BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13976_g2_i1 len=903 path=[1639:0-902]

Length=903
                                                                      Score     E

dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     356   6e-118   Ipomoea nil [qian niu]
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    279   5e-88    
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    277   2e-87    
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative           276   4e-87    
ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        275   4e-86    
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                   268   1e-83    
gb|KDP32333.1|  hypothetical protein JCGZ_13258                         265   8e-83    
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative           258   9e-80    Ricinus communis
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    255   9e-79    
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    254   1e-78    
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    254   2e-78    
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                          254   2e-78    Nicotiana tabacum [American tobacco]
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative           254   3e-78    Ricinus communis
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg             253   3e-78    
dbj|BAG48321.1|  gibberellin 3-oxidase2                                 253   3e-78    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                   254   3e-78    
ref|XP_006356177.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    253   5e-78    
gb|AGN95009.1|  gibberellin 3-beta-dioxygenase                          250   3e-77    
gb|ACN89834.1|  gibberellin 3-oxidase                                   251   4e-77    Solanum tuberosum subsp. andigenum
gb|ACN89835.1|  gibberellin 3-oxidase                                   251   5e-77    Solanum tuberosum subsp. andigenum
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    250   6e-77    
gb|ACF71491.1|  gibberellin 3-beta hydroxylase                          249   1e-76    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010249916.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    250   1e-76    
dbj|BAD91162.1|  gibberellin 3-beta hydroxylase                         250   1e-76    Prunus subhirtella [Higan cherry]
ref|XP_008228615.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        250   1e-76    
gb|AHC32022.1|  gibberellin 3-oxidase 1                                 249   2e-76    
gb|AAR12160.1|  gibberellin 3-oxidase                                   249   2e-76    Populus tremula x Populus tremuloides
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    249   2e-76    
ref|XP_002303276.1|  gibberellin 3-beta-hydroxylase family protein      249   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_007215556.1|  hypothetical protein PRUPE_ppa007336mg             249   3e-76    
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   3e-76    
gb|ABO70984.1|  gibberellin 3-oxidase 2                                 248   4e-76    Nicotiana tabacum [American tobacco]
gb|AEK70424.1|  GA3ox2                                                  248   5e-76    
gb|ABG46320.1|  gibberellin 3-oxidase 1                                 248   5e-76    Rumex palustris
ref|NP_001233848.1|  3b-hydroxylase                                     248   5e-76    
gb|ACT99991.1|  gibberellin 3-oxidase                                   248   6e-76    
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   6e-76    
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   6e-76    
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   6e-76    
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                       248   6e-76    Nicotiana sylvestris
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                           247   9e-76    Lactuca sativa [cultivated lettuce]
dbj|BAD30036.1|  gibberellin 3beta-hydroxylase2                         247   1e-75    Daucus carota [carrots]
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                   247   1e-75    
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    247   1e-75    
dbj|BAG48320.1|  gibberellin 3-oxidase1                                 246   2e-75    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEW67998.1|  gibberellin 3 oxidase 1                                 246   3e-75    
gb|ABB00360.1|  gibberellin 3-oxidase                                   246   4e-75    Fragaria x ananassa
ref|NP_001233855.1|  3b-hydroxylase                                     245   6e-75    
gb|EYU21574.1|  hypothetical protein MIMGU_mgv1a017804mg                246   6e-75    
dbj|BAG32267.1|  gibberellin 3-oxidase                                  245   8e-75    Allium fistulosum [Japanese bunching onion]
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    245   8e-75    
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    245   8e-75    
ref|XP_008377587.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        245   1e-74    
gb|AFS18537.1|  gibberellin 3-oxidase                                   245   1e-74    
ref|XP_008804067.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    244   1e-74    
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    244   1e-74    
gb|AEK70423.1|  GA3ox1                                                  244   2e-74    
ref|XP_011039983.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    247   2e-74    
emb|CDP18939.1|  unnamed protein product                                244   2e-74    
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg             243   3e-74    
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein          243   3e-74    
ref|NP_001275108.1|  gibberellin 3-beta-hydroxylase 1                   243   5e-74    
