIPTI---LANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV---------------VNGTRRHLRGK--------KFKGPCKALNPI  1229
                +    E+D+ V                N TRR L GK        K KGPC A NPI
Sbjct  66    NSTDVEGTEEDKAVDSTEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPI  125

Query  1228  DRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVI  1049
             D+CWRC  DW + RKR+  C  GFG  TTGGK G  YVVT   D++   P+PGTLRHAVI
Sbjct  126   DKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  185

Query  1048  QDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIK  869
             Q  PLWIIF   M+I L  EL++ S KTID RGA V I  GAG T+Q+V N+II  L + 
Sbjct  186   QKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVH  245

Query  868   RIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAV  689
              I ++SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GSTA+
Sbjct  246   HIVSSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAI  305

Query  688   TISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDY  509
             TISN HFT H+ V+L GA + +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDY
Sbjct  306   TISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  365

Query  508   THWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVN  332
             THWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ P  EWK W W S++D F+N
Sbjct  366   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLN  425

Query  331   DAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  426   GAYFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 296/447 (66%), Gaps = 23/447 (5%)
 Frame = -2

Query  1516  VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH-S  1340
             V+F +  AV  A  GE       D +W  RK EA   A   +  +P  V  ++   VH S
Sbjct  17    VLFLSAAAVSEANIGEF------DEHWQRRKLEARARAEATYHPNPIEVANSLNRAVHRS  70

Query  1339  MRHETMAFEDDREVVNGTRRHLRG--KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             +R E+           G+RR L G  KKF GPC A NPIDRCWRC KDW  +R R+A CA
Sbjct  71    LRDES-----------GSRRKLLGLHKKFAGPCTATNPIDRCWRCRKDWATDRMRLARCA  119

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
              GFG   TGG  G  Y+VTD +D+++ EP+PGTLR  VIQ+ PLWIIF+  M I L+ EL
Sbjct  120   QGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFARPMLIKLKEEL  179

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             LV SDKTIDGRGA V+I  GA  TVQ+  NVII N+ +  +    GG IRDS  H G RT
Sbjct  180   LVGSDKTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRT  239

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDG+++FGS+NVW+DHLS++ C+DG+ID +  +T VTISNCH T+H+ V+LFG+++ 
Sbjct  240   QSDGDGVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGSSDS  299

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
             +P D++MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGN
Sbjct  300   NPKDQIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGN  359

Query  445   RYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDL  269
             RYIAPP  +  K IT R   ++ EWK W W S  D  +NDA F  SG      K+ + DL
Sbjct  360   RYIAPPNLAA-KLITKRLGASEAEWKNWVWHSQDDLLLNDAVFADSGGAN-ERKFDKDDL  417

Query  268   LDPMPSSHAGKITRFAGALSCKYGKPC  188
             + P P S+  ++TRFAG L CK GKPC
Sbjct  418   ITPKPGSYVTRLTRFAGCLPCKPGKPC  444



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 304/455 (67%), Gaps = 23/455 (5%)
 Frame = -2

Query  1507  FAFGAVIPAVAGELGDIHSS--DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             FAF ++  AV       H +  D YW  R+A A+   ++++  +P +VT       H   
Sbjct  13    FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTD------HLNY  66

Query  1333  HETMAFEDDREVVNGTRRHL-------RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMA  1175
             H  +A E      NGTRR L       + K+  G   +LN ID+CWR  ++W KNRK++A
Sbjct  67    HAALAMETT-GADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLA  125

Query  1174  DCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQ  995
             DC LGFG  TTGGK GP YVVTD+SD+++  PKPGTLR+AV +D PLWIIF  SM I LQ
Sbjct  126   DCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQ  185

Query  994   HELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKG  815
              EL++ SDKTIDGRGA + I GGAG T+QFVKNVII N+ IK I   +GG+IRDS  H G
Sbjct  186   QELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFG  245

Query  814   LRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA  635
              RT  +GDGI IFGS+NVWIDH+SM+ C DG+ID + GSTA+TISNCH TDH++V+LFGA
Sbjct  246   HRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGA  305

Query  634   NNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIIS  455
                D +DK MQITVAFNHFGKRL QRMPR R+GL H++NNDYTHWEMYA+GG+   TIIS
Sbjct  306   REEDVVDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIIS  365

Query  454   QGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGA  293
             QGNR+IAPP  +  K++T R++    EWK W W S+RD F+N A+F  SG      P   
Sbjct  366   QGNRFIAPPKENS-KQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPE  424

Query  292   VKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 R   + P P +   ++T+ AG L C+ GK C
Sbjct  425   NPIPRHFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 232/467 (50%), Positives = 301/467 (64%), Gaps = 26/467 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     + 
Sbjct  9     LMFMFCIAGLIPTIRGNISEL---DEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1339  MRHETMAFEDD-------------REVVNGT---RRHLRGK------KFKGPCKALNPID  1226
                +    E+D             + V N T   RR LRGK      K KGPC A NPID
Sbjct  66    NSTDATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPID  125

Query  1225  RCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQ  1046
             +CWRC  +W K RK++  C  GFG  TTGGK G  YVVT + D +M  PKPGTLRHAVIQ
Sbjct  126   KCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQ  185

Query  1045  DGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKR  866
               PLWIIF   M+I L  ELL+ S KTID RGA V I  GAG T+QFVKNVII  L I  
Sbjct  186   KEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIHH  245

Query  865   IKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVT  686
             I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST +T
Sbjct  246   ISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGIT  305

Query  685   ISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYT  506
             ISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDYT
Sbjct  306   ISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  365

Query  505   HWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVND  329
             HWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ P DEWK W W S++D F+N 
Sbjct  366   HWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNG  425

Query  328   AFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  426   AYFRQSGNPHFKCAHTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  472



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   442 bits (1137),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/468 (48%), Positives = 294/468 (63%), Gaps = 27/468 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV      ++IP +   + +   +D YWVN+  EA  + + A+   P  +  +     + 
Sbjct  9     LVCVICIASLIPTIRANVAE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV---------------VNGTRRHLRGK--------KFKGPCKALNPI  1229
                +    E+D  V                N TRR L GK        K KGPC A NPI
Sbjct  66    NSTDVEGTEEDTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPI  125

Query  1228  DRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVI  1049
             D+CWRC  DW K RKR+  C  GFG  TTGGK G  YVVT   D++   P+PGTLRHAVI
Sbjct  126   DKCWRCQPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  185

Query  1048  QDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIK  869
             Q  PLWIIF   M+I L  EL++ S KTID RGA V I  GAG T+Q+V N+II  L + 
Sbjct  186   QKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVH  245

Query  868   RIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAV  689
              I  +SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GSTA+
Sbjct  246   HIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAI  305

Query  688   TISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDY  509
             TISN HFT H+ V+L GA + +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDY
Sbjct  306   TISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  365

Query  508   THWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVN  332
             THWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ P  EWK W W SD+D F+N
Sbjct  366   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLN  425

Query  331   DAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  426   GAYFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   441 bits (1134),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 302/460 (66%), Gaps = 30/460 (7%)
 Frame = -2

Query  1537  KMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI  1358
             K+ ++LL  F     VIP +   + +    D +   +  EA   A+ ++   P  V   +
Sbjct  7     KVAFTLLATF---AIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHEL  60

Query  1357  TAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKG--PCKALNPIDRCWRCDKDWVKNRK  1184
                VH      MA E      N TRR LR +K +G   C+A NPID CWRC+KDW  +R 
Sbjct  61    NFHVH------MALE------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRF  108

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHA-------VIQDGPLWII  1025
             R+A C  GFG   TGG  GP YVVTD+SD++M  PKPGT+RHA       V Q GPLWII
Sbjct  109   RLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLWII  168

Query  1024  FSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGG  845
             F  SM I+L+ EL+++SDKTIDGRGA V    GAG T+QFV NVII  ++IK I    GG
Sbjct  169   FGHSMIISLRQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKDGG  228

Query  844   IIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFT  665
             +IRDSA H GLRT  +GD I+IFGS+N+WIDH+S+S C DG+ID ++GSTA+TISNCH T
Sbjct  229   MIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMT  288

Query  664   DHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAV  485
              H+ V LFGA++    DK+MQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+
Sbjct  289   KHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAI  348

Query  484   GGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSG  308
             GGS+G TI+SQGNR+IAP   +  KEITHRD+   D WK W W S+ D F+N A F  SG
Sbjct  349   GGSSGPTILSQGNRFIAPNNDNA-KEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSG  407

Query  307   DPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              P   + Y +  ++ P   +H  ++TR AGAL+C  GKPC
Sbjct  408   SPI-KMTYKKGLIMKPRDGTHVSRLTRHAGALNCFVGKPC  446



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   440 bits (1132),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 296/446 (66%), Gaps = 20/446 (4%)
 Frame = -2

Query  1519  LVVFFAFGAV-IPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             LV  FAF AV +P +   + D    D  W  R  EA    +KA+   P  V  +    VH
Sbjct  8     LVFAFAFLAVAVPVLRANIADF---DEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVH  64

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                       +D +  N TRR L  K+ KG C A NPIDRCWRC KDW  +RKR+A+CAL
Sbjct  65    ----------EDMQRSNNTRRSL--KRTKGGCLATNPIDRCWRCRKDWASHRKRLANCAL  112

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG GTTGGK G  Y VTD SD+ +  PKPGTLRHAVIQ  PLWIIF+ +M I L  EL+
Sbjct  113   GFGRGTTGGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELI  172

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             VT +KTIDGRGA V I  GA  T+QFV+NVII  L I      +GG+IRDS  H G RT 
Sbjct  173   VTDNKTIDGRGANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTG  232

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI++FG++NVWIDH+SMS C DG+ID ++ STA+TISNCHFT H++V+LFG ++  
Sbjct  233   SDGDGISLFGATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTY  292

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D  MQITVAFNHFG+ L QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  293   SDDAHMQITVAFNHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGNR  352

Query  442   YIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLL  266
             +IAP  P+  KE+T RD+   D WK W+W S+ D  +N AFF  SG P   V   + +++
Sbjct  353   FIAPLDPNC-KEVTKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSPIRNVN--KNNVI  409

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
                P S   ++TRFAGAL+C  GKPC
Sbjct  410   KAKPGSFVTRLTRFAGALNCVKGKPC  435



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   441 bits (1135),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/468 (48%), Positives = 296/468 (63%), Gaps = 27/468 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV      ++IP +   + +   +D YWVN+  EA  + + A+   P  +  +     + 
Sbjct  9     LVCVICIASLIPTIRANVAE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV---------------VNGTRRHLRGK--------KFKGPCKALNPI  1229
                +    E+D+ V                N TRR L GK        K KGPC A NPI
Sbjct  66    NSTDVEGTEEDKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPI  125

Query  1228  DRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVI  1049
             D+CWRC  DW + RKR+  C  GFG  TTGGK G  YVVT   D++   P+PGTLRHAVI
Sbjct  126   DKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  185

Query  1048  QDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIK  869
             Q  PLWIIF   M+I L  EL++ S KTID RGA V I  GAG T+Q+VKN+II  L + 
Sbjct  186   QKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVH  245

Query  868   RIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAV  689
              I  +SGG+IRDS  H G R   +GDGI+IFG++++W+DH+SMS+C+DG+IDA+ GSTA+
Sbjct  246   HIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGSTAI  305

Query  688   TISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDY  509
             TISN HFT H+ V+L GA + +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDY
Sbjct  306   TISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  365

Query  508   THWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVN  332
             THWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ P  EWK W W S++D F+N
Sbjct  366   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLN  425

Query  331   DAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  426   GAYFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   440 bits (1132),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 226/419 (54%), Positives = 289/419 (69%), Gaps = 13/419 (3%)
 Frame = -2

Query  1441  YWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKK  1262
             YW  + + A     KA+T  P  V+ N++  V  M            + N  RR+L G K
Sbjct  43    YWQQKASAAAMKNDKAYTPDPYAVSGNLSHSVSEM-----------IIGNQGRRNLAGGK  91

Query  1261  FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEE  1082
              +GPC A NPIDRCWRCD +W  NR+++ADC  GFG  TTGGK GP YVVTD SD++M  
Sbjct  92    ARGPCMATNPIDRCWRCDPNWANNRQKLADCVKGFGRKTTGGKGGPIYVVTDPSDSDMVN  151

Query  1081  PKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFV  902
             P+PGTLR  V ++GPLWI F+ SMTI L  EL++TS KTIDGRGA V I  GAG T+QF+
Sbjct  152   PRPGTLRFGVTRNGPLWITFARSMTIRLNQELIMTSHKTIDGRGADVTIASGAGITIQFI  211

Query  901   KNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDG  722
             +NVII  +KI  I   SGG+IRD   H G RT  +GDGI+IFGSSN+WIDH+SM  C DG
Sbjct  212   ENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDHVSMRNCRDG  271

Query  721   IIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCR  542
             ++DA+ GSTA+TISN HFTDH++V+LFGA++    D+ MQITVAFNHFGKRL QRMPRCR
Sbjct  272   LVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQITVAFNHFGKRLIQRMPRCR  331

Query  541   WGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDE-WKGW  365
             +G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IA P   + KEIT R++ ++  WK W
Sbjct  332   FGFIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIA-PNNGHAKEITKREYVDESVWKSW  390

Query  364   TWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              W S  D ++N AFF   G       + R D++   P ++ G++TR++G+L C  GKPC
Sbjct  391   QWRSINDVYLNGAFFRQGGPELKDRPFSRKDMIKSRPGTYVGRLTRYSGSLRCIVGKPC  449



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   439 bits (1130),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 286/425 (67%), Gaps = 15/425 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D  W  R  +A   A  A+  +P+ V  ++  +V            D+ V     R
Sbjct  25    IKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV------------DKAVRGSKSR  72

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
                 +++ G C A NPID+CWRCD +W +NR ++ DC LGFG  TTGGK G  YVV D+S
Sbjct  73    RRDLQRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNS  132

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DNE+  PKPGTLRHAVIQ  PLWIIF+ +M I L  EL++TS+KTID RG  V I  G G
Sbjct  133   DNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVHIAHGGG  192

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
               +QF+ NVII+NL I   KA +GG+IRDS +H G R+  +GDGI+IFGS+NVWIDH+SM
Sbjct  193   LMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHISM  252

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S C+DG+IDAV+GSTA+TISNCHFT H+ V+LFGA++    D VMQIT+AFNHFG  L Q
Sbjct  253   SNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGLTQ  312

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PN  383
             RMPR RWG  H++NNDYTHW MYA+GGS   TI+SQGNR+IAPP P+  KE+T RD+ P 
Sbjct  313   RMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNA-KEVTKRDYAPE  371

Query  382   DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCK  203
             + WK W W S  D  +N AFF  SGDP+ A   G  D++   P S    +T+F+G+L C 
Sbjct  372   NVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLKGP-DMITSKPGSSVSSLTQFSGSLKCI  430

Query  202   YGKPC  188
              G+PC
Sbjct  431   EGRPC  435



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   438 bits (1127),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 285/445 (64%), Gaps = 46/445 (10%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV+   F  ++PAV   +GD    D  W  R  EA   A++A+  HPE VT N   +VH 
Sbjct  8     LVILIPFLVIVPAVTANIGDF---DEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVH-  63

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                                                   +CWRC  DW  NR ++ADC LG
Sbjct  64    --------------------------------------KCWRCRSDWASNRMKLADCVLG  85

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGGK G  YVVTD SDN+M  PKPGTLRHA IQ+ PLWIIF+ SM I L  EL++
Sbjct  86    FGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIM  145

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
             TS+KTID RGA V I  GAG T+QFV N+II  L I  IK  +GG+IRDSA+H G RT  
Sbjct  146   TSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRS  205

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGI+IFG++N+WIDH+SMS C DG+IDA+  STA+TISNCHFT H++V+LFGA++   
Sbjct  206   DGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYS  265

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D +MQIT+ FNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGNR+
Sbjct  266   GDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRF  325

Query  439   IAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLD  263
             IAPP  +  KE+T RD+ P   WK WTW S  D  +N AFF  SGDP     +    ++ 
Sbjct  326   IAPPDINC-KEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPN--FDFSNKYVIR  382

Query  262   PMPSSHAGKITRFAGALSCKYGKPC  188
               P +   ++TRF+GALSC+ G PC
Sbjct  383   AKPGAFVTRLTRFSGALSCREGMPC  407



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 227/425 (53%), Positives = 284/425 (67%), Gaps = 15/425 (4%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D  W  R  +A   A  A+  +P+ V  ++  +V            D+ V     R
Sbjct  25    IKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV------------DKAVRGSNSR  72

Query  1279  HLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
                  ++ G C A NPID+CWRCD +W +NR ++ DC LGFG  TTGGK G  YVV D+S
Sbjct  73    RRDLHRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNS  132

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DNE+  PKPGTLRHAVIQ  PLWIIF+ +M I L  EL++TS+KTID RG  V I  G G
Sbjct  133   DNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHIAHGGG  192

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
               +QFV NV+I+NL I   KA SGG+IRDS +H G R+  +GDGI+IFGS+NVWIDH+SM
Sbjct  193   LMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHISM  252