ref|XP_010476647.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        243   5e-74    
ref|XP_011081703.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    243   6e-74    
ref|XP_007024019.1|  Gibberellin 3-oxidase 1, putative                  243   6e-74    
ref|XP_010925284.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    242   8e-74    
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    243   8e-74    
emb|CAN80137.1|  hypothetical protein VITISV_028510                     242   1e-73    Vitis vinifera
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                     241   2e-73    Ipomoea nil [qian niu]
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein      241   2e-73    Populus trichocarpa [western balsam poplar]
ref|XP_002892873.1|  hypothetical protein ARALYDRAFT_471756             241   3e-73    
emb|CDX81720.1|  BnaC08g38810D                                          241   4e-73    
ref|NP_001269085.1|  uncharacterized protein LOC100265167               241   5e-73    
ref|XP_009117822.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    240   6e-73    
ref|NP_173008.1|  gibberellin 3-beta-dioxygenase 1                      240   7e-73    Arabidopsis thaliana [mouse-ear cress]
gb|AHC32023.1|  gibberellin 3-oxidase 2                                 240   7e-73    
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    240   8e-73    
ref|XP_006305164.1|  hypothetical protein CARUB_v10009532mg             239   2e-72    
gb|KDP37169.1|  hypothetical protein JCGZ_06225                         239   2e-72    
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        238   3e-72    
ref|XP_003543662.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    238   3e-72    
emb|CDY39663.1|  BnaC05g11920D                                          238   4e-72    
ref|XP_010459098.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    238   4e-72    
emb|CDY36572.1|  BnaA06g10250D                                          237   7e-72    
gb|AAN87570.1|  gibberellin 3-oxidase                                   238   8e-72    Spinacia oleracea
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    237   1e-71    
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    236   1e-71    
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    237   2e-71    
dbj|BAQ02990.1|  gibberellin 3-oxidase                                  236   2e-71    
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    236   2e-71    
ref|XP_010497240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    236   2e-71    
ref|XP_009108486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        236   2e-71    
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        236   2e-71    
ref|XP_007150692.1|  hypothetical protein PHAVU_005G173500g             236   2e-71    
dbj|BAJ65442.1|  gibberellin 3-oxidase                                  236   3e-71    
ref|XP_003546239.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    235   4e-71    
ref|NP_193900.1|  gibberellin 3-beta-dioxygenase 3                      235   4e-71    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28643.1|  unknown                                                 235   5e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CDX76441.1|  BnaA08g09590D                                          234   8e-71    
ref|XP_009148952.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        234   9e-71    
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                         233   2e-70    Daucus carota [carrots]
ref|XP_010691237.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    236   2e-70    
ref|XP_006416894.1|  hypothetical protein EUTSA_v10008008mg             234   2e-70    
gb|KDO80406.1|  hypothetical protein CISIN_1g043986mg                   228   2e-70    
ref|XP_010434144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        233   2e-70    
emb|CDY31424.1|  BnaC03g64000D                                          233   3e-70    
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...    233   5e-70    Pisum sativum [garden pea]
ref|XP_006451038.1|  hypothetical protein CICLE_v10010731mg             227   6e-70    
gb|KFK43811.1|  hypothetical protein AALP_AA1G176200                    232   6e-70    
ref|XP_007013765.1|  Gibberellin 3-oxidase 3, putative                  231   8e-70    
ref|XP_002869872.1|  gibberellin 3-oxidase 3                            231   9e-70    
dbj|BAM73280.1|  gibberellin 3 oxidase 1                                232   1e-69    
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                          232   1e-69    Pisum sativum [garden pea]
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg             231   1e-69    
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                    232   1e-69    Pisum sativum [garden pea]
ref|XP_010439443.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    231   2e-69    
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                          231   2e-69    Pisum sativum [garden pea]
ref|XP_002324270.1|  gibberellin 3 beta-hydroxylase family protein      230   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_008352044.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    230   3e-69    
ref|XP_010449018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    230   3e-69    
ref|XP_006413746.1|  hypothetical protein EUTSA_v10026853mg             230   4e-69    
gb|KCW53766.1|  hypothetical protein EUGRSUZ_J03019                     230   4e-69    
ref|XP_002887835.1|  predicted protein                                  230   5e-69    
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                    230   5e-69    
ref|XP_006285095.1|  hypothetical protein CARUB_v10006427mg             229   5e-69    
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                          229   8e-69    Lactuca sativa [cultivated lettuce]
ref|XP_008785607.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    229   2e-68    
ref|XP_011026517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    228   2e-68    
gb|KDO58203.1|  hypothetical protein CISIN_1g043985mg                   228   3e-68    
ref|XP_009355033.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    228   4e-68    
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    228   4e-68    
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    228   5e-68    
ref|NP_001267625.1|  gibberellin 3-beta-dioxygenase 1-like              227   8e-68    
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                          227   8e-68    Medicago falcata [sickle alfalfa]
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    226   2e-67    
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg             226   2e-67    
ref|XP_006382066.1|  gibberellin 3 beta-hydroxylase family protein      225   2e-67    
ref|XP_009372969.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    225   3e-67    
ref|XP_006465424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    225   3e-67    
gb|AGQ42612.1|  GA3ox3                                                  225   3e-67    
ref|XP_002284981.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        225   3e-67    Vitis vinifera
ref|XP_008461055.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    226   3e-67    
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                     225   4e-67    
ref|XP_004135830.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    224   9e-67    
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        224   9e-67    Vitis vinifera
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                          224   1e-66    Medicago sativa subsp. caerulea
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg             224   1e-66    
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    224   1e-66    
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g             224   1e-66    
ref|XP_008461056.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    224   2e-66    
emb|CDY38661.1|  BnaC02g23180D                                          223   2e-66    
ref|XP_011019738.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    223   2e-66    
ref|XP_003533057.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    224   2e-66    
ref|XP_004158763.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    224   2e-66    
gb|KHN47796.1|  Gibberellin 3-beta-dioxygenase 1                        223   2e-66    
gb|ADK71024.1|  gibberellin 3-beta-hydroxylase                          221   2e-66    
gb|KDP32294.1|  hypothetical protein JCGZ_13219                         223   2e-66    
ref|XP_008350339.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    220   2e-66    
ref|XP_009128433.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        223   2e-66    
emb|CAN73736.1|  hypothetical protein VITISV_025221                     224   3e-66    Vitis vinifera
gb|AGQ42610.1|  GA3ox2                                                  223   3e-66    
emb|CDY37589.1|  BnaA02g19810D                                          223   3e-66    
emb|CAC83089.1|  gibberellin 3-oxidase                                  223   3e-66    Cucurbita maxima [Boston marrow]
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    222   6e-66    
ref|XP_007227245.1|  hypothetical protein PRUPE_ppa018007mg             221   7e-66    
ref|XP_010049018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    221   8e-66    
ref|XP_010520599.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        222   1e-65    
ref|XP_002515599.1|  gibberellin 3-beta hydroxylase, putative           221   1e-65    Ricinus communis
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                          221   2e-65    Medicago sativa subsp. caerulea
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    221   2e-65    
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                          219   2e-65    
ref|XP_008387508.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    220   2e-65    
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                          217   3e-65    
dbj|BAD30035.1|  gibberellin 3beta-hydroxylase1                         219   5e-65    Daucus carota [carrots]
ref|XP_008347459.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    219   6e-65    
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                          217   7e-65    
ref|XP_009400517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    219   9e-65    
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    218   2e-64    
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    218   2e-64    
ref|XP_004136071.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    217   2e-64    
ref|XP_008337346.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    213   3e-64    
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                          215   4e-64    
gb|EPS71653.1|  gibberellin 3-oxidase                                   216   4e-64    
ref|XP_010670743.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    217   4e-64    
ref|XP_009385827.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    217   5e-64    
ref|XP_006829636.1|  hypothetical protein AMTR_s00122p00090120          217   5e-64    
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                          215   6e-64    
ref|XP_008219863.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    216   6e-64    
gb|ABI64150.1|  gibberellin 3-oxidase                                   216   1e-63    Pisum sativum [garden pea]
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    216   1e-63    
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                      215   2e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537951.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    216   2e-63    