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S C+DG+IDAV+GSTA+TISNCHFT H+ V+LFGA++    D VMQIT+AFNHFG  L Q
Sbjct  253   SNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGLTQ  312

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PN  383
             RMPR RWG  H +NNDYTHW MYA+GGS   TI+SQGNR+IAPP P+  KE+T RD+ P 
Sbjct  313   RMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNA-KEVTKRDYAPE  371

Query  382   DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCK  203
             + WK W W S  D  +N AFF  SGDP+ A   G  D++   P S    +TRF+G+L C 
Sbjct  372   NVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLKGP-DMITSKPGSFVSSLTRFSGSLKCI  430

Query  202   YGKPC  188
              G+PC
Sbjct  431   EGRPC  435



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 270/370 (73%), Gaps = 3/370 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N TRRHL  KK+KGPC A N ID+CWRCD  W  +R++ ADCA+GFG+   GGK G  YV
Sbjct  30    NSTRRHL-AKKYKGPCMATNLIDKCWRCDPHWADHREKYADCAMGFGSKAIGGKGGRVYV  88

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             VTD+SD ++E P PGTLRHAVIQ  PLWIIF   M I L+ ELL+ S KTIDGRG  + I
Sbjct  89    VTDNSDKDVENPTPGTLRHAVIQKEPLWIIFERHMHIKLKRELLMQSHKTIDGRGFNIHI  148

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q V N+IITNL +  I  T GG+IRDS  H G+R+ DEGDGI++F +++VWI
Sbjct  149   EKGAGLKMQSVNNIIITNLHVHNIGITPGGMIRDSVDHVGIRSEDEGDGISLFAATDVWI  208

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAV+GST +TISNCHFTDH K +LFGAN+    DK MQIT+A+NHFG
Sbjct  209   DHVSMSRATDGLIDAVQGSTGITISNCHFTDHDKAMLFGANDNHVEDKKMQITLAYNHFG  268

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPR R+G FHI+NNDYTHW  YA+GG++G+TIISQGNR+IA       KE+THR
Sbjct  269   KRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNSGATIISQGNRFIA-QASLLIKEVTHR  327

Query  394   DWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG  218
             +   + EWK WTW+S  D+  N AFF  SGD     K   L+L+   PS   G +T+FAG
Sbjct  328   EKAEESEWKNWTWLSIDDDMQNGAFFRTSGDQDALRKLKNLNLIPAEPSYKVGILTKFAG  387

Query  217   ALSCKYGKPC  188
             +LSC  G+PC
Sbjct  388   SLSCTAGRPC  397



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 239/455 (53%), Positives = 304/455 (67%), Gaps = 23/455 (5%)
 Frame = -2

Query  1507  FAFGAVIPAVAGELGDIHSS--DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             FAF ++  AV       H +  D YW  R+++A+   ++++  +P +VT       H   
Sbjct  13    FAFLSLCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTD------HLNY  66

Query  1333  HETMAFEDDREVVNGTRRHL-------RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMA  1175
             H  +A E      NGTRR L       + K+  G   +LN ID+CWR  ++W KNRK++A
Sbjct  67    HAALAMETT-GADNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLA  125

Query  1174  DCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQ  995
             DC LGFG  TTGGK GP YVVTD++D+++  PKPGTLR+AV +D PLWIIF  SM I LQ
Sbjct  126   DCVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQ  185

Query  994   HELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKG  815
              EL++ SDKTIDGRGA V I GGAG T+QFVKNVII N+ IK I   +GG+IRDS  H G
Sbjct  186   QELIINSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFG  245

Query  814   LRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA  635
              RT  +GDGI IFGS+NVWIDH+SM+ C DG+ID + GSTA+TISNCH TDH++V+LFGA
Sbjct  246   HRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGA  305

Query  634   NNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIIS  455
                D IDK MQITVAFNHFGKRL QRMPR R+GL H++NNDYTHWEMYA+GG+   TIIS
Sbjct  306   REEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIIS  365

Query  454   QGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSG-----DPQGA  293
             QGNR+ APP  +  K++T R++    EWK W W S+RD F+N A+F  SG      P   
Sbjct  366   QGNRFTAPPKEN-CKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPE  424

Query  292   VKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 R   + P P +   ++T+ AG L C+ GK C
Sbjct  425   NPIPRHFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/373 (60%), Positives = 275/373 (74%), Gaps = 5/373 (1%)
 Frame = -2

Query  1303  EVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
             +  N TRR+L+ +K+KGPC A NPIDRCWRCD +W  NRK++ADCA GFG  TTGGK G 
Sbjct  111   DAANKTRRNLK-QKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGK  169

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVTD+SDN+M  PKPGTLRHAVIQ GPLWIIF+  M I L+ EL+VTSDKTID RGA 
Sbjct  170   IYVVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGAN  229

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  GA  T+QFV NVII NL I   K  +GG+IRDS  H G RT  +GDGI+++G+SN
Sbjct  230   VHIEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASN  289

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFN  584
             VWIDH+S S C DG++DA++GSTA+TISNCHFT+H+ V+LFG+++ +  D+VMQIT+AFN
Sbjct  290   VWIDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFN  349

Query  583   HFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEI  404
             HFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR+IAP   +  KE+
Sbjct  350   HFGQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNAS-KEV  408

Query  403   THR-DWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITR  227
             T R     +EWK W W S+ D  +N AFF  SG P       + D++   P +   ++TR
Sbjct  409   TKRTSGAENEWKSWNWRSENDLMMNGAFFVESGSP--IRNLPKADMIKAKPGTFVTRLTR  466

Query  226   FAGALSCKYGKPC  188
             FAG L C  GKPC
Sbjct  467   FAGPLKCIKGKPC  479



>ref|XP_009587688.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=396

 Score =   437 bits (1123),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 266/370 (72%), Gaps = 3/370 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N TRRHL  KK+KGPC A N ID+CWRCD  W  NR++ ADCA+GFG    GGK G  YV
Sbjct  29    NSTRRHL-SKKYKGPCVAANLIDKCWRCDPRWADNRQKYADCAMGFGRTAIGGKGGRIYV  87

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             VTD SDN +E P PGTLRHAVIQ  PLWIIFS  M I L  ELL+ S KTID RG  V I
Sbjct  88    VTDPSDNNVENPVPGTLRHAVIQKEPLWIIFSKHMKIKLNRELLMQSYKTIDARGHNVHI  147

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q V N+IITNL I  I  +SGG+IRDS  H G+R  DEGD I+IF S ++WI
Sbjct  148   ENGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGDAISIFASHDIWI  207

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAV+GST +TISNCHFTDH KV+LFGAN+    DK MQIT+A+NHFG
Sbjct  208   DHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDKKMQITLAYNHFG  267

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPRCR G FH++NNDYTHW  YA+GGS+ +TIISQGNR+IA       KE+THR
Sbjct  268   KRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVD-IKEVTHR  326

Query  394   DWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG  218
             +   + EW+ WTW+S  D+  N AFF  SGDP    K+  L+L+   PS   G +T+F+G
Sbjct  327   EKAQESEWRHWTWLSRDDDMQNGAFFRTSGDPNALSKFKNLNLMPAEPSYRVGILTKFSG  386

Query  217   ALSCKYGKPC  188
             +L C  G+PC
Sbjct  387   SLGCTVGRPC  396



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   439 bits (1128),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 286/427 (67%), Gaps = 18/427 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  R   A      A+ K P  ++ N TA +     E +A ++         R+L G
Sbjct  40    DSYWQERAKVAKQENKAAYFKDPYAISGNFTASIS----EIIAVKE-------KGRNLGG  88

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
              K  G C A NPIDRCWRCD +W  NR+++ADC  GFG  T GG+ GP YVVTD SD++M
Sbjct  89    LKDDGTCLATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGQGGPIYVVTDPSDDDM  148

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
               PKPGTLR+AV ++G LWI F+ SM ITLQ EL+++ DKTIDGRG  V I  GAG T+Q
Sbjct  149   MNPKPGTLRYAVTRNGSLWITFARSMAITLQQELIMSGDKTIDGRGVDVYISNGAGITIQ  208

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             FVKNVII  +KI  I+   GG+IRDS  H G RT  +GDGI+IFG+SNVWIDH+SM  C 
Sbjct  209   FVKNVIIHGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGDGISIFGASNVWIDHVSMRNCT  268

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA+ GSTA+TISN HFTDH++V+LFGA+N    DK+MQIT+AFNHFGKRL QRMPR
Sbjct  269   DGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYSEDKIMQITLAFNHFGKRLVQRMPR  328

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSY------FKEITHRDWP  386
              R+G  H +NNDYTHWEMYA+GGS   TIIS+GNR+I P            KEIT R++ 
Sbjct  329   ARFGFVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSKEITKREYT  388

Query  385   ND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALS  209
              + EWK W W S  DE++N AFF  SG       + + D++   P S  G++TR++G L 
Sbjct  389   EESEWKTWQWRSINDEYINGAFFVQSGPELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLR  448

Query  208   CKYGKPC  188
             C+ G+PC
Sbjct  449   CRVGEPC  455



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   438 bits (1126),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 226/446 (51%), Positives = 292/446 (65%), Gaps = 15/446 (3%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV++  F  ++ A A    +I   D +W  RK  A   A   + + P  VT +    VH 
Sbjct  14    LVLYAVF--LLSAAATSEANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHR  71

Query  1339  MRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALg  1160
                      +++E    +    + KKF GPCKA NPIDRCWRC  DW  +RKR+A CA G
Sbjct  72    --------SEEKETARRSLMLSKRKKFAGPCKATNPIDRCWRCRDDWATDRKRLARCAQG  123

Query  1159  fgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLV  980
             FG  TTGG  G +YVVTD +D+++  P+PGTLR  VIQD PLWIIF  +M I L+ EL++
Sbjct  124   FGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMIINLKEELMI  183

Query  979   TSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFD  800
              +DKT+DGRGA V+I  GA  TVQ   NVII N+ +  I    GG+IRDS  H G RT  
Sbjct  184   GNDKTVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQS  243

Query  799   EGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDP  620
             +GDGITIFGS+NVW+DHLS+S C+DG+ID +  ST VTISNCH T+H+ V+LFG+++   
Sbjct  244   DGDGITIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFS  303

Query  619   IDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRY  440
              D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNRY
Sbjct  304   EDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRY  363

Query  439   IAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK--YGRLDLL  266
             IAPP  +  +          EWK W W S+ D F+  A+FT SG   GA++    + DL+
Sbjct  364   IAPPNLAAKQITKQLGAEESEWKNWVWHSEEDLFMEGAYFTTSG---GAIRTSINKKDLI  420

Query  265   DPMPSSHAGKITRFAGALSCKYGKPC  188
              P P S+  ++TRFAG++ C+ GKPC
Sbjct  421   KPKPGSYVTRLTRFAGSIPCRPGKPC  446



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   437 bits (1124),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 232/423 (55%), Positives = 290/423 (69%), Gaps = 18/423 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW  + A A  +A  A+  +PE VT +    V  MR             N TRR LRG
Sbjct  29    DEYWQKKAALARSHANNAYNPNPESVTHHFNEAV--MRDL---------ASNSTRRGLRG  77

Query  1267  K--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
             K     G C+A NPIDRC+RC  +WV +RK++A CA GFG   TGGK+G +YVVTDSSD 
Sbjct  78    KMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGDFYVVTDSSDA  137

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             ++  P+ GTLRHAVIQD PLWI+F+  M I L  EL++ S+KTIDGRGA V+I  GAG T
Sbjct  138   DLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQIAYGAGLT  197

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +QFV NVI+ N++I  IKA +GG+IRDS  H GLRT  +GDGI+IFG+SN+WIDH+SMS 
Sbjct  198   IQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWIDHVSMSN  257

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D +MQITVAFNHFGK L QRM
Sbjct  258   CMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHFGKGLVQRM  317

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDE  377
             PRCRWG  H++NNDYTHW MYAVGGS   TI+SQGNR+IAPP   + KE+T R++ P   
Sbjct  318   PRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPP-TLFAKEVTKREYSPEPV  376

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             WK W+W S+ D   N AFF  SG P   +     DL+   P S   ++TRFAG+  C   
Sbjct  377   WKQWSWRSEGDLMANGAFFVESGAP---ITKPYADLIKAKPGSFVTRLTRFAGSRPCIPN  433

Query  196   KPC  188
             +PC
Sbjct  434   QPC  436



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   434 bits (1117),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 287/389 (74%), Gaps = 9/389 (2%)
 Frame = -2

Query  1339  MRHETMAFEDDREVVNGTRRHLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
             M ++ + F+D   + N TRR LRGK  K+ GPC A+NPIDRCWRC K+W KNRKR+A C 
Sbjct  1     MSNQPLEFKD--VITNSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCV  58

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG  T GGK G YY+VTD+SD+++  PKPGTLRHAVIQ  PLWIIF+  M I L  EL
Sbjct  59    LGFGHKTRGGKKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQEL  118

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             +V S KTIDGRGA V I  G G T+QFV NVII N+ I R+  +SGG+IRDS  H G RT
Sbjct  119   MVQSHKTIDGRGANVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRT  178

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSS +W+DH+SMS C+DG+IDA++GSTA+TISNCHFT H  V+L GA++ 
Sbjct  179   VGDGDGISIFGSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDT  238

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                D+ MQ+T+AFNHFGK L QRMPRCRWG FH++NNDYTHW++YA+GGS   TIISQGN
Sbjct  239   YSRDQFMQVTLAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGN  298

Query  445   RYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGA--VKYGRL  275
             R+IAP  P   KEIT+R++ ++ EW+ W W S+ D F+N AFF  SG P     +K+ + 
Sbjct  299   RFIAPDDP-LTKEITNRNYASESEWRHWVWRSEGDRFMNGAFFVTSG-PHSPPRLKFKKK  356

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++ P P+   G++T+F+G L CK G  C
Sbjct  357   DIIKPKPAIFVGRLTKFSGTLKCKEGVKC  385



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   437 bits (1125),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/485 (48%), Positives = 299/485 (62%), Gaps = 44/485 (9%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     + 
Sbjct  9     LMFMFCIAGLIPTIRGNISEL---DEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV----------------------------------VNGTRRHLRGK-  1265
                +    E+D  V                                   N TRR LRGK 
Sbjct  66    NSTDATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKG  125

Query  1264  -----KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
                  K KGPC A NPID+CWRC  +W K RK++  C  GFG  TTGGK G  YVVT + 
Sbjct  126   KGKWSKLKGPCTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNL  185

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             D +M  PKPGTLRHAVIQ  PLWIIF   M+I L  ELL+ S KTID RGA V I  GAG
Sbjct  186   DEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIAHGAG  245

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              T+QFVKNVII  L I  I  +SGG+IRDS  H G+RT  +GDG++I+GSSN+W+DH+SM
Sbjct  246   ITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISM  305

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S+C+DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L Q
Sbjct  306   SKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQ  365

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PN  383
             RMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ P 
Sbjct  366   RMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPE  425

Query  382   DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCK  203
             DEWK W W S++D F+N A+F  SG+P     + R  ++         K+T++AGAL C+
Sbjct  426   DEWKHWNWRSEKDVFMNGAYFRQSGNPHFKCTHTRKQMIKHKNGMAVSKLTKYAGALDCR  485

Query  202   YGKPC  188
              GK C
Sbjct  486   VGKRC  490



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   437 bits (1124),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 228/470 (49%), Positives = 307/470 (65%), Gaps = 29/470 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             L++ F    +IP +  ++ ++   D YW  R  EA ++ ++A+   P  +  +       
Sbjct  9     LMLVFCIAGLIPTIQADMSEL---DEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYD  65

Query  1357  -------TAEVHSMRHETMAFEDDREV------VNGTRRHLRGK------KFKGPCKALN  1235
                    T E  + + E +  E    V       N TRR LRGK      K KGPC A N
Sbjct  66    NSTDITPTEEASNAKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASN  125

Query  1234  PIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHA  1055
             PID+CWRC K+W K RK++  C  GFG  T GGK G  YVVT + D ++  P+PGTLRHA
Sbjct  126   PIDKCWRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHA  185

Query  1054  VIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLK  875
             VIQ+ PLWIIF   M+I L  EL++ S KTID RGA V I  GAG T+QFV++VII  L 
Sbjct  186   VIQEEPLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLH  245

Query  874   IKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGST  695
             I  I  +SGG+IRDSA H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST
Sbjct  246   IHHISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGST  305

Query  694   AVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINN  515
             A+TISN HFT H+ V+L GA N   +DK MQ+TVA+NHFGK L QRMPR RWG  H++NN
Sbjct  306   AITISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNN  365

Query  514   DYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEF  338
             DYTHWE+YA+GGS   TI+SQGNR+IAPP   +++E+T RD+ P +EWK W W S++D F
Sbjct  366   DYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIF  425

Query  337   VNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +N A+F  SG+P     + R +++ P       K+T++AGAL C+ G+ C
Sbjct  426   MNGAYFRQSGNPNYETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   437 bits (1124),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/471 (48%), Positives = 298/471 (63%), Gaps = 29/471 (6%)
 Frame = -2

Query  1522  LLVVFFAF--GAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAE  1349
             LL + F F    +IP +   L ++   D YW  R  EA ++ ++A+  +P  V  +    
Sbjct  6     LLKLMFTFYIAGLIPTIRANLSEL---DEYWSKRAGEAREFTLQAYHSNPYEVVDHFHER  62

Query  1348  VHSMRHETMAFEDDRE-----------------VVNGTRRHLRGK------KFKGPCKAL  1238
              +    +    E+D +                  +N TRR LRGK      K KGPC A 
Sbjct  63    HYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTAS  122

Query  1237  NPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRH  1058
             NPID+CWRC  +W K RK +  C  GFG  T GGK G  YVVT + D +M  PKPGTLRH
Sbjct  123   NPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRH  182

Query  1057  AVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNL  878
             AVIQ  PLWIIF   M I L  EL++ S KTID RG  V I  GAG T+QFV++VII  L
Sbjct  183   AVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHGL  242

Query  877   KIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGS  698
             +I  I  ++GG+IRDS  H G+RT  +GDGI+I+GSS +W+DH+SMS+C+DG+IDA+ GS
Sbjct  243   RIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGS  302

Query  697   TAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIIN  518
             TA+TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR RWG  H++N
Sbjct  303   TAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  362

Query  517   NDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDE  341
             NDYTHWE+YA+GGS   TI+S GNR+IAPP   +++E+T RD+ ++ EWK W W SD+D 
Sbjct  363   NDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDM  422

Query  340   FVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             F+N A+F  SG+P     + R  ++ P        +T++AGAL C+ GK C
Sbjct  423   FMNGAYFRQSGNPHFKCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   438 bits (1126),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 234/494 (47%), Positives = 304/494 (62%), Gaps = 53/494 (11%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHV----------  1370
             L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +          
Sbjct  9     LMFMFCIAGLIPTIRGNISEL---DEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1369  --------TRNITAEVHSM--------RHETMAFEDDR-----------------EVVNG  1289
                     T +  A++            H  +  E++                     N 
Sbjct  66    NSTDDATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGNSTNS  125

Query  1288  TRRHLRGK------KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdG  1127
             TRR LRGK      K KGPC A NPID+CWRC  +W K RK++  C  GFG  TTGGK G
Sbjct  126   TRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRG  185

Query  1126  PYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGA  947
               YVVT + D +M  PKPGTLRHAVIQ  PLWIIF   M+I L  ELL+ S KTID RGA
Sbjct  186   RIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGA  245

Query  946   YVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSS  767
              V I  GAG T+QFVKNVII  L I  I  +SGG+IRDS  H G+RT  +GDG++I+GSS
Sbjct  246   NVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSS  305

Query  766   NVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAF  587
             N+W+DH+SMS+C+DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK MQ+TVA+
Sbjct  306   NIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAY  365

Query  586   NHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKE  407
             NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   +++E
Sbjct  366   NHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYRE  425

Query  406   ITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKIT  230
             +T RD+ P DEWK WTW S++D F+N A+F  SG+P     + R  ++ P       K+T
Sbjct  426   VTKRDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTRKQMIKPKNGMAVSKLT  485

Query  229   RFAGALSCKYGKPC  188
             ++AGAL C+ GK C
Sbjct  486   KYAGALDCRVGKRC  499



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   436 bits (1120),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 289/421 (69%), Gaps = 16/421 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D +   R  +A+  +++A+   PE VT N T +V  M           E  N TRR L+ 
Sbjct  40    DDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKML----------EGGNETRRQLKA  89

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
                 G C A NPIDRCWRCD +W KNRKR+A CA GFG  T GG  G YYVV D SD+ +
Sbjct  90    ----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVDPSDDNV  145

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
             ++P+PGTLRHAVIQ  PLWIIF  SM I L  ELL+ SDKTIDGRG  V I  GAG ++Q
Sbjct  146   QDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHIAYGAGLSIQ  205

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
             FV+NVII N+KI  I   +GG++RDS +H GLRT  +GDGI+IFGS++VWIDH+S+S+C 
Sbjct  206   FVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWIDHVSLSKCS  265

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+IDA+  STA+TISNC F +H+ V+L GA++    D +MQ+TVAFN FGK L QRMPR
Sbjct  266   DGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFGKGLVQRMPR  325

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWK  371
             CRWG FHI+NNDY+ W+MYA+GGSA  TIISQGNR+ A     + KE+T RD+    +W 
Sbjct  326   CRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKN-QFTKEVTKRDYAEKSQWM  384

Query  370   GWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKP  191
             GW W S+ D+F+N AFF  SG P     +   + L   P S+AG++TR+AGAL C+ GKP
Sbjct  385   GWQWRSEGDKFLNGAFFVESGPPLKKSPFTGKNKLQFKPGSYAGRLTRYAGALKCREGKP  444

Query  190   C  188
             C
Sbjct  445   C  445



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   435 bits (1119),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 301/457 (66%), Gaps = 25/457 (5%)
 Frame = -2

Query  1546  MFNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVT  1367
             M +K+ +SLL         IP +   + +    D +   +  +A + A++++   PE VT
Sbjct  6     MASKVVFSLLATL---AITIPCLEAGIAEF---DEFLRAQSEKAHEIALQSYVPTPEFVT  59

Query  1366  RNITAEVH-SMRHETMAFEDDREVVNGTRRHLR--GKKFKGPCKALNPIDRCWRCDKDWV  1196
              ++   VH SM+             N TRR L+        PC++ NPID CWRC+KDW 
Sbjct  60    NDLNYHVHLSMQ-------------NVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWA  106

Query  1195  KNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSA  1016
             K+R R+A C  GFG    GG  GP YVVTD+SD +M  PKPGTLR+AV Q GPLWI F  
Sbjct  107   KDRYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFER  166

Query  1015  SMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIR  836
             SM I+LQ EL+++SDKTIDGRGA V+I  G G T+QFV NVII  +++K I    GG+IR
Sbjct  167   SMIISLQQELMISSDKTIDGRGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIR  226

Query  835   DSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHS  656
             DS  H G RT  +GD I++FG+SN+WIDH+S+S   DG+ID ++GSTA+TISNCH T H+
Sbjct  227   DSYNHIGQRTRSDGDAISVFGASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHN  286

Query  655   KVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGS  476
              V+LFGA +    DK+MQITVAFNHFG+ L QRMPRCR G FH++NNDYTHW MYA+GGS
Sbjct  287   DVMLFGAADSYTGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGS  346

Query  475   AGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQ  299
             AG TI+SQGNR+IAP   +  KEITHRD+   +EWK W W SD D  +N A F  SG P 
Sbjct  347   AGPTILSQGNRFIAPNNDAA-KEITHRDYATPEEWKNWQWQSDMDLLMNGATFNSSGSPI  405

Query  298   GAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              A+K+ +  ++ P   +H  ++TR +GAL+C  G PC
Sbjct  406   -AMKHKKGFIMKPRDGTHVSRLTRHSGALNCFVGLPC  441



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   435 bits (1119),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 296/454 (65%), Gaps = 15/454 (3%)
 Frame = -2

Query  1534  MNWSLL-----VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHV  1370
             + WS L     +V +A   ++ A A    +I   D YW  RK  A   A   + + P  V
Sbjct  5     IRWSKLPAAGSLVLYAVFLLLSAAATSEANIGEYDEYWQKRKLMADAAAEATYKRDPFEV  64

Query  1369  TRNITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKN  1190
             T +    VH    E+      R  +  T+R    KKF GPCKA NPIDRCWRC  DWV +
Sbjct  65    TNSFNRAVHRSEEES-----GRRELAMTKR----KKFAGPCKATNPIDRCWRCRADWVTD  115

Query  1189  RKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASM  1010
             RKR+A CA GFG  TTGG  G +Y+VTD +D+++E P+PGTLR  VIQD PLWIIF+  M
Sbjct  116   RKRLARCAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDM  175

Query  1009  TITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDS  830
              I L+ E+++ SDKTIDGRGA V+I  GA  TVQ   NVII N+ I  I    GG+IRDS
Sbjct  176   IINLKEEMMINSDKTIDGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDS  235

Query  829   ATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKV  650
               H G RT  +GDGI+IFGS+NVW+DHLS+S C+DG+ID +  ST VTISNCH T+H+ V
Sbjct  236   PEHFGFRTQSDGDGISIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDV  295

Query  649   LLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAG  470
             +LFG+++    D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS  
Sbjct  296   MLFGSSDSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKN  355

Query  469   STIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
              TIISQGNRYIAPP  +  +         +EWK W W S+ D F+  A+FT SG P    
Sbjct  356   PTIISQGNRYIAPPNLAAKRITKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGPIQK-  414

Query  289   KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             ++   DL+ P P S+  ++TRFAG++ C  GKPC
Sbjct  415   QFSNKDLIKPKPGSYVTRLTRFAGSIPCVAGKPC  448



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   436 bits (1122),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 229/470 (49%), Positives = 305/470 (65%), Gaps = 29/470 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L++      +IP +  ++ ++   D YW  R  EA ++ ++A+   P  +  +     + 
Sbjct  9     LMLVLCIVGLIPTIRADMSEL---DEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYD  65

Query  1339  MRHETMAFEDDR---------EVV----------NGTRRHLRGK------KFKGPCKALN  1235
                +    E+D          EV+          N TRR LRGK      K KGPC A N
Sbjct  66    NSTDVTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASN  125

Query  1234  PIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHA  1055
             PID+CWRC K+W K RK++  C  GFG  T GGK G  YVVT + D +M  P+PGTLRHA
Sbjct  126   PIDKCWRCRKNWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHA  185

Query  1054  VIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLK  875
             VIQ  PLWIIF   M+I L  ELL+ S KTID RGA V I  GAG T+QFV++VII  L 
Sbjct  186   VIQKEPLWIIFKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLH  245

Query  874   IKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGST  695
             I  I  +SGG+IRDSA H G+RT  +GDG++I+GSSN+W+DH+SMS+C+DG+IDA+ GST
Sbjct  246   IHHISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGST  305

Query  694   AVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINN  515
             A+TISN HFT H+ V+L GA N   +DK MQ+TVA+NHFGK L QRMPR RWG  H++NN
Sbjct  306   AITISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNN  365

Query  514   DYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEF  338
             DYTHWE+YA+GGS   TI+SQGNR+IAPP   +++E+T RD+ P +EWK W W S++D F
Sbjct  366   DYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIF  425

Query  337   VNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +N A+F  SGDP     + R +++ P       K+T++AGAL C+ G+ C
Sbjct  426   MNGAYFRQSGDPNYETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   434 bits (1117),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 300/452 (66%), Gaps = 22/452 (5%)
 Frame = -2

Query  1540  NKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRN  1361
             NK+      VF+   A+ P +   +   H +  +W  R  EA   A KA+  +P  +   
Sbjct  4     NKLRLLCFCVFYL--ALFPTLRASIA--HDAQ-FWQTRAREAKQAAQKAYKPNPHDIALT  58

Query  1360  ITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
                     +H   +F+      NGTRR L   K+ GPC A NPID+CWRCD +W KNRK+
Sbjct  59    FN------KHVDKSFKSS----NGTRRGL--SKYTGPCLATNPIDKCWRCDPNWEKNRKK  106

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             +A+CALGFG GTTGGK+G  YVVTDSSD+++  PKPGTLRHAVIQ+ PLWIIF  SM I 
Sbjct  107   LANCALGFGHGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIK  166

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATH  821
             L  EL+ T +KTID RGA V I  GA  T+Q+VKN+II  L I  IK   GG+IRDS  H
Sbjct  167   LSSELIFTDNKTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNH  226

Query  820   KGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLF  641
              G R+  +GD I++FGSS+VWIDH+S+  C+DG+ID V+GSTA+TISNCH T H+ V+LF
Sbjct  227   YGYRSSSDGDAISLFGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLF  286

Query  640   GANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTI  461
             GA++    DKV+Q+TVAFNHFGK L QRMPRCRWG FHI+NNDYT W MYA+GGS   TI
Sbjct  287   GASDGYSGDKVLQVTVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTI  346

Query  460   ISQGNRYIAPPGPSYFKEITHRDWPNDE-WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY  284
             +SQGNR+IAP  P+  KE+T RD+  +  WK W+W S+ D   N AFF  SG   G   +
Sbjct  347   LSQGNRFIAPNNPNA-KEVTKRDYAAESVWKTWSWTSENDLMRNGAFFVQSGKKSG--NF  403

Query  283   GRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              + D +   P S+A  +TRF+GA+ C   KPC
Sbjct  404   PKTD-IKAKPGSYAASLTRFSGAIKCVVNKPC  434



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 298/449 (66%), Gaps = 20/449 (4%)
 Frame = -2

Query  1531  NWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITA  1352
             N+SLL  +  F A++P +   +G     D  W  R  EA + A +A+  +P  VT     
Sbjct  5     NFSLLFFYVIFLAILPTLQANIGQF---DHVWHRRLKEAREAAKQAYKPNPMKVTAEFN-  60

Query  1351  EVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
               H MR    +        N TRR L GKK    C+A NPID+CWRCD DW KNRK++AD
Sbjct  61    -THVMRAMKGS--------NSTRRGL-GKK-NDECEAANPIDKCWRCDPDWEKNRKKLAD  109

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CA+GFG GTTGGKDG  YVV D+SD ++  PKPGTLRHAVIQ  PLWIIFS +M I L  
Sbjct  110   CAIGFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNIRLTA  169

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             ELL+T +KTID RGA V I+ GA  T+QFVKN+II  L I  I+  SGG+IRDS +H G+
Sbjct  170   ELLITDNKTIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGV  229

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             R   +GDGI++FGS+++WIDH+SM+ C DG+ID V  STAVTISNCHF  H+ VLLFGA 
Sbjct  230   RAMSDGDGISVFGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGAT  289

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    DKVMQ+T+AFNHFGK L QRMPRCRWG FHI+NNDYTHW MYAVGGS   TIISQ
Sbjct  290   DSFSRDKVMQVTLAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQ  349

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR++AP   +  KE+T RD+ P  EWK W W S+ D F N AFF  SG  +   K+ + 
Sbjct  350   GNRFVAPKDRNA-KEVTKRDYAPESEWKNWNWRSEGDLFENGAFFVESG--KKVTKFPKT  406

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D    + +     +T+ AG + C   KPC
Sbjct  407   D-AKAVSAKSVAFLTKDAGPIKCIPNKPC  434



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 270/368 (73%), Gaps = 4/368 (1%)
 Frame = -2

Query  1285  RRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
             RR L  KK+ GPC   NPID+CWRCD +W  NRK++ +C++GFG  TTGG+DG +YVVTD
Sbjct  24    RRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDGEFYVVTD  83

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
              SD +   PKPGTLRHAVIQ  PLWIIF  +M I L  EL++  DKTIDGRGA V I GG
Sbjct  84    PSD-DYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRGATVHITGG  142

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             A   +Q+ KNVII  L I  I   SGG++RD+  H GLRT  +GDGI+I+GSSN+WIDH+
Sbjct  143   ASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSNIWIDHM  202

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SM  C DG+IDAV+GST +TISN H+TDH++V+LFGA++   ID+ MQIT+AFNHFGKRL
Sbjct  203   SMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKRL  262

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-  389
              QRMPRCRWG  H++NNDYTHW MYA+GGS   TIISQGNR+IAPP   + KEIT R++ 
Sbjct  263   VQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIFKKEITKREYS  321

Query  388   PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL-DLLDPMPSSHAGKITRFAGAL  212
             P   W  WTW S+ D ++N A+F  +GDP  + K+  L D + P P+     ITRFAGAL
Sbjct  322   PESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVTWITRFAGAL  381

Query  211   SCKYGKPC  188
             +CK G PC
Sbjct  382   NCKVGLPC  389



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   435 bits (1118),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 231/494 (47%), Positives = 299/494 (61%), Gaps = 53/494 (11%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     + 
Sbjct  9     LMFMFCIAGLIPTIRGNISEL---DEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV-------------------------------------------VNG  1289
                +    E+D  V                                              
Sbjct  66    NSTDATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKS  125

Query  1288  TRRHLRGK------KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdG  1127
             TRR LRGK      K KGPC A NPID+CWRC  +W K RK++  C  GFG  TTGGK G
Sbjct  126   TRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRG  185

Query  1126  PYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGA  947
               YVVT + D +M  PKPGTLRHAVIQ  PLWIIF   M+I L  ELL+ S KTID RGA
Sbjct  186   RIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGA  245

Query  946   YVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSS  767
              V I  GAG T+QFVKNVII  L I  I  +SGG+IRDS  H G+RT  +GDG++I+GSS
Sbjct  246   NVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSS  305

Query  766   NVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAF  587
             N+W+DH+SMS+C+DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK MQ+TVA+
Sbjct  306   NIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAY  365

Query  586   NHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKE  407
             NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   +++E
Sbjct  366   NHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYRE  425

Query  406   ITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKIT  230
             +T RD+ P DEWK W W S++D F+N A+F  SG+P     + R  ++ P       K+T
Sbjct  426   VTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTRKQMIKPKNGMAVSKLT  485

Query  229   RFAGALSCKYGKPC  188
             ++AGAL C+ GK C
Sbjct  486   KYAGALDCRVGKRC  499



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   432 bits (1112),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 239/449 (53%), Positives = 291/449 (65%), Gaps = 19/449 (4%)
 Frame = -2