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                          213   2e-63    
ref|XP_006450547.1|  hypothetical protein CICLE_v10010629mg             215   2e-63    
ref|XP_006476223.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    215   2e-63    
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                          213   4e-63    
gb|AAC83647.1|  gibberellin 3 beta-hydroxylase                          214   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161254.1|  hypothetical protein PHAVU_001G055000g             214   4e-63    
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                          213   5e-63    
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                          213   5e-63    
gb|AHW42464.1|  GA3ox2                                                  214   5e-63    
ref|XP_008445137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    214   6e-63    
ref|XP_008445138.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    214   6e-63    
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                          212   8e-63    
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                          212   8e-63    
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                          212   8e-63    
ref|XP_008356836.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    213   1e-62    
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                          211   1e-62    
gb|AHW42463.1|  GA3ox1                                                  213   1e-62    
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                          211   1e-62    
ref|XP_003550162.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    213   2e-62    
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg             213   2e-62    
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        212   2e-62    
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    213   2e-62    
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                          211   2e-62    
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    212   3e-62    
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                          210   3e-62    
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    212   3e-62    
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                          210   3e-62    
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                          210   4e-62    
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                          210   5e-62    
gb|EYU21920.1|  hypothetical protein MIMGU_mgv1a009050mg                211   6e-62    
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                          209   6e-62    
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                          209   6e-62    
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                          209   6e-62    
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                          209   6e-62    
ref|XP_003527798.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    211   7e-62    
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                          209   8e-62    
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                          209   9e-62    
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                          209   9e-62    
emb|CAX46400.1|  putative GA3OX protein                                 207   9e-62    Rosa lucieae [memorial rose]
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                          209   9e-62    
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                          209   1e-61    
ref|XP_003588693.1|  Gibberellin 3-beta-dioxygenase                     211   1e-61    
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                          208   1e-61    
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                          209   1e-61    
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                          209   1e-61    
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    210   1e-61    
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                          209   1e-61    
ref|XP_008461419.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    211   1e-61    
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                          209   2e-61    
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                          208   2e-61    
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                          207   3e-61    
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                          207   3e-61    
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                          207   3e-61    
ref|XP_004498636.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    210   3e-61    
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                          207   3e-61    
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                          207   4e-61    
ref|NP_001275523.1|  gibberellin 3-beta-dioxygenase 1-like              209   4e-61    
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                          207   4e-61    
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                          207   4e-61    
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                          207   4e-61    
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                          207   5e-61    
ref|XP_004158764.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    209   5e-61    
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                          207   6e-61    