Query  1510  FFAFGAVIPAVAGELG-DIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMR  1334
             FF    +  A A   G DI   D +W  +  EA+  +  A+   PE VT +    VH   
Sbjct  10    FFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVH---  66

Query  1333  HETMAFEDDREVVNGTRRHLRG---KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                +A  + R   N TRR LR    KKFKG C A NPIDRCWRC K+W+K+RK++A C  
Sbjct  67    ---LALAEAR---NSTRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGK  120

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG   TGGK G +YVVTD SD+++  PK GTLR  VIQD PLWI+F+  M I L  EL+
Sbjct  121   GFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELM  180

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
             + S+KTID RGA V I  GA  T+QFV NVII  L I  IK ++GG+IRDS  H GLRT 
Sbjct  181   INSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTK  240

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI+I+GSS+VWIDH SM  C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +
Sbjct  241   SDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSN  300

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQ TVAFNHFGK L QRMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR
Sbjct  301   ENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNR  360

Query  442   YIAPP---GPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             +IAPP        KE+T RD+   D WK WTW S+ D   N AFF         V   R 
Sbjct  361   FIAPPLRFAKEVTKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFASLVLKHKDVH--RK  418

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D +   P +   ++TRFAG L CK G+ C
Sbjct  419   DFIRAKPGTWVRRLTRFAGPLGCKAGRAC  447



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   433 bits (1114),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 296/466 (64%), Gaps = 25/466 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             LV      ++IP +   + +   +D YWV    EA    + A+   P  +  +       
Sbjct  9     LVCVICIASLIPTLRANVAE---TDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYD  65

Query  1357  -TAEVHSMRHETMAFEDDRE----VVNGTRRHLRG----------KKFKGPCKALNPIDR  1223
              + +V          EDD E    + N TRR LRG           K KGPC A NPID+
Sbjct  66    NSTDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDK  125

Query  1222  CWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQD  1043
             CWRC  DW + RK++  C  GFG  TTGGK G  YVVT + D++   P+PGTLRHAVIQ+
Sbjct  126   CWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQN  185

Query  1042  GPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRI  863
              PLWIIF   M+I L  EL++ S KTID RG  V I  GAG T+Q+V+N+II  L +  I
Sbjct  186   EPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHI  245

Query  862   KATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTI  683
                SGG+IR+S  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GST +TI
Sbjct  246   VPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITI  305

Query  682   SNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTH  503
             SN HFT H+ V+L GA N +  DK MQ+TVAFNHFGK L QRMPR RWG  H++NNDYTH
Sbjct  306   SNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTH  365

Query  502   WEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDA  326
             WE+YA+GGS   TI+S GNR+IAPP   +++E+T RD+ P  EWK W W SD+D F+N+A
Sbjct  366   WELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNA  425

Query  325   FFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +F  SG+P+    + R  ++ P   S   K+T++AGAL C+ GKPC
Sbjct  426   YFRQSGNPKFMCSHSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 296/466 (64%), Gaps = 25/466 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             LV      ++IP +   + +   +D YWV    EA    + A+   P  +  +       
Sbjct  9     LVCVICIASLIPTLRANVAE---TDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYD  65

Query  1357  -TAEVHSMRHETMAFEDDREV----VNGTRRHLRG----------KKFKGPCKALNPIDR  1223
              + +V          EDD E+     N TRR LRG           K KGPC A NPID+
Sbjct  66    NSTDVEETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDK  125

Query  1222  CWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQD  1043
             CWRC  DW + RK++  C  GFG  TTGGK G  YVVT + D++   P+PGTLRHAVIQ+
Sbjct  126   CWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQN  185

Query  1042  GPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRI  863
              PLWIIF   M+I L  EL++ S KTID RG  V I  GAG T+Q+V+N+II  L +  I
Sbjct  186   EPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHI  245

Query  862   KATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTI  683
                SGG+IR+S  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GST +TI
Sbjct  246   VPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITI  305

Query  682   SNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTH  503
             SN HFT H+ V+L GA N +  DK MQ+TVAFNHFGK L QRMPR RWG  H++NNDYTH
Sbjct  306   SNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTH  365

Query  502   WEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDA  326
             WE+YA+GGS   TI+S GNR+IAPP   +++E+T RD+ P  EWK W W SD+D F+N+A
Sbjct  366   WELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNA  425

Query  325   FFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +F  SG+P+    + R  ++ P   S   K+T++AGAL C+ GKPC
Sbjct  426   YFRQSGNPKFMCSHSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_009789922.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=396

 Score =   430 bits (1105),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 265/370 (72%), Gaps = 3/370 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N TRRHL  KK+KGPC A N ID+CWRC+  W  +R++ ADCA+GFG    GGK G  YV
Sbjct  29    NSTRRHL-SKKYKGPCVAANLIDKCWRCNPRWADDRQKYADCAMGFGRNAIGGKGGRIYV  87

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             VTD SD  +E P PGTLRHAVIQ  PLWIIFS  M I L  ELL+ S KTID RG  V I
Sbjct  88    VTDPSDYNVENPVPGTLRHAVIQKEPLWIIFSKHMKIKLNRELLMQSYKTIDARGHNVHI  147

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q V N+IITNL I  I  +SGG+IRDS  H G+R  DEGD I+IF S ++WI
Sbjct  148   EKGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGDAISIFASHDIWI  207

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAV+GST +TISNCHFTDH KV+LFGAN+    DK MQIT+A+NHFG
Sbjct  208   DHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDKKMQITLAYNHFG  267

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPRCR G FH++NNDYTHW  YA+GGS+ +TIISQGNR+IA       KE+THR
Sbjct  268   KRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVD-IKEVTHR  326

Query  394   DWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG  218
             +   + EW+ WTW+S  D+  N AFF  SGDP    K+  L+L+   PS   G +T+F+G
Sbjct  327   EKAQESEWRHWTWLSQDDDMQNGAFFRTSGDPNALSKFKNLNLMPAEPSYRVGILTKFSG  386

Query  217   ALSCKYGKPC  188
             +L C  G+PC
Sbjct  387   SLGCTVGRPC  396



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/424 (54%), Positives = 284/424 (67%), Gaps = 22/424 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D +W  R+  A   A +A+   P +VT +  A VH                   RR +R 
Sbjct  35    DEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHRS--------------TSPRREMRE  80

Query  1267  KKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
             KK K  GPC+A NPID+CWRC K+W  +R+R+A CA GFG   TGG  G  YVVTD +D 
Sbjct  81    KKKKSNGPCRATNPIDKCWRCRKNWATDRQRLARCARGFGRAATGGLGGKIYVVTDPTDA  140

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             ++  P+PGTLR   IQ GPLWIIF+ SM I L  ELLV+SDKTIDGRGA V I  G G T
Sbjct  141   DVVNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRGAQVHIANGGGIT  200

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             VQF +NVII  L +  +K T GG++RDS TH G RT  +GDGI++FG+++VWIDH+SMS 
Sbjct  201   VQFARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGDGISLFGATDVWIDHISMSN  260

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             CEDG+ID V+ ST VTISNCHFT+H+ V+LFGA++  P D+VMQITVAFNHFG+ L QRM
Sbjct  261   CEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQVMQITVAFNHFGRGLVQRM  320

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDEW  374
             PRCRWG FH++NNDYTHW MYA+GGS   TIISQGNRYIAPP  +  K IT        W
Sbjct  321   PRCRWGFFHVVNNDYTHWLMYAIGGSNAPTIISQGNRYIAPPNIAA-KLITKHYADEGVW  379

Query  373   KGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGRLDLLDPMPSSHAGKITRFAGALSCKY  200
             K W W ++ D F+N A F PSG   GAV  K  + + + P P S+  ++TRF+G LSC  
Sbjct  380   KNWVWHTEDDLFMNGAVFQPSG---GAVPRKINKKEWVKPKPGSYVTRLTRFSGTLSCIP  436

Query  199   GKPC  188
             G+ C
Sbjct  437   GRKC  440



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   428 bits (1100),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 266/358 (74%), Gaps = 3/358 (1%)
 Frame = -2

Query  1255  GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPK  1076
             GPC A NPIDRCWRCD +W  NR+++ADC  GFG  T GGK GP+YVVTD SD++M  PK
Sbjct  8     GPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPK  67

Query  1075  PGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKN  896
             PGTLRHAV +DGPLWIIF+ SM ITLQ EL++ S+KTIDGRG  V I  GAG TVQFVKN
Sbjct  68    PGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVKN  127

Query  895   VIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGII  716
             +II  +K+  I    GG+IRDS TH G RT  +GDGI+IFGSSN+WIDH+SM  C DG+I
Sbjct  128   IIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMRNCSDGLI  187

Query  715   DAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWG  536
             DA+ GSTA+TISN HFTDH++V+LFGA++    DK+MQIT+AFNHFGKRL QRMPR R+G
Sbjct  188   DAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRYG  247

Query  535   LFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTW  359
               H +NNDYTHWEMYA+GGS   TIIS+GNR+IAP    + K+IT R++ P + W  W W
Sbjct  248   FVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDN-QFAKQITKREYAPENVWANWQW  306

Query  358   VSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAG-ALSCKYGKPC  188
              S  D ++N AFF  SG    +  + R D++     ++ G++TR++G  L C+ G+PC
Sbjct  307   RSINDVYMNGAFFVQSGPELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  364



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 299/462 (65%), Gaps = 18/462 (4%)
 Frame = -2

Query  1552  IEMFNKMNWSLLVVFFAFGAVIP-AVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPE  1376
             I M     WS    F  +  V+  + A    +I   D YW  RK  A   A   +   P 
Sbjct  36    ITMEEGFRWSRPGSFVLYAVVLLLSAAVSEANIGEFDDYWRQRKLMADAAAEATYQHDPI  95

Query  1375  HVTRNITAEVH-SMRHETMAFEDDREVVNGTRRHLRGKK---FKGPCKALNPIDRCWRCD  1208
              V   +   VH S++ E ++          TRR + G+K     GPCKA NPIDRCWRC 
Sbjct  96    EVPNQLNRAVHRSIKKEDIS----------TRREMLGQKKGKMNGPCKATNPIDRCWRCR  145

Query  1207  KDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWI  1028
             KDW  +RKR+A CA GFG  TTGG  G +YVVTD +D+++  P+PGTLR AVIQ  PLWI
Sbjct  146   KDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWI  205

Query  1027  IFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATS-  851
              F+ +M ITL+ EL++  DKTIDGRG  V+I  GA  TVQF  NVII N+ I  I +++ 
Sbjct  206   TFAKTMIITLKEELIIRGDKTIDGRGVQVRIANGAQLTVQFANNVIIHNIHINDIISSNK  265

Query  850   -GGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNC  674
              GG IRDS  H G RT  +GDGIT+FGS+NVW+DHLS+S C+DG+ID +  ST VTISNC
Sbjct  266   NGGNIRDSPDHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNC  325

Query  673   HFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEM  494
             H T+H+ V+LF +++  P D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW M
Sbjct  326   HMTNHNDVMLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLM  385

Query  493   YAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTP  314
             YA+GGS   TIISQGNRYIAPP  +  +     D P  EWK W W S+ D F+  A+FT 
Sbjct  386   YAIGGSKAPTIISQGNRYIAPPNLAAKQVTKQHDAPESEWKNWVWHSEDDLFMEGAYFTV  445

Query  313   SGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +G  Q   ++ + DL+ P P S+  ++TRFAG+L CK GKPC
Sbjct  446   TGG-QINRQFNKKDLIKPKPGSYVTRLTRFAGSLDCKPGKPC  486



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   430 bits (1106),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 293/444 (66%), Gaps = 18/444 (4%)
 Frame = -2

Query  1516  VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             +  F    ++ ++   +G+    D  W  R  +A   A  A+  +P+ V  ++  +V   
Sbjct  8     LFLFVMVVLVLSIEAHIGEF---DEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQV---  61

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                      D+ V     R     ++ G CKA NPID+CWRCD +W +NR ++ADC LGF
Sbjct  62    ---------DKAVRGSNSRRRDLHRYNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGF  112

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGGK G  YVVTD+SD+++  PKPGTLRHAVIQ  PLWIIF+ +M I L  EL++T
Sbjct  113   GRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMT  172

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             S+KTID RG  V I  G G  +QF+ NVII+NL+I   KA +GG+IRDS  H G RT  +
Sbjct  173   SNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSD  232

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI+IFGS+NVWIDH+SMS C+DG+IDAV+ STA+TISN HFT H++V+LFGA++    
Sbjct  233   GDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSR  292

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             D +MQIT+AFNHFG+ L QRMPR RWG  H +NNDYTHW MYA+GGS   TI+SQGNR+I
Sbjct  293   DSIMQITLAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFI  352

Query  436   APPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDP  260
             APP P+  KE+T RD+ P   WK W W S  D  +N AFF  SG+P  A      D++  
Sbjct  353   APPNPNA-KEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLRSP-DMISS  410

Query  259   MPSSHAGKITRFAGALSCKYGKPC  188
              P S    +TRF+G+L+C  GKPC
Sbjct  411   KPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   430 bits (1106),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 295/454 (65%), Gaps = 23/454 (5%)
 Frame = -2

Query  1540  NKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRN  1361
             +K+ +SLLV        IP +   + +    D +   +  +A   A++++   PE V   
Sbjct  6     SKVVFSLLVTL---AITIPCLEAGIAEF---DDFLKAQSEKAHKIALESYVPTPEFVASE  59

Query  1360  ITAEVHSMRHETMAFEDDREVVNGTRRHLR-GKKFKG-PCKALNPIDRCWRCDKDWVKNR  1187
             +   VH              ++N TRR L+ G    G PC + NPID CWRC+KDW  +R
Sbjct  60    LNYHVH------------LSMLNSTRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWANDR  107

Query  1186  KRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMT  1007
              R+A C  GFG    GG  GP YVVTD+SD +M  PK GTLR+ V Q GPLWI F+ SM 
Sbjct  108   YRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSMI  167

Query  1006  ITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSA  827
             ITLQ ELL++SDKTIDGRGA V+I  GAG T+QFV NVII  +++K I +  GG+IRDS 
Sbjct  168   ITLQQELLISSDKTIDGRGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSY  227

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H GLRT  +GD I++FG+SN+WIDH+S+S  +DG+ID ++GSTA+TISNCH T H+ V+
Sbjct  228   NHVGLRTRSDGDAISVFGASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVM  287

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LFGA +    DK+MQITVAFNHFG+ L QRMPRCR G FH++NNDYTHW MYA+GGSA  
Sbjct  288   LFGATDTYSGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAP  347

Query  466   TIISQGNRYIAPPGPSYFKEITHR-DWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
             TI+SQGNR+IAP   +  KEITHR D   + WK W W SD D  +N A F  SG P    
Sbjct  348   TILSQGNRFIAPNNDAA-KEITHRVDAEPEVWKNWQWQSDMDLLMNGATFNTSGSPI-TT  405

Query  289   KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +Y +  L+ P   +H  ++TR AGAL+C  G PC
Sbjct  406   QYKKGLLMKPRDGTHVSRLTRHAGALNCFVGLPC  439



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   431 bits (1107),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 298/464 (64%), Gaps = 23/464 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             L+      ++IPA+   + ++   D YW  R  EA  +++ A+   P  +  +       
Sbjct  9     LICVVCIASLIPAIRSNIAEL---DEYWQQRSEEAEKHSLAAYHSDPFEIVDHFHERHYD  65

Query  1357  -TAEVHSMRHETMAFEDDREVVNGT------------RRHLRGKKFKGPCKALNPIDRCW  1217
              + ++ + R +    ED   ++ G+            R   +  K KGPC A NPID+CW
Sbjct  66    NSTDIETERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCW  125

Query  1216  RCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGP  1037
             RC  DW + R+++ADC  GFG  TTGGK G  YVVT + DN++  P+PGTLRHAVIQ  P
Sbjct  126   RCMPDWARRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEP  185

Query  1036  LWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKA  857
             LWIIF   M I LQ EL++ S KTID RGA V I  GAG T+QFV N+II  L I  I +
Sbjct  186   LWIIFKNDMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVS  245

Query  856   TSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISN  677
             ++GG+IRDS  H G RT  +GDG++IFG+SN+WIDH+SMSRC+DG+IDA+ GST +TISN
Sbjct  246   SNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGSTGITISN  305

Query  676   CHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWE  497
              HFT H+ V+L GA+N    DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDYTHWE
Sbjct  306   SHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWE  365

Query  496   MYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFF  320
             +YA+GGS   TI+S GNR+IAPP    +KE+T RD+ P  EWK W W S+RD F+N AFF
Sbjct  366   LYAIGGSQSPTILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFF  425

Query  319   TPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               SG+P     + R  ++ P        +T++AGAL CK G+PC
Sbjct  426   RQSGNPNFRCTHTRQQMIKPKHGLAVSMLTKYAGALDCKVGRPC  469



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   430 bits (1105),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 225/424 (53%), Positives = 284/424 (67%), Gaps = 20/424 (5%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D +   RK  A   A +A+   P +VT +  A VH               V+ +RR +R 
Sbjct  37    DDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVH-------------RAVSSSRREMRE  83