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                          207   6e-61    
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                          207   7e-61    
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                          207   7e-61    
emb|CAH69705.1|  gibberellin 3-oxidase                                  208   7e-61    Phaseolus coccineus [scarlet runner bean]
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                          207   8e-61    
ref|XP_004136072.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    209   8e-61    
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                          207   9e-61    
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                          206   9e-61    
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                          206   9e-61    
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                          206   1e-60    
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    208   1e-60    
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                          206   1e-60    
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                   209   1e-60    
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                          206   1e-60    
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                          206   1e-60    
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                          206   1e-60    
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                          206   2e-60    
ref|NP_001274405.1|  gibberellin 3-beta-dioxygenase 1-like              207   2e-60    
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                          206   2e-60    
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                          205   2e-60    
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                          206   2e-60    
gb|KGN62899.1|  hypothetical protein Csa_2G379300                       207   3e-60    
ref|XP_010941486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    207   4e-60    
ref|XP_003522638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    206   4e-60    
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                          204   5e-60    
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                          204   6e-60    
emb|CAB92914.1|  gibberellin 3-beta-hydroxylase                         206   8e-60    
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                          203   1e-59    
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                          204   1e-59    
ref|NP_178149.1|  gibberellin 3-beta-dioxygenase 4                      205   2e-59    
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                          203   2e-59    
ref|XP_009396646.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    205   2e-59    
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                          203   2e-59    
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                          203   2e-59    
ref|XP_007137069.1|  hypothetical protein PHAVU_009G097100g             204   2e-59    
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    204   2e-59    
ref|XP_004291423.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    204   3e-59    
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    204   3e-59    
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    204   4e-59    
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    204   4e-59    
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    204   4e-59    
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    203   7e-59    
gb|ADM47338.1|  gibberellin 3-oxidase 2                                 204   9e-59    
ref|XP_002887836.1|  gibberellin 3-oxidase 4                            203   9e-59    
ref|XP_010472948.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        203   9e-59    
dbj|BAJ65443.1|  gibberellin 3-oxidase                                  197   1e-58    
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                          200   2e-58    
ref|XP_010417722.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    202   3e-58    
emb|CDY38660.1|  BnaC02g23190D                                          202   3e-58    
emb|CBL59327.1|  Gibberellin 3-oxidase                                  202   3e-58    
ref|XP_004240225.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    201   3e-58    
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        201   4e-58    
ref|XP_004292966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    201   4e-58    
ref|XP_006389781.1|  hypothetical protein EUTSA_v10019663mg             201   4e-58    
gb|ADM47339.1|  gibberellin 3-oxidase 3                                 201   5e-58    
ref|XP_006301563.1|  hypothetical protein CARUB_v10021997mg             200   1e-57    
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    200   1e-57    
ref|XP_007137070.1|  hypothetical protein PHAVU_009G097200g             200   1e-57    
ref|XP_004291424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    199   2e-57    
gb|AAF80661.1|AF074710_1  putative gibberellin 3 beta hydroxylase       199   2e-57    
emb|CDY37588.1|  BnaA02g19820D                                          199   4e-57    
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    198   5e-57    
ref|XP_010429980.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        198   6e-57    
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg             197   1e-56    
ref|XP_003544624.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    197   1e-56    
gb|ADK70967.1|  gibberellin 3-beta-hydroxylase                          195   4e-56    
gb|AFK49394.1|  unknown                                                 196   4e-56    
emb|CDP04846.1|  unnamed protein product                                194   2e-55    
gb|ADM47337.1|  gibberellin 3-oxidase 1                                 194   3e-55    
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                        189   6e-54    
dbj|BAB62073.1|  GA 3beta-hydroxylase                                   189   2e-53    
gb|ADE18861.1|  putative 2-oxoglutarate dependent dioxygenase           189   2e-53    
gb|EEC78618.1|  hypothetical protein OsI_18664                          189   3e-53    
ref|NP_001054798.1|  Os05g0178100                                       189   4e-53    
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                         184   2e-51    
ref|NP_001042186.1|  Os01g0177400                                       184   2e-51    
dbj|BAB17075.1|  GA 3beta-hydroxylase                                   184   2e-51    
dbj|BAB62072.1|  GA 3beta-hydroxylase                                   184   2e-51    
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    183   5e-51    
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    182   1e-50    
emb|CDM81908.1|  unnamed protein product                                182   1e-50    
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    181   2e-50    
ref|XP_003569638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    181   3e-50    
ref|XP_002455082.1|  hypothetical protein SORBIDRAFT_03g004020          181   5e-50    
gb|AAB64347.1|  gibberellin 2beta,3beta-hydroxylase                     180   5e-50    
gb|AAT49061.1|  GA 3-oxidase 2                                          180   8e-50    
emb|CDP19027.1|  unnamed protein product                                179   9e-50    
ref|XP_004968405.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    180   1e-49    
ref|NP_001266453.1|  GA 3-oxidase 1                                     180   1e-49    
gb|ABE97176.1|  putative gibberellin 3-beta-dioxygenase/gibberell...    177   3e-49    
ref|XP_002517539.1|  gibberellin 3-beta hydroxylase, putative           175   3e-49    
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                          178   4e-49    
gb|ADK70957.1|  gibberellin 3-beta-hydroxylase                          173   1e-48    
gb|ABY49031.1|  GA3-oxidase                                             173   3e-48    
gb|ABY49032.1|  GA3-oxidase                                             172   4e-48    
gb|ABY49025.1|  GA3-oxidase                                             172   6e-48    
gb|ABY49029.1|  GA3-oxidase                                             172   7e-48    
gb|ABY49024.1|  GA3-oxidase                                             172   9e-48    
gb|ABY49026.1|  GA3-oxidase                                             171   1e-47    
gb|ABY49028.1|  GA3-oxidase                                             171   1e-47    
ref|XP_004963513.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    174   2e-47    
gb|ABY49030.1|  GA3-oxidase                                             171   2e-47    
gb|ABY49023.1|  GA3-oxidase                                             170   3e-47    
gb|AAO22518.1|  GA4                                                     166   6e-47    
dbj|BAK06541.1|  predicted protein                                      171   3e-46    
dbj|BAB32734.1|  gibberellin-3-beta-hydroxylase                         164   4e-46    
gb|AAT49060.1|  GA 3-oxidase 1                                          171   4e-46    
ref|XP_002989203.1|  hypothetical protein SELMODRAFT_450793             169   8e-46    
ref|XP_002987280.1|  hypothetical protein SELMODRAFT_450789             169   9e-46    
gb|ABX10776.1|  gibberellin 3-oxidase-like protein                      169   9e-46    
gb|ABY49027.1|  GA3-oxidase                                             163   2e-44    
ref|XP_008647746.1|  PREDICTED: GA 3-oxidase 2 isoform X1               164   1e-43    
gb|KGN45323.1|  hypothetical protein Csa_7G435480                       159   2e-43    
ref|XP_010474519.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    157   2e-42    
ref|XP_009106760.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    155   2e-42    
ref|XP_002440702.1|  hypothetical protein SORBIDRAFT_09g005400          160   3e-42    
gb|KGN62901.1|  hypothetical protein Csa_2G379320                       154   1e-41    
ref|NP_001146525.1|  GA 3-oxidase 2                                     158   2e-41    
gb|EPS70010.1|  hypothetical protein M569_04751                         152   4e-41    
gb|ACG46320.1|  gibberellin 3-beta-dioxygenase 2-2                      155   3e-40    
gb|EEE62526.1|  hypothetical protein OsJ_17324                          149   7e-40    
gb|ACL54258.1|  unknown                                                 153   1e-39    
dbj|BAQ20604.1|  gibberellin 3 oxidase 1                                150   2e-38    
ref|XP_001768518.1|  predicted protein                                  149   6e-38    
ref|NP_001044707.1|  Os01g0832600                                       146   5e-37    
emb|CBI33966.3|  unnamed protein product                                142   2e-36    
gb|ADT91908.1|  GA3 oxidase-like protein                                137   3e-36    
gb|AAA85365.1|  ethylene-forming enzyme                                 142   5e-36    
ref|XP_010664126.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    142   5e-36    
ref|XP_002282580.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    142   5e-36    
ref|XP_001769181.1|  predicted protein                                  142   5e-36    
ref|XP_010664128.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    142   6e-36    
ref|XP_010664106.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    142   8e-36    
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like         142   2e-35    
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                       141   2e-35    