Query  1267  K----KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
             +    K +GPC+A NPID+CWRC +DW  +R+R+A CA GFG  TTGG  G  YVVTD +
Sbjct  84    RPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPT  143

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             D ++  P+PGTLR  VIQ GPLWIIF+ SM I L  ELL++SDKTIDGRGA V I  GAG
Sbjct  144   DLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAG  203

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              TVQ  +NVII NL +  +K T GG++RDS TH G RT  +GDGI++F ++NVWIDH+SM
Sbjct  204   ITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISM  263

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
             S CEDG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D++MQITVAFNHFG+ L Q
Sbjct  264   SNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQ  323

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND  380
             RMPRCRWG FH++NNDYTHW MYA+GG    TIISQGNRYIAPP  +  K IT       
Sbjct  324   RMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAA-KVITKHYAEEG  382

Query  379   EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKY  200
              WK W W ++ D F+N A F PSG     V     + + P P ++  ++TRF+G LSC  
Sbjct  383   VWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTN--EWVKPKPGTYVTRLTRFSGTLSCCT  440

Query  199   GKPC  188
             GKPC
Sbjct  441   GKPC  444



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 283/428 (66%), Gaps = 16/428 (4%)
 Frame = -2

Query  1465  GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGT  1286
              +I   D +W  RK  A     + +   P +VT +    VH       A    R +    
Sbjct  32    ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHR------ATSLRRTMREMP  85

Query  1285  RRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
             R+H    K KGPC+A NPID+CWRC  DW  +R R+A CA GFG  TTGG  GP Y+VTD
Sbjct  86    RKH----KKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIYIVTD  141

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
              SD ++  P+PGTLR  VIQ GPLWIIF+ SM I L  ELLV+SDKTIDGRGA V I  G
Sbjct  142   PSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVHIANG  201

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             AG TVQ  +NVII NL +  +  + GG++RDS TH G RT  +GDGI++F ++NVWIDH+
Sbjct  202   AGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVWIDHI  261

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             SMS CEDG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D++MQITVAFNHFG+ L
Sbjct  262   SMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITVAFNHFGRGL  321

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP  386
              QRMPRCRWG FH++NNDYTHW MYA+GG    TIISQGNRYIAPP  +  K IT     
Sbjct  322   VQRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPPNIAA-KVITKHYAE  380

Query  385   NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGRLDLLDPMPSSHAGKITRFAGAL  212
               EWK W W ++ D F+N A F PSG   GAV  +    + + P P ++  ++TRF+G L
Sbjct  381   EGEWKNWVWHTEDDLFMNGAIFEPSG---GAVQRQINSNEWVKPKPGTYVTRLTRFSGTL  437

Query  211   SCKYGKPC  188
             SC   KPC
Sbjct  438   SCCMSKPC  445



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 292/449 (65%), Gaps = 21/449 (5%)
 Frame = -2

Query  1528  WSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAE  1349
             +SLL  +    A+ P +   +G     D  W  R  EA + A +A+  +P  VT      
Sbjct  6     FSLLFFYVICLAIFPTLNANIGHF---DHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTH  62

Query  1348  V-HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMAD  1172
             V  +MR             N +RR L   ++ GPCKA NPID+CWRCD +W KNRKR+AD
Sbjct  63    VIRAMRGS-----------NNSRRGL-SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLAD  110

Query  1171  CALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQH  992
             CALGFG GTTGGKDG  YVV DSSDN++  PKPGTLRHA IQ  PLWIIF  +M I L  
Sbjct  111   CALGFGHGTTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHA  170

Query  991   ELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGL  812
             EL++T +KTID RGA V I  GA  T+Q+VKN+II  L I  IK  SGG+IRDS  H G+
Sbjct  171   ELMLTDNKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGV  230

Query  811   RTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGAN  632
             R   +GD I++FGS+ VWIDH+S + C+DG+ID V  STAVTISNCH T H+ VLLFGA+
Sbjct  231   RAMSDGDAISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGAS  290

Query  631   NWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQ  452
             +    DK+MQ+T+AFNHFGK L QRMPRCRWG FHI+NNDYTHW MYA+GGS   TIISQ
Sbjct  291   DSYSGDKIMQVTLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQ  350

Query  451   GNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL  275
             GNR+IAP   +  KE+T RD+ P   WK W W S+ D  +N AFF  SG  +   K  + 
Sbjct  351   GNRFIAPNDRNA-KEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQSG--KNVAKNPKA  407

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +++   P      +TRFAG L C+  K C
Sbjct  408   EII-AKPGKAVSSLTRFAGPLKCEVNKSC  435



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 304/438 (69%), Gaps = 22/438 (5%)
 Frame = -2

Query  1489  IPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFED  1310
             +P +  ++ +    D Y  N+  EA++ ++ A+ +HPE VT     EV           D
Sbjct  21    VPNLHAQIAEF---DAYLENKAKEALNSSLAAYNEHPEQVTNTFNREV----------GD  67

Query  1309  DREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkd  1130
                 +   RRHL   K K  C A NPIDRCWRCD++W KNRK++ADCA GFG  TTGGK 
Sbjct  68    TLLNITSLRRHL---KEKSSCMATNPIDRCWRCDENWAKNRKKLADCARGFGHKTTGGKA  124

Query  1129  GPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRG  950
             G YYVVTD SD+++++PKPGTLRHAVIQ+ PLWIIF  SM I L+ EL++TSDKTIDGRG
Sbjct  125   GRYYVVTDDSDDDVKDPKPGTLRHAVIQEEPLWIIFEKSMIIRLKQELMITSDKTIDGRG  184

Query  949   AYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGS  770
               + I  GAGFT+QFV NVII N++I  I +TSGG+IRDS  H G+RT  +GDGI+IFGS
Sbjct  185   VSLHIAYGAGFTIQFVHNVIIHNIRIHHIISTSGGMIRDSGKHIGIRTVSDGDGISIFGS  244

Query  769   SNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVA  590
             +++WIDH ++S+C DG+IDA+  STA+TISNC F  H+ V+L GA +  P D +MQ+TVA
Sbjct  245   NHIWIDHCTLSQCTDGLIDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQVTVA  304

Query  589   FNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFK  410
             FN FGK L QRMPRCRWG FH++NNDY+HW+MYA+GGSA  TIISQGNR+ A   P+  K
Sbjct  305   FNRFGKGLIQRMPRCRWGFFHVVNNDYSHWQMYAIGGSANPTIISQGNRFKAANNPNT-K  363

Query  409   EITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG--RLDLLDPMPSSHAG  239
             ++T RD+ P   WK W WVS+ D F+N A+F  SG PQ   K    +   +   P S+AG
Sbjct  364   QVTKRDYAPESVWKNWQWVSEGDLFLNGAYFVESG-PQNKKKSALTKPHRIKFKPGSYAG  422

Query  238   KITRFAGAL-SCKYGKPC  188
             ++TR+AG L  CK G PC
Sbjct  423   RLTRYAGVLIKCKAGTPC  440



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/455 (51%), Positives = 308/455 (68%), Gaps = 21/455 (5%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
             F   N  LL++  +  +++P +   + +    D Y   +  EA++ ++ A+ +HPE +T 
Sbjct  3     FVSGNSVLLILVISLASLVPNLHAGIAEF---DAYLEKQAKEALNSSLAAYNEHPEEITD  59

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
                 EV           D    +   RRHL   K K  C   NPIDRCWRCD++W KNRK
Sbjct  60    TFNREV----------GDTLLNITSLRRHL---KEKSSCMTTNPIDRCWRCDENWAKNRK  106

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             ++A+CA GFG  TTGGK G YYVVTD SD+++++PKPGTLRHAVIQ+ PLWIIF  SM I
Sbjct  107   KLAECARGFGHKTTGGKAGRYYVVTDDSDDDVKDPKPGTLRHAVIQEEPLWIIFEKSMVI  166

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSAT  824
              L+ EL++TSDKTIDGRG  + I  GAG T+QFV NVII N++I  I +TSGG+IRDS  
Sbjct  167   KLKEELMITSDKTIDGRGVSIYIAYGAGLTIQFVHNVIIHNIRIHHIISTSGGMIRDSVK  226

Query  823   HKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLL  644
             H G+RT  +GDGI+IFGS+++WIDH ++S+C DG+IDA+  STA+TISNC F  H+ V+L
Sbjct  227   HIGIRTLSDGDGISIFGSNHIWIDHCTLSQCTDGLIDAIMASTAITISNCKFNHHNDVML  286

Query  643   FGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGST  464
              GA +  P D +MQ+TVAFN FGK L QRMPRCRWG FH++NNDY+HW+MYA+GGSA  T
Sbjct  287   LGATDAFPQDSIMQVTVAFNRFGKGLIQRMPRCRWGFFHVVNNDYSHWQMYAIGGSANPT  346

Query  463   IISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             IISQGNR+ A   P+  K++T RD+ P   WK W WVS+ D F+N A+F  SG PQ   K
Sbjct  347   IISQGNRFKAANNPNT-KQVTKRDYAPESVWKNWQWVSEGDLFLNGAYFVESG-PQNKKK  404

Query  286   YG--RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 +   +   P S+AG++TR+AG   CK G PC
Sbjct  405   SALTKPHRIKFKPGSYAGRLTRYAGVRKCKIGTPC  439



>ref|XP_009599824.1| PREDICTED: pectate lyase [Nicotiana tomentosiformis]
Length=397

 Score =   427 bits (1097),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 277/372 (74%), Gaps = 4/372 (1%)
 Frame = -2

Query  1294  NGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYV  1115
             N  RR L  KK+KGPC+A N ID+CWRCD +W +NR++MADCALGFG+   GGK G  YV
Sbjct  27    NIPRRQLGNKKYKGPCRAENAIDKCWRCDPNWAENRQKMADCALGFGSNAIGGKLGRIYV  86

Query  1114  VTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKI  935
             VTD SD+++ +PKPGTLR+ VIQ  PLWIIF  +M I L  EL+VTS+KTIDGRG  V I
Sbjct  87    VTDPSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKTIDGRGFNVHI  146

Query  934   VGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
               GAG  +Q   N+II+NL+I  I  T GG++R+S  H GLR+ DEGDGI+IF S ++WI
Sbjct  147   QNGAGIKIQCASNIIISNLRIHNIVPTPGGLLRESEDHVGLRSGDEGDGISIFDSRDIWI  206

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMSR  DG+IDAV  ST +TISNCHFTDH KV+LFGAN+   +DK M+IT+A+NHFG
Sbjct  207   DHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDNYVLDKDMKITLAYNHFG  266

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             KRL+QRMPRCR+G FH++NNDYTHWE YA+GGS+G+TIISQGNR+IA       KE+T+R
Sbjct  267   KRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-ELLVKEVTYR  325

Query  394   DWPN---DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRF  224
             +       EW  WTW+SD D+  N A FTPSGD     K   L+L+ P PSS  G +T+F
Sbjct  326   EKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLDKIDHLNLIKPEPSSKVGILTKF  385

Query  223   AGALSCKYGKPC  188
             +GALSC  G+PC
Sbjct  386   SGALSCVKGRPC  397



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/451 (49%), Positives = 293/451 (65%), Gaps = 22/451 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
              L       ++IP +   + +    D Y   +  EA+  ++ A+ ++PE +T     EV 
Sbjct  11    FLYSLLCIASLIPNLHANIAEF---DPYLEKKAEEALKSSLAAYNENPEELTDTFNKEV-  66

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGP-----CKALNPIDRCWRCDKDWVKNRKRM  1178
                           + NGTRRHL+ +          CKA NPID+CWRCDK+W  NRK +
Sbjct  67    -----------GETIFNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWANNRKAL  115

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA GFG GTTGGKDG +YVVTD SD+ +EEPKPGTLRHAVIQ+ PLWIIF  SM I L
Sbjct  116   ADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIFEKSMIIKL  175

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             Q EL++ +DKTIDGRG  V +  GAG T+QFV NVI+ N+++  I +TSGG+IRDS  H 
Sbjct  176   QQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHI  235

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GD I+IFG++ +WIDH ++++  DG+IDA+  STA+TISNC F  H+ V+L G
Sbjct  236   GLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLG  295

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             AN+  P DK+MQ+TVAFN FGK   QRMPRCRWG FH++NNDY  WEMYA+GG+A  TII
Sbjct  296   ANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTII  355

Query  457   SQGNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+ A   P+  KE+T+R+  P   W+ W W S+ D F+N A+F  SG       + 
Sbjct  356   SQGNRFKASNNPNT-KEVTNRNGAPESLWRNWQWRSEGDLFLNGAYFRESGPDIKHTPFT  414

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 +   P+   G++TR AG + CK GK C
Sbjct  415   EHTSIKFEPAKFVGRLTRKAGVIKCKIGKAC  445



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 236/429 (55%), Positives = 290/429 (68%), Gaps = 20/429 (5%)
 Frame = -2

Query  1459  IHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRR  1280
             I   D +W  R+A A   A + +   P +VT       H++   T     +R V+   RR
Sbjct  33    IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFN---HAVIRST-----ERGVL---RR  81

Query  1279  HLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
              L GK  K+KGPC A NPIDRCWRC KDW  +RKR+A CA+GFG G TGG  G  YVVTD
Sbjct  82    ELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYVVTD  141

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIV-G  929
               D +   P+ GTLR   +Q  PLWI F+ SM I L  ELLV SDKTIDGRGA V I  G
Sbjct  142   PGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHIARG  201

Query  928   GAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDH  749
             GAG TVQF +NVIIT+L +  +K + GG +RDS TH G RT  +GDGI++F +++VW+DH
Sbjct  202   GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  261

Query  748   LSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKR  569
             +SMS CEDG+ID V+GST VTISN HFT+H+ V+LFGA++  P DKVMQITVAFNHFG+ 
Sbjct  262   VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGRG  321

Query  568   LEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW  389
             L QRMPRCRWG FH++NNDYTHW MYA+GG    TI+SQGNRYIAPP  +  K IT    
Sbjct  322   LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAA-KLITRHYA  380

Query  388   PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGRLDLLDPMPSSHAGKITRFAGA  215
             P  EWK W W SD D F+N A+F  S    GA+  K    D++ P P S+  ++TRFAGA
Sbjct  381   PEWEWKNWAWRSDGDLFMNGAYFQAS---NGAINRKVKGSDMVKPKPGSYVRRLTRFAGA  437

Query  214   LSCKYGKPC  188
             LSC+ G+PC
Sbjct  438   LSCRPGEPC  446



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   428 bits (1100),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 282/420 (67%), Gaps = 12/420 (3%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D +   RK  A   A +A+   P +VT +  A VH            RE+    R+H   
Sbjct  37    DDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRA-----VSSSRREMWERPRKH---  88

Query  1267  KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEM  1088
              K +GPC+A NPID+CWRC +DW  +R+R+A CA GFG  TTGG  G  YVVTD +D ++
Sbjct  89    -KKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPTDLDV  147

Query  1087  EEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQ  908
               P+PGTLR  VIQ GPLWIIF+ SM I L  ELL++SDKTIDGRGA V I  GAG TVQ
Sbjct  148   VNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAGITVQ  207

Query  907   FVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCE  728
               +NVII NL +  +K T GG++RDS TH G RT  +GDGI++F ++NVWIDH+SMS CE
Sbjct  208   LAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISMSNCE  267

Query  727   DGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPR  548
             DG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D++MQITVAFNHFG+ L QRMPR
Sbjct  268   DGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQRMPR  327

Query  547   CRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPNDEWKG  368
             CRWG FH++NNDYTHW MYA+GG    TIISQGNRYIAPP  +  K IT        WK 
Sbjct  328   CRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAA-KVITKHYAEEGVWKN  386

Query  367   WTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             W W ++ D F+N A F PSG     V     + + P P ++  ++TRF+G LSC  GKPC
Sbjct  387   WVWHTEDDLFMNGAIFNPSGGAPKQVDTN--EWVKPKPGTYVTRLTRFSGTLSCCTGKPC  444



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   427 bits (1098),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 232/424 (55%), Positives = 286/424 (67%), Gaps = 15/424 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D +W  +  EA   +  A+   PE VT      VH      +A    R   N TRR LR 
Sbjct  34    DDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVH------LAVSQAR---NSTRRALRS  84

Query  1267  ---KKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSD  1097
                 KFKGPC A NPIDRCWRC ++W++NRK++A CA GFG    GGKDG +YVVTD SD
Sbjct  85    AGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGDFYVVTDPSD  144

Query  1096  NEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGF  917
             N++  PK GTLR  VIQD PLWIIF+  M I L  EL++ S+KTIDGRGA V+I  GA  
Sbjct  145   NDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVRIAYGAQI  204

Query  916   TVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMS  737
             T+QFV NVII  + I  IK ++GGIIRDS  H G+RT  +GDGI+I+GSS++WIDH S+ 
Sbjct  205   TLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHCSLR  264

Query  736   RCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQR  557
              C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +  D +MQITVAFNHFGK L QR
Sbjct  265   NCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFNHFGKGLVQR  324

Query  556   MPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP-ND  380
             MPRCRWG  H++NNDYT W MYA+GGS   TIISQGNR+IAP    + KE+T RD+   D
Sbjct  325   MPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPL-MQFAKEVTKRDYATED  383