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like         141   3e-35    
gb|AFA35958.1|  gibberellin 3-oxidase                                   135   4e-35    
dbj|BAK04700.1|  predicted protein                                      140   4e-35    
ref|XP_006646452.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     141   4e-35    
dbj|BAC54041.1|  GA 3bete-hydroxylase                                   134   5e-35    
gb|EMT01311.1|  Gibberellin 20 oxidase 1                                140   5e-35    
emb|CBI30780.3|  unnamed protein product                                139   7e-35    
gb|KDP21182.1|  hypothetical protein JCGZ_21653                         140   8e-35    
gb|KCW79673.1|  hypothetical protein EUGRSUZ_C01027                     139   8e-35    
gb|EAY77129.1|  hypothetical protein OsI_05094                          140   1e-34    
ref|XP_002980524.1|  2-oxoacid dioxygenase                              140   1e-34    
gb|KCW79671.1|  hypothetical protein EUGRSUZ_C01023                     137   2e-34    
ref|XP_002269890.1|  PREDICTED: protein SRG1                            139   2e-34    
ref|XP_008805016.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    139   2e-34    
ref|NP_001183568.1|  hypothetical protein                               139   2e-34    
ref|NP_001045319.1|  Os01g0935400                                       139   2e-34    
ref|XP_002976797.1|  2-oxoacid dioxygenase                              139   2e-34    
ref|XP_004970458.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    139   3e-34    
ref|XP_002527641.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    138   3e-34    
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                       138   3e-34    
ref|NP_001149543.1|  LOC100283169                                       138   3e-34    
gb|ACF86013.1|  unknown                                                 137   4e-34    
ref|XP_001780360.1|  predicted protein                                  135   5e-34    
ref|XP_001774834.1|  predicted protein                                  136   6e-34    
ref|XP_004986102.1|  PREDICTED: S-norcoclaurine synthase 1-like         137   6e-34    
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                       137   6e-34    
ref|XP_002279610.1|  PREDICTED: S-norcoclaurine synthase 1-like         137   6e-34    
gb|KCW74258.1|  hypothetical protein EUGRSUZ_E02905                     135   6e-34    
dbj|BAG68572.1|  GA20 oxidase-like protein                              137   6e-34    
ref|XP_001774669.1|  predicted protein                                  137   6e-34    
ref|XP_006355570.1|  PREDICTED: protein SRG1-like                       137   7e-34    
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg             137   7e-34    
ref|XP_007039569.1|  S-norcoclaurine synthase 1, putative               137   8e-34    
emb|CBI30786.3|  unnamed protein product                                136   9e-34    
ref|XP_008673339.1|  PREDICTED: hypothetical protein isoform X2         138   9e-34    
ref|XP_010528915.1|  PREDICTED: protein SRG1                            137   9e-34    
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2            137   9e-34    
ref|XP_010050489.1|  PREDICTED: protein SRG1-like                       137   1e-33    
ref|XP_004984849.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     137   1e-33    
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1            137   1e-33    
gb|EMT22994.1|  Leucoanthocyanidin dioxygenase                          136   1e-33    
gb|KCW74243.1|  hypothetical protein EUGRSUZ_E02880                     135   1e-33    
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                       136   1e-33    
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                       136   1e-33    
gb|EMT22046.1|  Flavonol synthase/flavanone 3-hydroxylase               136   2e-33    
gb|KHN47359.1|  Protein SRG1                                            135   2e-33    
ref|XP_003542959.2|  PREDICTED: codeine O-demethylase-like              136   2e-33    
emb|CBI30787.3|  unnamed protein product                                134   2e-33    
ref|XP_003632980.1|  PREDICTED: protein SRG1-like                       136   2e-33    
ref|XP_006449602.1|  hypothetical protein CICLE_v10018344mg             136   2e-33    
emb|CBI30792.3|  unnamed protein product                                135   3e-33    
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                       135   3e-33    
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                       135   3e-33    
gb|ABX10773.1|  gibberellin 3-oxidase-like protein                      135   3e-33    
ref|XP_002271009.1|  PREDICTED: protein SRG1                            135   3e-33    
ref|XP_002300451.1|  SENESCENCE-RELATED GENE 1 family protein           135   4e-33    
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    135   4e-33    
emb|CBI30788.3|  unnamed protein product                                134   4e-33    
gb|KCW79675.1|  hypothetical protein EUGRSUZ_C01029                     134   4e-33    
ref|XP_008657097.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     135   4e-33    
emb|CBI30791.3|  unnamed protein product                                135   4e-33    
ref|XP_009419671.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    135   4e-33    
emb|CDM84843.1|  unnamed protein product                                135   4e-33    
ref|XP_006467560.1|  PREDICTED: protein SRG1-like                       135   5e-33    
gb|ABK24855.1|  unknown                                                 135   5e-33    
ref|XP_007159373.1|  hypothetical protein PHAVU_002G232800g             135   5e-33    
ref|XP_004310153.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    134   5e-33    