Query  379   EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKY  200
              WK WTW S+ D   N AFF  SG P     + R D +   P +   ++TRFAG L C+ 
Sbjct  384   VWKQWTWRSEGDLMQNGAFFRESGSPN-TKSFHRKDFIKAKPGTWVRRLTRFAGPLGCRA  442

Query  199   GKPC  188
             G+PC
Sbjct  443   GRPC  446



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   427 bits (1098),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 222/371 (60%), Positives = 267/371 (72%), Gaps = 9/371 (2%)
 Frame = -2

Query  1285  RRHLRGK--KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVV  1112
             RR L GK  K+KGPC A NPIDRCWRC KDW  +RKR+A CA+GFG G TGG  G  YVV
Sbjct  73    RRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYVV  132

Query  1111  TDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIV  932
             TD  D +   P+ GTLR   +Q  PLWI F+ SM I L  ELLV SDKTIDGRGA V I 
Sbjct  133   TDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHIA  192

Query  931   -GGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWI  755
              GGAG TVQF +NVIIT+L +  +K + GG +RDS TH G RT  +GDGI++F +++VW+
Sbjct  193   RGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWV  252

Query  754   DHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFG  575
             DH+SMS CEDG+ID V+GST VTISN HFT+H+ V+LFGA++  P DKVMQITVAFNHFG
Sbjct  253   DHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFG  312

Query  574   KRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHR  395
             + L QRMPRCRWG FH++NNDYTHW MYA+GG    TI+SQGNRYIAPP  +  K IT  
Sbjct  313   RGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAA-KLITRH  371

Query  394   DWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGRLDLLDPMPSSHAGKITRFA  221
               P  EWK W W SD D F+N A+F  S    GA+  K    D++ P P S+  ++TRFA
Sbjct  372   YAPEWEWKNWAWRSDGDLFMNGAYFQAS---NGAINRKVKGSDMVKPKPGSYVRRLTRFA  428

Query  220   GALSCKYGKPC  188
             GALSC+ G+PC
Sbjct  429   GALSCRPGEPC  439



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 299/479 (62%), Gaps = 37/479 (8%)
 Frame = -2

Query  1522  LLVVFFAF--GAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAE  1349
             LL + F F    +IP +   L ++   D YW  R  EA ++ ++A+  +P  V  +    
Sbjct  6     LLKLMFTFYIAGLIPTIRANLSEL---DEYWSKRAGEAREFTLQAYHSNPYEVVDHFHER  62

Query  1348  VHSMRHETMAFEDD------REV-----------VNGTRRHLRG--------------KK  1262
              +    +    E+D       EV           +N TRR LRG               K
Sbjct  63    HYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSK  122

Query  1261  FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEE  1082
              KGPC A NPID+CWRC  +W K RK +  C  GFG  T GGK G  YVVT + D +M  
Sbjct  123   LKGPCTASNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVN  182

Query  1081  PKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFV  902
             PKPGTLRHAVIQ  PLWIIF   M I L  EL++ S KTID RGA V I  GAG T+QFV
Sbjct  183   PKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQFV  242

Query  901   KNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDG  722
             ++VII  L+I  I  ++GG+IRDS  H G+RT  +GDGI+I+GSS +W+DH+SMS+C+DG
Sbjct  243   RHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDG  302

Query  721   IIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCR  542
             +IDA+ GSTA+TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR R
Sbjct  303   LIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIR  362

Query  541   WGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGW  365
             WG  H++NNDYTHWE+YA+GGS   TI+S GNR+IAPP   +++E+T RD+ ++ EWK W
Sbjct  363   WGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHW  422

Query  364   TWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
              W SD+D F+N A+F  SG+P     + R  ++ P        +T++AGAL C+ GK C
Sbjct  423   NWRSDKDMFMNGAYFRQSGNPHFKCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 296/467 (63%), Gaps = 26/467 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHP--------EHVTR  1364
             LV      ++IP +   + +   +D YWVN+  EA    +  +   P        E    
Sbjct  9     LVCVVCIASLIPTLRANVAE---TDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYD  65

Query  1363  NITAEVHSMRHETMAF--EDDREVVNGT----------RRHLRGK--KFKGPCKALNPID  1226
             N T       HE  AF  EDD E+++ +           R  RGK  K KGPC A NPID
Sbjct  66    NSTDVEEREEHEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPID  125

Query  1225  RCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQ  1046
             +CWRC  DW K RK++  C  GFG  TTGGK G  YVVT   D+++  PKPGTLRHAVIQ
Sbjct  126   KCWRCQADWAKRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQ  185

Query  1045  DGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKR  866
               PLWIIF   M+I L+ EL++ S KTID RGA V +  GAG T+Q+V N+II  L +  
Sbjct  186   KEPLWIIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVHH  245

Query  865   IKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVT  686
             I   SGG++R+S  H G R   +GDGI+IFG++N+W+DH+SMS+C+DG+IDA+ GST +T
Sbjct  246   IIEGSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGIT  305

Query  685   ISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYT  506
             ISN HFT H+ V+L GA++ +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDYT
Sbjct  306   ISNSHFTHHNDVMLLGAHDSNKDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYT  365

Query  505   HWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVND  329
             HWE+YA+GGS G TI+S GNR+IA      + E+T RD+ ++ EWK W W SDRD F+N 
Sbjct  366   HWELYAIGGSQGPTILSHGNRFIASLHKPQYNEVTKRDYASESEWKNWNWRSDRDVFMNR  425

Query  328   AFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             A+F  SG+P+    + R  ++ P     A  +T++AGAL C+ GKPC
Sbjct  426   AYFRQSGNPKFKCTHTRQQMIKPKHGVAASMLTKYAGALDCRVGKPC  472



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 294/464 (63%), Gaps = 35/464 (8%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
              L     F ++IP +   + D    D Y   R  EA+  ++ A+ ++PE VT+    EV 
Sbjct  12    FLFSLLCFISIIPKLYANIADF---DPYLEKRAEEALQSSLAAYNENPEAVTQIFNKEVG  68

Query  1342  SMRHETMAFEDDREVVNGTRRHLR------------------GKKFKGPCKALNPIDRCW  1217
                           ++NGTRRHL+                   +K    CKA NPID+CW
Sbjct  69    ET------------ILNGTRRHLKEEDKEDKNEKVEKDDKEGDEKSVDICKAYNPIDKCW  116

Query  1216  RCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGP  1037
             RCDK+W  NRK +ADCA GFG GTTGGKDG +YVVTD SDN +EEP PGTLRHAVIQ+ P
Sbjct  117   RCDKNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDNNVEEPVPGTLRHAVIQEEP  176

Query  1036  LWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKA  857
             LWIIF  SM I L+ EL++ +DKTIDGRG  V +  GAG T+QFV NVI+ N+++  I +
Sbjct  177   LWIIFEKSMIIKLKQELMINNDKTIDGRGISVHVAYGAGLTLQFVHNVIVHNIRVHHILS  236

Query  856   TSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISN  677
               GG+IRDS  H GLRT  +GD I++FG++ +WIDH ++++  DG++DA+  STA+TISN
Sbjct  237   KDGGMIRDSVKHIGLRTVSDGDAISLFGANRIWIDHCTLTKGADGLVDAIMASTAITISN  296

Query  676   CHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWE  497
             C F  H+ V+L GAN+  P DK+MQ+TVAFN FGK   QRMPRCRWG FH++NNDY  WE
Sbjct  297   CKFNHHNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWE  356

Query  496   MYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFF  320
             MYA+GG+A  TIISQGNR+ A   P+  KE+T+R+  P   W+ W W S+ D F N AFF
Sbjct  357   MYAIGGTANPTIISQGNRFKAADNPNT-KEVTNRNGAPEALWRNWQWRSEGDLFKNGAFF  415

Query  319   TPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
               SG    +  +     +   P+   G++TR AG + CK GK C
Sbjct  416   RESGPEIKSTPFTEHTTIQFEPAKFVGRLTRKAGVIQCKIGKAC  459



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 220/466 (47%), Positives = 294/466 (63%), Gaps = 25/466 (5%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNI------  1358
             LV      ++IP +   + +   +D YWV    EA    + A+   P  +  +       
Sbjct  9     LVCVICIASLIPTLRANVAE---TDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYD  65

Query  1357  -TAEVHSMRHETMAFEDDRE----VVNGTRRHLRG----------KKFKGPCKALNPIDR  1223
              + +V          EDD E    + N TRR LRG           K KGPC A NPID+
Sbjct  66    NSTDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDK  125

Query  1222  CWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQD  1043
             CWRC  DW + RK++  C  GFG  TTGGK G  YVVT + D++   P+PGTLRHAVIQ+
Sbjct  126   CWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQN  185

Query  1042  GPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRI  863
              PLWIIF   M+I L  EL++ S KTID RG  V I  GAG T+Q+V+N+II  L +  I
Sbjct  186   EPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHI  245

Query  862   KATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTI  683
                SGG+IR+S  H G R   +GDGI++FG++N+W+DH+SMS+C+DG+IDA+ GS  +T+
Sbjct  246   VPGSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDHISMSKCQDGLIDAIMGSPGITL  305

Query  682   SNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTH  503
             SN HFT H+ V+L GA N +  DK MQ+TVAFNHFGK L QRMPR RWG  H++NNDYTH
Sbjct  306   SNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTH  365

Query  502   WEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDA  326
             WE+YA+GGS   TI+S GNR+IAPP   +++E+T RD+ P  EWK W W SD+D F+N+A
Sbjct  366   WELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNA  425

Query  325   FFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             +F  SG+P+    + R  ++ P   S    +T++AGAL C+ GKPC
Sbjct  426   YFRQSGNPKFMCSHSRQQMIKPKHGSAVSTLTKYAGALDCRVGKPC  471



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 239/444 (54%), Positives = 291/444 (66%), Gaps = 21/444 (5%)
 Frame = -2

Query  1516  VVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSM  1337
             ++FFA  A+  A   E       D YW  +   A   A KA+T HPE VT +    VHS 
Sbjct  11    LLFFASAALSSANIAEF------DEYWQKKSKVAQAKAKKAYTPHPEEVTNHFNKAVHS-  63

Query  1336  RHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgf  1157
                  +FE      N TRR+LR  K  G C A NPIDRCWRC K+W  NRK +  C  GF
Sbjct  64    -----SFEG-----NSTRRNLRTNKL-GQCLATNPIDRCWRCKKNWSANRKDLVKCVKGF  112

Query  1156  gagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVT  977
             G  TTGG  G  YVVTD SD+ + +PK GTLR  VIQD PLWIIF  SM I L+ EL++ 
Sbjct  113   GRKTTGGAAGEIYVVTDPSDDSLTDPKFGTLRWGVIQDRPLWIIFGKSMVIRLKQELIIN  172

Query  976   SDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDE  797
             +DKTIDGRGA V+I GGA  TVQFV NVII  + I  IK   GG+IRDS  H G+RT  +
Sbjct  173   NDKTIDGRGANVQIAGGAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSD  232

Query  796   GDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPI  617
             GDGI+I GSSN+WIDH+S++RC DG+ID + GSTA+TISNCH T+H  V+L GA++    
Sbjct  233   GDGISIIGSSNIWIDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQ  292

Query  616   DKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYI  437
             D++MQ+TVAFNHFG+ L QRMPRCR+G  H++NNDYTHW MYAVGGS   TIISQGNRYI
Sbjct  293   DEIMQVTVAFNHFGRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYI  352

Query  436   APPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDP  260
             AP   +  KE+T RD+    EW  WTW S  D FV+ AFF  SG P    KY + DL+  
Sbjct  353   APHIEAA-KEVTKRDYAEPAEWSKWTWKSQGDLFVSGAFFVESGGPF-ENKYSKKDLIKA  410

Query  259   MPSSHAGKITRFAGALSCKYGKPC  188
              P +   ++TRF+GAL+CK    C
Sbjct  411   KPGTFVQRLTRFSGALNCKENMEC  434



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   425 bits (1093),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 227/423 (54%), Positives = 278/423 (66%), Gaps = 21/423 (5%)
 Frame = -2

Query  1453  SSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL  1274
             S ++YW  R   A      A+   P        A+V               +   TRR L
Sbjct  42    SDEVYWAERAEAARSRNRAAYVSDPVAAMNRFNADV---------------LRATTRRAL  86

Query  1273  RGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
                ++ GPC A NPIDRCWRC  DW  +RKR+A CA GFG  TTGG  G  YVVTD SD+
Sbjct  87    --ARYSGPCMATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAAGKLYVVTDPSDD  144

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             EM  P+ GTLRHAVIQD PLWI+F+  M I L+ EL+VTSDKTIDGRGA V +VG A  T
Sbjct  145   EMIVPRKGTLRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRGAQVHVVG-AQVT  203

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +Q V +VI+ NL I    A SGG+IRDS  H G+RT  +GDGI++  SSNVWIDH+SMSR
Sbjct  204   LQSVHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSSSNVWIDHVSMSR  263

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             C DG+ID V GSTA+T+SN HFT H  V+LFGA+N +P D+VMQITVAFNHFG+ L QRM
Sbjct  264   CADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITVAFNHFGRGLVQRM  323

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPN-DE  377
             PRCR+G FH++NNDYTHW MYA+GG+   TIISQGNR+IAP  P+  KE+T R++    +
Sbjct  324   PRCRYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPDDPNA-KEVTKREYTAYKD  382

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             +K W W S  D  +N AFF  SG  Q   KY  LD +      + G++TRFAG L C  G
Sbjct  383   YKEWVWKSQGDVMMNGAFFNESGG-QNERKYDELDFIPAKHGRYVGQLTRFAGPLKCIVG  441

Query  196   KPC  188
             +PC
Sbjct  442   QPC  444



>ref|XP_003571658.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=432

 Score =   425 bits (1092),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 269/371 (73%), Gaps = 9/371 (2%)
 Frame = -2

Query  1285  RRHLRGKKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVV  1112
             RR L+GKK +  GPC+A NPIDRCWRC KDW  +R R+A CA GFG  TTGG  G  Y+V
Sbjct  66    RRALKGKKKQSNGPCEATNPIDRCWRCRKDWATDRMRLARCAKGFGQNTTGGLGGQIYIV  125

Query  1111  TDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIV  932
             TD +D +++ P+PGT+R  VIQ  P+WIIF+ +M ITL  EL++ SD TIDGRGA V I 
Sbjct  126   TDPTDADVQNPRPGTIRFGVIQPQPIWIIFAKNMVITLTQELIINSDTTIDGRGAQVHIA  185

Query  931   GGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWID  752
              GAG TVQ   NVII NL +  IK T GG++RDS  H G RT  +GDGI++F ++NVWID
Sbjct  186   KGAGLTVQNRSNVIIHNLHVHDIKHTDGGMVRDSPDHIGYRTRADGDGISLFTATNVWID  245

Query  751   HLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGK  572
             H+S S CEDG++D V+ STA+TISNCH T H+ V+LFGA++  P DK+MQ+TVAF HFG+
Sbjct  246   HISTSMCEDGLVDIVQSSTAITISNCHLTSHNDVMLFGASDSYPDDKIMQVTVAFTHFGR  305

Query  571   RLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRD  392
              L QRMPRCRWG FH++NNDYTHW MYA+GGS+  TIISQGNRYIAPP  +  K+IT RD
Sbjct  306   GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRYIAPPNKAA-KKITKRD  364

Query  391   W-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV--KYGRLDLLDPMPSSHAGKITRFA  221
             + P  EWK W W S+ D  +N+A F P+G   GAV  K+    L+ P P ++  ++ R+A
Sbjct  365   YAPESEWKNWVWHSEDDLLMNEAVFDPTG---GAVTYKFDSTKLIKPKPGTYVTRLVRYA  421

Query  220   GALSCKYGKPC  188
             G L+CK G PC
Sbjct  422   GTLACKPGCPC  432



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   425 bits (1092),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 298/454 (66%), Gaps = 26/454 (6%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKH-PEHVTRNITAEV  1346
             L +VFF   A +      +GD    D YW  RK  A D A +A  KH P  V   +   V
Sbjct  15    LYLVFFFLSAALSE--ANIGDF---DEYWQQRKLMA-DAAAEATYKHDPVEVANQLNRAV  68

Query  1345  H-SMRHETMAFEDDREVVNGTRRHLRG-----KKFKGPCKALNPIDRCWRCDKDWVKNRK  1184
             H S+  E +          GTRR + G      KF GPC+A NPIDRCWRC +DW  +RK
Sbjct  69    HRSVEKEDI----------GTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRK  118

Query  1183  RMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTI  1004
             R+A CA GFG  TTGG  G +YVVTD +D+++  P+PGTLR  VIQ  PLWI F+ +M I
Sbjct  119   RLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMII  178

Query  1003  TLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATS--GGIIRDS  830
             TL+ EL++  DKTIDGRG  V+I  GA  T+QFV NVII N+ I  I +++  GG +RDS
Sbjct  179   TLKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDS  238

Query  829   ATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKV  650
               H G RT  +GDGIT+FGS+NVW+DHLS+S C+DG+ID +  ST VTISNCH T+H+ V
Sbjct  239   PDHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDV  298

Query  649   LLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAG  470
             +LF +++  P D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS  
Sbjct  299   MLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKA  358

Query  469   STIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAV  290
              TIISQGNRYIAPP  +  +     D P   WK W W S+ D F+  A+FT +G  Q   
Sbjct  359   PTIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGG-QINR  417

Query  289   KYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             ++ + DL+ P   S+  ++TR+AG+L+C  GKPC
Sbjct  418   QFNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   424 bits (1091),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/451 (49%), Positives = 292/451 (65%), Gaps = 22/451 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
              L       ++IP +   + +    D Y   +  EA+  ++ A+ ++PE +T     EV 
Sbjct  11    FLFSLLCIASLIPNLHANIAEF---DPYLEKKAEEALKSSLAAYNENPEELTDTFNKEV-  66

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGP-----CKALNPIDRCWRCDKDWVKNRKRM  1178
                           + NGTRRHL+ +          CKA NPID+CWRCDK+W  NRK +
Sbjct  67    -----------GETIFNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWANNRKAL  115

Query  1177  ADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITL  998
             ADCA GFG GTTGGKDG +YVVTD SD+ +EEP PGTLRHAVIQ+ PLWIIF  SM I L
Sbjct  116   ADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPNPGTLRHAVIQEEPLWIIFEKSMIIRL  175

Query  997   QHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHK  818
             + EL++ +DKTIDGRG  V +  GAG T+QFV NVI+ N+++  I +TSGG+IRDS  H 
Sbjct  176   KQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHI  235

Query  817   GLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFG  638
             GLRT  +GD I+IFG++ +WIDH ++++  DG+IDA+  STA+TISNC F  H+ V+L G
Sbjct  236   GLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLG  295

Query  637   ANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTII  458
             AN+  P DK+MQ+TVAFN FGK   QRMPRCRWG FH++NNDY  WEMYA+GG+A  TII
Sbjct  296   ANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTII  355

Query  457   SQGNRYIAPPGPSYFKEITHRD-WPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG  281
             SQGNR+ A   P+  KE+T+R+  P   W+ W W S+ D F+N A+F  SG       + 
Sbjct  356   SQGNRFKASNNPNT-KEVTNRNGAPESLWRNWQWRSEGDLFLNGAYFRESGPDIKHTPFT  414

Query  280   RLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                 +   P+   G++TR AG + CK GK C
Sbjct  415   EHTSIKFEPAKFVGRLTRKAGVIKCKIGKAC  445



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 260/360 (72%), Gaps = 1/360 (0%)
 Frame = -2

Query  1264  KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEME  1085
             K  GPC A NPID+CWRC  DW + RK++  C  GFG  TTGGK G  YVVT   D++M 
Sbjct  6     KLTGPCTASNPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMV  65

Query  1084  EPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQF  905
              P+PGTLRHAVIQ  PLWI+F   M+I L  EL++TSDKTID RGA V I  GAG T+Q+
Sbjct  66    NPRPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQY  125

Query  904   VKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCED  725
             V N+II  L +  I  +SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMS+C+D
Sbjct  126   VHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQD  185

Query  724   GIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRC  545
             G+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK MQ+TVA+NHFGK L QRMPR 
Sbjct  186   GLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRV  245

Query  544   RWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKG  368
             RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ ++ EWK 
Sbjct  246   RWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKN  305

Query  367   WTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             W W S++D F+N+A+F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  306   WNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  365



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 240/494 (49%), Positives = 308/494 (62%), Gaps = 53/494 (11%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAF------------TKHPE  1376
             L+  F    +IP +   + ++   D YW  R  EA ++ ++A+             +H +
Sbjct  9     LMCVFCIAGLIPTIRANISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1375  HVTRNITAEVHSMRH--------------ETMAFEDDR---------EVV-------NGT  1286
             + T + T E HS                 +  A E+D          EV+       N T
Sbjct  66    NSTDDTTTEEHSSNSADVTATAEDSSNSTDVTATEEDSSTKPEEERTEVIEMVGNSKNST  125

Query  1285  RRHLRGKKFKG------PCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
             RR L+GK          PC A NPID+CWRC  +W   RK++A C  GFG GTTGGK G 
Sbjct  126   RRSLKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRGR  185

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVT + D +M  P PGTLRHAVIQ  PLWIIF   M+I L  ELLV SDKTID RGA 
Sbjct  186   IYVVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGAD  245

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  GAG T+QFV+NVII  L I  I  ++GG+IRDS  H G+RT  +GDG++I+GSSN
Sbjct  246   VHIAHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSN  305

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA-NNWDPIDKVMQITVAF  587
             +WIDH+SMS+C+DG+IDA+ GSTA+TISN HFT H+ V+L GA NN +  D+ MQ+TVA+
Sbjct  306   IWIDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAY  365

Query  586   NHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKE  407
             NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   Y+KE
Sbjct  366   NHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKE  425

Query  406   ITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKIT  230
             +T RD+   DEWK WTW S++D F+N AFF  SGDP     + R  ++ P       K+T
Sbjct  426   VTKRDYALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRKQMIKPKNGYAVSKLT  485

Query  229   RFAGALSCKYGKPC  188
             ++AGAL C+ GK C
Sbjct  486   KYAGALDCRVGKRC  499



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 297/453 (66%), Gaps = 24/453 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKH-PEHVTRNITAEV  1346
             L +VFF   A +      +GD    D YW  RK  A D A +A  KH P  V   +   V
Sbjct  15    LYLVFFFLSAALSE--ANIGDF---DEYWQQRKLMA-DAAAEATYKHDPVEVANQLNRAV  68

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRG-----KKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
             H       + E D     GTRR + G      KF GPC+A NPIDRCWRC +DW  +RKR
Sbjct  69    HR------SVEKDDI---GTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKR  119

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             +A CA GFG  TTGG  G +YVVTD +D+++  P+PGTLR  VIQ  PLWI F+ +M IT
Sbjct  120   LARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIIT  179

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATS--GGIIRDSA  827
             L+ EL++  DKTIDGRG  V+I  GA  T+QFV NVII N+ I  I +++  GG +RDS 
Sbjct  180   LKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSP  239

Query  826   THKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVL  647
              H G RT  +GDGIT+FGS+NVW+DHLS+S C+DG+ID +  ST VTISNCH T+H+ V+
Sbjct  240   DHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVM  299

Query  646   LFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGS  467
             LF +++  P D++MQITVAFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS   
Sbjct  300   LFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAP  359

Query  466   TIISQGNRYIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVK  287
             TIISQGNRYIAPP  +  +     D P   WK W W S+ D F+  A+FT +G  Q   +
Sbjct  360   TIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGG-QINRQ  418

Query  286   YGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             + + DL+ P   S+  ++TR+AG+L+C  GKPC
Sbjct  419   FNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 282/425 (66%), Gaps = 16/425 (4%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHL--  1274
             D +W  +  EA   +  A+   PE VT +    VH      +A    R   N TRR L  
Sbjct  54    DDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVH------LALAQAR---NSTRRGLKA  104

Query  1273  -RGKKFK-GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSS  1100
              R  KF+ G C A NPIDRCWRC KDW+K+RK++A C  GFG    GG+DG +YVVTD S
Sbjct  105   VRADKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYVVTDPS  164

Query  1099  DNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAG  920
             DN++  PK GTLR  VIQD PLWIIF+  M I L  EL++ S+KTID RGA V I  GA 
Sbjct  165   DNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGANVHIAFGAQ  224

Query  919   FTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSM  740
              ++QFV+NVII  L I  IK  +GG+IRDS  H G RT  +GDGI+I+GSS++WIDH SM
Sbjct  225   ISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSDIWIDHCSM  284

Query  739   SRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQ  560
               C DG+IDA++ STA+TISNCHF  H+ VLLFGA++ +  D +MQ+TVAFNHFGK L Q
Sbjct  285   RNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAFNHFGKGLVQ  344

Query  559   RMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP-N  383
             RMPRCRWG FH++NNDYTHW MYA+GGS   TIISQGNR++APP   + KEIT RD+   
Sbjct  345   RMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPP-MRFAKEITKRDYATE  403

Query  382   DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCK  203
             D WK WTW S+ D   N AFF  SG P     + + D +   P +   ++TR+AG L C+
Sbjct  404   DVWKHWTWRSEGDLMQNGAFFRESGAP-AKNNFDKKDFIKAKPGTWVKRLTRYAGPLGCR  462

Query  202   YGKPC  188
              G+ C
Sbjct  463   AGRAC  467



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 239/494 (48%), Positives = 309/494 (63%), Gaps = 53/494 (11%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAF------------TKHPE  1376
             L+  F    +IP +   + ++   D YW  R  EA ++ ++A+             +H +
Sbjct  9     LMCVFCIAGLIPTIKANISEL---DEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1375  HVTRNITAEVHSMRH-ETMAFEDDR----------------------EVV-------NGT  1286
             + T + T E HS    +  A E+D                       EV+       N T
Sbjct  66    NSTDDTTTEEHSSNSTDVTATEEDNSNSTDVTATEEDSSTKPEEEGTEVIEMVGNSKNST  125

Query  1285  RRHLRGKKFKG------PCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGP  1124
             RR L+GK          PC A NPID+CWRC  +W   RK++A C  GFG GTTGGK G 
Sbjct  126   RRSLKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRGR  185

Query  1123  YYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAY  944
              YVVT + D +M  P PGTLRHAVIQ  PLWIIF   M+I L  ELLV SDKTID RGA 
Sbjct  186   IYVVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGAD  245

Query  943   VKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSN  764
             V I  GAG T+QFV+NVII  L I  I  ++GG+IRDS  H G+RT  +GDG++I+GSSN
Sbjct  246   VHIAHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSN  305

Query  763   VWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGA-NNWDPIDKVMQITVAF  587
             +WIDH+SMS+C+DG+IDA+ GSTA+TISN HFT H+ V+L GA NN +  D+ MQ+TVA+
Sbjct  306   IWIDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAY  365

Query  586   NHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKE  407
             NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   Y+KE
Sbjct  366   NHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKE  425

Query  406   ITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKIT  230
             +T RD+ + DEWK WTW S++D F+N AFF  SGDP     + R  ++ P       K+T
Sbjct  426   VTKRDYASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRKQMIKPKNGYAVSKLT  485

Query  229   RFAGALSCKYGKPC  188
             ++AGAL C+ G+ C
Sbjct  486   KYAGALDCRVGRRC  499



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   426 bits (1094),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 230/501 (46%), Positives = 298/501 (59%), Gaps = 60/501 (12%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             L+  F    +IP + G + ++   D YW  R  EA ++ ++A+   P  +  +     + 
Sbjct  9     LMFMFCIAGLIPTIRGNISEL---DEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV-------------------------------------------VNG  1289
                +    E+D  V                                              
Sbjct  66    NSTDATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKS  125

Query  1288  TRRHLRGKK-------------FKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgag  1148
             TRR LRGK               KGPC A NPID+CWRC  +W K RK++  C  GFG  
Sbjct  126   TRRSLRGKGKGKWSKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHR  185

Query  1147  ttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDK  968
             TTGGK G  YVVT + D +M  PKPGTLRHAVIQ  PLWIIF   M+I L  ELL+ S K
Sbjct  186   TTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHK  245

Query  967   TIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDG  788
             TID RGA V I  GAG T+QFVKNVII  L I  I  +SGG+IRDS  H G+RT  +GDG
Sbjct  246   TIDARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDG  305

Query  787   ITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKV  608
             ++I+GSSN+W+DH+SMS+C+DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK 
Sbjct  306   LSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKH  365

Query  607   MQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPP  428
             MQ+TVA+NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP
Sbjct  366   MQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPP  425

Query  427   GPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPS  251
                +++E+T RD+ P DEWK W W S++D F+N A+F  SG+P     + R  ++ P   
Sbjct  426   HKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTRKQMIKPKNG  485

Query  250   SHAGKITRFAGALSCKYGKPC  188
                 K+T++AGAL C+ GK C
Sbjct  486   MAVSKLTKYAGALDCRVGKRC  506



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   423 bits (1088),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 288/427 (67%), Gaps = 9/427 (2%)
 Frame = -2

Query  1465  GDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGT  1286
              +I   D +W  +  EA+  +  A+   PE VT +    VH      +A  + R     T
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVH------LALSEARNSTRRT  79

Query  1285  RRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTD  1106
              R +   KFKGPC A NPIDRCWRC K+W+ +RK++A CA GFG    GGK+G +YVVTD
Sbjct  80    LRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTD  139

Query  1105  SSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGG  926
              SD+++  PK GTLR  VIQD PLWIIF+  M I L  EL++ S+KTIDGRGA V I  G
Sbjct  140   PSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFG  199

Query  925   AGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHL  746
             A  T+QFV +VII  + I  I+ ++GGIIRDS  H G+RT  +GDGI+I+GSS++WIDH 
Sbjct  200   AQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHC  259

Query  745   SMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRL  566
             S+  C DG+IDA++ STA+TISNCHFT H+ VLLFGA++ +  D +MQ TVAFNHFGK L
Sbjct  260   SLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKGL  319

Query  565   EQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWP  386
              QRMPRCRWG FH++NNDYT W MYA+GGS   TIISQGNR++AP    + KE+T RD+ 
Sbjct  320   VQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPR-MLFSKEVTKRDYA  378

Query  385   -NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALS  209
               D WK WTW S+ D   N AFF  SG+P  A K+ R D +   P +   ++TRFAG L 
Sbjct  379   TEDVWKQWTWRSEGDLMQNGAFFRESGNPN-ARKFDRKDFIKAKPGTWVRRLTRFAGPLG  437

Query  208   CKYGKPC  188
             C+ G+PC
Sbjct  438   CRAGRPC  444



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   423 bits (1087),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 224/426 (53%), Positives = 277/426 (65%), Gaps = 21/426 (5%)
 Frame = -2

Query  1462  DIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTR  1283
             ++ S + YW  R   A    + A+   P   T    A+V               +   TR
Sbjct  33    NVTSDEEYWAERAEVARSRNLAAYVSDPVAATNRFNADV---------------LRATTR  77

Query  1282  RHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDS  1103
             R L   ++ GPC A NPIDRCWRC  DW  +RKR+A CA GFG  T GG  G  YVV D 
Sbjct  78    RAL--ARYDGPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRTVGGAAGKLYVVRDP  135

Query  1102  SDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGA  923
             SD+EM  P+ GTLRHAVIQD PLWI+F+  M I L+ EL+V  +KTIDGRGA V I+  A
Sbjct  136   SDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIMF-A  194

Query  922   GFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLS  743
               T+Q V+NVI+ NL I   KA SGG+IRDS  H GLRT  +GDG+++  SSNVWIDH+S
Sbjct  195   QITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHVS  254

Query  742   MSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLE  563
             MS C DG+ID V GSTA+T+SN HFTDH  V+LFGA+N  P D VMQ+TVAFNHFG+ L 
Sbjct  255   MSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVAFNHFGRGLV  314

Query  562   QRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-P  386
             QRMPRCR+G FH++NNDYTHW MYA+GG+   TIISQGNR+IAP  P+  KE+T R++ P
Sbjct  315   QRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPDDPNA-KEVTKREYTP  373

Query  385   NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSC  206
               ++K W W S  D  +N AFF  SG  Q   KY R D +      + G++TRFAG L C
Sbjct  374   YKDYKEWVWKSQGDVMMNGAFFNESGG-QNERKYDRFDFIPAKHGRYVGQLTRFAGPLKC  432

Query  205   KYGKPC  188
               G+PC
Sbjct  433   IVGQPC  438



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   425 bits (1093),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 268/377 (71%), Gaps = 7/377 (2%)
 Frame = -2

Query  1297  VNGTRRHLRGK------KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttgg  1136
              N TRR LRGK      K +GPC A NPID+CWRC  DW K RK++  C  GFG  TTGG
Sbjct  136   TNSTRRSLRGKGKGKWSKLRGPCTASNPIDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGG  195

Query  1135  kdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDG  956
             K G  YVVT + D +M  PKPGTLRHAVIQ  PLWIIF   M I L  ELL+ S KTID 
Sbjct  196   KRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELLINSHKTIDA  255

Query  955   RGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIF  776
             RGA V I  GAG T+QFV+NVII  L I  I  +SGG+IRDS  H G+RT  +GDGI+I+
Sbjct  256   RGADVHIAHGAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISIY  315

Query  775   GSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQIT  596
             GSS +W+DH+SMS+C+DG+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK MQ+T
Sbjct  316   GSSKIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  375

Query  595   VAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSY  416
             VA+NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP   +
Sbjct  376   VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  435

Query  415   FKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAG  239
             ++E+T RD+ + DEWK W W S++D F+N A+F  SGDP+    + R  ++ P       
Sbjct  436   YREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTRQQMIKPKHGLAVS  495

Query  238   KITRFAGALSCKYGKPC  188
             K+T++AGAL C+ GK C
Sbjct  496   KLTKYAGALDCRVGKRC  512



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 304/457 (67%), Gaps = 28/457 (6%)
 Frame = -2

Query  1540  NKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRN  1361
             +K +  +L++  +F  ++P        I   D Y   R   +++ + KAF  +PE +  +
Sbjct  8     HKFSILVLIIILSFVLLLPKSGAA---IAKYDEYLKKRAQASLEESRKAFNPNPEELADD  64

Query  1360  ITAEVHSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKR  1181
             +  +V     ET+  E       G +R+LR    +G CKA NPIDRCWRCD +W KNRK+
Sbjct  65    LNDQVS----ETLTRE-------GGKRNLR----QGGCKATNPIDRCWRCDPNWDKNRKQ  109

Query  1180  MADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTIT  1001
             +A+CA GFG   TGGK G YYVVTD SDN+M++PKPGTLRHAVIQ  PLWIIF  +M IT
Sbjct  110   LAECARGFGHRATGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVIT  169

Query  1000  LQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATH  821
             L+ EL+  SDKT+DGRGA V I  GAG T+QFV NVII N+ I  I    GG+IRD+  H
Sbjct  170   LKEELIFASDKTVDGRGAEVHIAYGAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDH  229

Query  820   KGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLF  641
              GLRT  +GDGI++FGS+N+WIDH+S+S+  DG+ID ++GSTAVTISNC F +H+ V+L 
Sbjct  230   IGLRTQSDGDGISVFGSNNIWIDHVSLSKGTDGLIDVIEGSTAVTISNCKFNNHNDVMLL  289

Query  640   GANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTI  461
             GA++    D +MQ+TVAFN FG+ L QRMPRCR G  H+INNDY  W +YA+GGSA STI
Sbjct  290   GAHDGSNKDSIMQVTVAFNQFGEGLIQRMPRCRLGFVHVINNDYDSWGLYAIGGSAHSTI  349

Query  460   ISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKY  284
             ISQGNR+ A   P   K++T R + ++ EWK W W S+ D F+N A+F  SG P   +K+
Sbjct  350   ISQGNRFKASNNPDT-KQVTRRAYASESEWKKWQWRSEGDMFLNGAYFVESGPP---IKH  405

Query  283   GRLDL-----LDPMPSSHAGKITRFAGALSCKYGKPC  188
              +L L     +   P S AG++TR+AGA  C  GK C
Sbjct  406   TKLPLRKKNSIKFRPGSFAGRLTRYAGARMCFPGKLC  442



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 283/449 (63%), Gaps = 42/449 (9%)
 Frame = -2

Query  1525  SLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEV  1346
             SL V    F  V  A   E       D YW  R  EA   A  AF  +PE VT  + A V
Sbjct  6     SLFVCSLLFFVVANANVDE-------DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAV  58

Query  1345  HSMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCA  1166
                   TM         N TRR LR KK++GPC A NPIDRCWRCD++W KNR+++A+C 
Sbjct  59    S----RTMLGH------NSTRRSLR-KKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECP  107

Query  1165  LgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHEL  986
             LGFG  T GGK GP YVVTD+SD+++  PKPGTLRH VIQ GPLWIIF  SM I L  EL
Sbjct  108   LGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQEL  167

Query  985   LVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRT  806
             +++S KTID RGA V I  GAG T+QFV NVII NL I  I + SGG+IRDS  H G RT
Sbjct  168   MISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRT  227

Query  805   FDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNW  626
               +GDGI+IFGSS+VWIDH+SMS C+DG+IDA+ GSTA+TISNCHFT H++  +      
Sbjct  228   QSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNERAIATQ---  284

Query  625   DPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGN  446
                              K    +MPRCRWG FH++NNDYTHW MYA+GGS   TI+SQGN
Sbjct  285   -----------------KTKLCKMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  327

Query  445   RYIAPPGPSYFKEITHRDWP-NDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYG--RL  275
             R+IAPP P+  K+IT R++   DEWK W+W S+ DE +N A F  SGD     K G  R 
Sbjct  328   RFIAPPNPNA-KQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRY  386

Query  274   DLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             D++   P ++  ++ R +G + C  GKPC
Sbjct  387   DMISFKPGTYVRRLVRLSGTIECTPGKPC  415



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   424 bits (1089),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/379 (57%), Positives = 267/379 (70%), Gaps = 7/379 (2%)
 Frame = -2

Query  1303  EVVNGTRRHLRGK------KFKGPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagtt  1142
             E  N TRR LRGK      K KGPC A NPID+CWRC  DW + RKR+  C  GFG  TT
Sbjct  126   ESTNSTRRSLRGKGRGKWSKLKGPCTASNPIDKCWRCRPDWARRRKRLVKCVRGFGHRTT  185

Query  1141  ggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTI  962
             GGK G  YVVT + D +M  P PGTLRHAVIQ  PLWIIF   M+I L  ELL+ S KTI
Sbjct  186   GGKRGRIYVVTSNLDEDMVNPVPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTI  245

Query  961   DGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGIT  782
             D RGA V I  GAG T+QFV+NVII  L I  I  +SGG+IRDS  H G+RT  +GDG++
Sbjct  246   DARGADVHIAHGAGITMQFVRNVIIHGLHIHHISESSGGMIRDSVDHYGMRTRADGDGLS  305

Query  781   IFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQ  602
             I+GSSN+W+DH+SMS+C+DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK MQ
Sbjct  306   IYGSSNIWLDHISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNEEDKKMQ  365

Query  601   ITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGP  422
             +TVA+NHFGK L QRMPR RWG  H++NNDYTHWE+YA+GGS G TI+S GNR+IAPP  
Sbjct  366   VTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHK  425

Query  421   SYFKEITHRDWPN-DEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSH  245
              +++E+T RD+ + DEWK W W S++D F+N A+F  SG P     + R  ++ P     
Sbjct  426   PHYREVTKRDYASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCAHTRKQMIKPKNGMA  485

Query  244   AGKITRFAGALSCKYGKPC  188
               K+T++AGAL C+ GK C
Sbjct  486   VSKLTKYAGALDCRVGKRC  504



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   421 bits (1083),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 233/448 (52%), Positives = 302/448 (67%), Gaps = 21/448 (5%)
 Frame = -2

Query  1522  LLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVH  1343
             LL+    F  +IP        I   D Y   +  E+   ++KAF  +PE V   +  +V 
Sbjct  13    LLLSMIYFVTLIPKSHAA---IAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVG  69

Query  1342  SMRHETMAFEDDREVVNGTRRHLRGKKFKGPCKALNPIDRCWRCDKDWVKNRKRMADCAL  1163
                 ET+  E      N +RRHL   K +  CKA NPIDRCWRCD DW KNRK++A+C  
Sbjct  70    ----ETLVHE------NLSRRHL---KEENDCKATNPIDRCWRCDGDWSKNRKKLAECVR  116

Query  1162  gfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELL  983
             GFG  TTGGKDG YY+VTD SD++M++PK GTLRHAVIQ  PLWIIF+ SM I L+ EL+
Sbjct  117   GFGHRTTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIRLKQELI  176

Query  982   VTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTF  803
               SDKT+DGRG  V+I  GAG T+QFV NVII N++I  I +T GG+IRD+  H GLRT 
Sbjct  177   FASDKTVDGRGVRVRIAYGAGLTLQFVHNVIIHNIRIHNIVSTPGGMIRDAVDHIGLRTV  236

Query  802   DEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWD  623
              +GDGI +F S+N+WIDH+S+S+  DG+ID ++GSTA+TISNC F +H+ V+L GA++  
Sbjct  237   SDGDGINVFSSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNNHNTVMLLGAHDNS  296

Query  622   PIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNR  443
               D +MQ+TVAFN FGK L QRMPRCRWG FH+INNDY+ W MYA+GGS+  TIISQGNR
Sbjct  297   TKDTIMQVTVAFNRFGKGLVQRMPRCRWGFFHVINNDYSKWLMYAIGGSSNPTIISQGNR  356

Query  442   YIAPPGPSYFKEITHRDWPNDEWKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRL---D  272
             + A   P + K++T R+    EWK W W S+ D+FVN A+F  SG P+       L   +
Sbjct  357   FKASDNP-FTKQVTKRESTESEWKKWQWRSEGDKFVNGAYFRESG-PKVKHTISPLKEKN  414

Query  271   LLDPMPSSHAGKITRFAGALSCKYGKPC  188
             L+   P S+AG++TR+AGAL+C  GK C
Sbjct  415   LIKFKPGSYAGRLTRYAGALNCVAGKSC  442



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 240/465 (52%), Positives = 306/465 (66%), Gaps = 24/465 (5%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
              N  ++    V  +   V P+V G +      D YW  R+ +A+   +K++  +P +VT 
Sbjct  6     LNLGSYVFAFVSLSLAVVAPSVQGHVA---VYDEYWTQRQTDALRETIKSYDPNPFNVTD  62

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHLR-------GKKFKGPCKALNPIDRCWRCDK  1205
                   H   H  +A E      NGTRR LR        ++  G   +LN ID+CWR DK
Sbjct  63    ------HFNHHAALAMETT-GADNGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDK  115

Query  1204  DWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWII  1025
             +W KNRK++ADC LGFG  TTGGK G +YVVTD+SD+++  PKPGTLRHAV +D PLWII
Sbjct  116   NWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWII  175

Query  1024  FSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGG  845
             F  SM I LQ EL++T DKTIDGRGA V I+GGAG T+QFVKNVII N+ IK IK  +GG
Sbjct  176   FGRSMIIKLQQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGG  235

Query  844   IIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFT  665
             +IRD   H G R+  +GDGI IFG++N+WIDH+SM+ C DG+IDA+ GSTA+TISN H T
Sbjct  236   MIRDCEHHVGQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLT  295

Query  664   DHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAV  485
             DH++VLLFG  + D IDK MQITVAFNHFGKRL QRMPR R+GL H++NNDYTHWEMYA+
Sbjct  296   DHNEVLLFGGKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAI  355

Query  484   GGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG  308
             GG+   TIISQGNR+IAP   +  K++T R++ P  EWK W W S+RD F+N A+F  SG
Sbjct  356   GGNKNPTIISQGNRFIAPHKET-CKQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSG  414

Query  307   -----DPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                   P       R   + P   +   ++T+ AG L C  GK C
Sbjct  415   RANAWSPAPKNPIHRKFAIRPQSGTGVRRLTKDAGTLGCTPGKSC  459



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   421 bits (1082),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 240/465 (52%), Positives = 306/465 (66%), Gaps = 24/465 (5%)
 Frame = -2

Query  1543  FNKMNWSLLVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTR  1364
              N  ++    V  +   V P+V G +      D YW  R+ +A+   +K++  +P +VT 
Sbjct  6     LNLGSYVFAFVSLSLAVVAPSVQGHVA---VYDEYWTQRQTDALRETIKSYDPNPFNVTD  62

Query  1363  NITAEVHSMRHETMAFEDDREVVNGTRRHLR-------GKKFKGPCKALNPIDRCWRCDK  1205
                   H   H  +A E      NGTRR LR        ++  G   +LN ID+CWR DK
Sbjct  63    ------HFNYHAALAMETT-GADNGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDK  115

Query  1204  DWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQDGPLWII  1025
             +W KNRK++ADC LGFG  TTGGK G +YVVTD+SD+++  PKPGTLRHAV +D PLWII
Sbjct  116   NWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWII  175

Query  1024  FSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKRIKATSGG  845
             F  SM I LQ EL++T DKTIDGRGA V I+GGAG T+QFVKNVII N+ IK IK  +GG
Sbjct  176   FGRSMIIKLQQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGG  235

Query  844   IIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVTISNCHFT  665
             +IRD   H G R+  +GDGI IFG++N+WIDH+SM+ C DG+IDA+ GSTA+TISN H T
Sbjct  236   MIRDCEHHVGQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLT  295

Query  664   DHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYTHWEMYAV  485
             DH++VLLFG  + D IDK MQITVAFNHFGKRL QRMPR R+GL H++NNDYTHWEMYA+
Sbjct  296   DHNEVLLFGGKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAI  355

Query  484   GGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDEWKGWTWVSDRDEFVNDAFFTPSG  308
             GG+   TIISQGNR+IAP   +  K++T R++ P  EWK W W S+RD F+N A+F  SG
Sbjct  356   GGNKNPTIISQGNRFIAPHQEN-CKQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSG  414

Query  307   -----DPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
                   P       R   + P   +   ++T+ AG L C  GK C
Sbjct  415   RANAWSPAPKNPIHRKFAIRPQSGTGVRRLTKDAGTLGCTPGKSC  459



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   421 bits (1082),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 293/467 (63%), Gaps = 26/467 (6%)
 Frame = -2

Query  1519  LVVFFAFGAVIPAVAGELGDIHSSDLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHS  1340
             LV      + IP +     ++  +D YWVN+  EA  + + A+   P  +  +     + 
Sbjct  9     LVCVICIASFIPTIRA---NVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  1339  MRHETMAFEDDREV--------------VNGTRRHLRGK--------KFKGPCKALNPID  1226
                +    E+D+ V               N TRR L GK        K +GPC A NPID
Sbjct  66    NSTDVEETEEDKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPID  125

Query  1225  RCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDNEMEEPKPGTLRHAVIQ  1046
             +CWRC  DW K RK++  C  GFG   TGGK G  YVVT   D++   P+PGTLRHAVIQ
Sbjct  126   KCWRCQPDWAKRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQ  185

Query  1045  DGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFTVQFVKNVIITNLKIKR  866
               PLWIIF   M+I L  EL++ S KTID RG+ V I  GAG T+Q+V N+II  L I  
Sbjct  186   KEPLWIIFKHDMSIRLSQELMIASHKTIDARGSNVHIAYGAGITIQYVHNIIIHGLHIHH  245

Query  865   IKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSRCEDGIIDAVKGSTAVT  686
             I  +SGG+IRDS  H G R   +GDGI+IFG++N+W+DH+SMSRC+DG+IDA+ GSTA+T
Sbjct  246   IVKSSGGLIRDSINHFGQRGQADGDGISIFGATNIWLDHISMSRCQDGLIDAIMGSTAIT  305

Query  685   ISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRMPRCRWGLFHIINNDYT  506
             ISN HFT H+ V+L GA + +  DK MQ+TVA+NHFGK L QRMPR RWG  H++NNDYT
Sbjct  306   ISNSHFTHHNDVMLLGAQDNNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  365

Query  505   HWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDWPND-EWKGWTWVSDRDEFVND  329
             HWE+YA+GGS G TI+S GNR+IAPP   +++E+T RD+ ++ EWK W W S++D F+N 
Sbjct  366   HWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEGEWKHWNWRSEKDYFLNG  425

Query  328   AFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYGKPC  188
             A F  SG+P     + R  ++ P       K+T++AGAL C+ GK C
Sbjct  426   AHFRESGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  472



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 275/423 (65%), Gaps = 36/423 (9%)
 Frame = -2

Query  1447  DLYWVNRKAEAMDYAMKAFTKHPEHVTRNITAEVHSMRHETMAFEDDREVVNGTRRHLRG  1268
             D YW +R  EA   A++A++ HP  VT  +  +V          ++     N TRR LRG
Sbjct  10    DDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDV----------QEALTAKNNTRRQLRG  59

Query  1267  KKFK--GPCKALNPIDRCWRCDKDWVKNRKRMADCALgfgagttggkdGPYYVVTDSSDN  1094
             +K K  GPC A NPIDRCWRCD +W  NRKR+ADC LGFG  T GGK GPYY+VTD SD 
Sbjct  60    RKNKKGGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYYIVTDPSDT  119

Query  1093  EMEEPKPGTLRHAVIQDGPLWIIFSASMTITLQHELLVTSDKTIDGRGAYVKIVGGAGFT  914
             ++  PKPGTLRHAVIQ  PLWIIF+ SM I L  EL++T DKTID RGA V+I  GAG T
Sbjct  120   DLINPKPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARGANVRIAYGAGIT  179

Query  913   VQFVKNVIITNLKIKRIKATSGGIIRDSATHKGLRTFDEGDGITIFGSSNVWIDHLSMSR  734
             +QFVKNVII NL I  I A+ GG IRDSA H G RT  +GDGI+IFGSSNVWIDH+SMS 
Sbjct  180   IQFVKNVIIHNLHIHDIVASGGGNIRDSADHVGFRTKSDGDGISIFGSSNVWIDHVSMSN  239

Query  733   CEDGIIDAVKGSTAVTISNCHFTDHSKVLLFGANNWDPIDKVMQITVAFNHFGKRLEQRM  554
             C+DG+IDA+ GSTA+TISNCHFT H++    G N+        QI               
Sbjct  240   CQDGLIDAIMGSTAITISNCHFTHHNES---GFNSMHTSKFRGQI---------------  281

Query  553   PRCRWGLFHIINNDYTHWEMYAVGGSAGSTIISQGNRYIAPPGPSYFKEITHRDW-PNDE  377
                 WG FH++NNDYTHW MYA+GGS   TIISQGNR+IAPP  +  K++T RD+ P  E
Sbjct  282   ----WGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNDAA-KQVTKRDYAPESE  336

Query  376   WKGWTWVSDRDEFVNDAFFTPSGDPQGAVKYGRLDLLDPMPSSHAGKITRFAGALSCKYG  197
             WK W W S+ D  +N AFF  SG      ++ RLD++   P +   ++TR+AG L C  G
Sbjct  337   WKNWQWRSEGDLLMNGAFFVQSGKRLSKRRFSRLDMIKYKPGTFVTRLTRYAGTLLCGVG  396

Query  196   KPC  188
             +PC
Sbjct  397   RPC  399



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4838741935674