ref|XP_003632981.1|  PREDICTED: protein SRG1-like                       135   5e-33    
emb|CDY07746.1|  BnaA03g17650D                                          135   5e-33    
ref|XP_010920852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    135   5e-33    
gb|KHN06939.1|  Protein SRG1                                            135   6e-33    
ref|XP_009384795.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    135   6e-33    
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    135   6e-33    
emb|CAN62525.1|  hypothetical protein VITISV_002347                     135   6e-33    
ref|XP_002270474.1|  PREDICTED: protein SRG1                            134   6e-33    
ref|XP_010050492.1|  PREDICTED: protein SRG1-like                       134   7e-33    
gb|AHW42456.1|  GA2ox6                                                  135   7e-33    
ref|XP_002270514.1|  PREDICTED: protein SRG1-like                       134   8e-33    
ref|XP_009133236.1|  PREDICTED: protein SRG1-like                       134   9e-33    
ref|XP_010920851.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    134   9e-33    
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2            134   1e-32    
ref|XP_010655797.1|  PREDICTED: protein SRG1-like                       134   1e-32    
gb|AHW42452.1|  GA2ox2                                                  134   1e-32    
ref|XP_002464224.1|  hypothetical protein SORBIDRAFT_01g014550          134   1e-32    
ref|XP_002456585.1|  hypothetical protein SORBIDRAFT_03g038880          134   1e-32    
ref|XP_002270078.1|  PREDICTED: protein SRG1                            134   1e-32    
ref|XP_010034113.1|  PREDICTED: protein SRG1-like                       134   1e-32    
emb|CBI30782.3|  unnamed protein product                                134   1e-32    
ref|XP_008238358.1|  PREDICTED: S-norcoclaurine synthase 1-like         134   1e-32    
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2            134   1e-32    
ref|XP_009382431.1|  PREDICTED: S-norcoclaurine synthase 1-like         134   1e-32    
ref|XP_008784673.1|  PREDICTED: S-norcoclaurine synthase 1-like         134   1e-32    
ref|XP_008643721.1|  PREDICTED: LOC100283169 isoform X1                 134   1e-32    
ref|XP_003547191.1|  PREDICTED: protein SRG1-like                       134   1e-32    
gb|EPS62210.1|  gibberellin 20-oxidase                                  134   1e-32    
emb|CAN73448.1|  hypothetical protein VITISV_030816                     132   1e-32    
ref|XP_003631372.1|  PREDICTED: gibberellin 20 oxidase 1                134   2e-32    
ref|XP_002976806.1|  hypothetical protein SELMODRAFT_105948             134   2e-32    
gb|KHN04715.1|  Protein SRG1                                            133   2e-32    
ref|XP_003567249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    134   2e-32    
ref|XP_010104366.1|  S-norcoclaurine synthase 1                         134   2e-32    
ref|XP_009406925.1|  PREDICTED: protein SRG1-like                       133   2e-32    
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                       133   2e-32    
dbj|BAJ87886.1|  predicted protein                                      134   2e-32    
gb|AHW42458.1|  GA2ox8                                                  134   2e-32    



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 218/276 (79%), Gaps = 4/276 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKLRA RSP S  GYG V  S+ F+S+MW EGFTV G P  E AR+VWP+DYS FC VI
Sbjct  93   EQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSP-LEHARQVWPQDYSDFCSVI  151

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLS-SEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            + YQE+M+GLAEK+ +L+FKSLGLS  EDVEWF+P GL  ST + LQMN YPKCPDPTRA
Sbjct  152  DDYQEKMRGLAEKIAALMFKSLGLSPGEDVEWFEPNGLSNSTQAYLQMNWYPKCPDPTRA  211

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTD+S++T+LYQ+  +RGLQVY P+LNWVD++P+ DA+V+N+GDLM++ SNGRFK
Sbjct  212  MGLAQHTDTSLVTLLYQTSNIRGLQVYGPNLNWVDVKPISDAIVVNLGDLMQIISNGRFK  271

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+VS AH+RISV YF+G + +V+I P +KL K   FPMY+ +SW EYL +K+ YF
Sbjct  272  SVLHRAIVSEAHNRISVGYFFGSSKNVEISPSLKLIKGSEFPMYKPISWNEYLDIKNKYF  331

Query  716  FKSLEKVRFNPVAEEYNAITSGNEEAPLSSEVEEAR  823
             KSLE + FN   E+ NA+ SG +EAPL SEVE  +
Sbjct  332  NKSLEMIGFNSDVEKSNALASG-DEAPLGSEVEAIK  366



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 181/251 (72%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL--FCD  175
             QKL A RSPE  TGYG+   S  F+  MW EGFT++G P  + AR++WP +Y    FC 
Sbjct  103  NQKLLAGRSPEDFTGYGLPRISTFFSKLMWTEGFTILGSP-LDHARQLWPHEYDHINFCQ  161

Query  176  VIEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTR  355
            V+ +YQ+++KGLAEK++ L+F+SLGL+ ED+ WFKP    +S   +LQ+NSYP CPDP R
Sbjct  162  VMVEYQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNR  221

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            AMGLAPHTDSS++T LYQ +T  GLQVYR ++ WV + PV  A+V+ VGDLM++  NGRF
Sbjct  222  AMGLAPHTDSSLLTSLYQGNT-SGLQVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRF  280

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVY  712
            KS LHRA+V+N  HRIS AYFYGP  DVKI P VKL     P +Y+ ++W+EYL  K  +
Sbjct  281  KSALHRALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATH  340

Query  713  FFKSLEKVRFN  745
            F K++E +R++
Sbjct  341  FNKAIELIRYD  351



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 185/251 (74%), Gaps = 7/251 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL---FC  172
            +QKLRA RSPES +GYG   ++ NF+  MW EGFT++G P  E A ++WP+D S+   FC
Sbjct  96   DQKLRALRSPESFSGYGSAGNAANFSKLMWSEGFTIMGSP-VEHAAQLWPDDQSVQTHFC  154

Query  173  DVIEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDP  349
            DV+E+YQ++MKGL+ KL+ L+  SLGL  EDV+W  +P     +   +LQ+N YP CPDP
Sbjct  155  DVMEEYQKKMKGLSGKLIRLMLGSLGLDKEDVKWLNRPKRSSTNFPQVLQLNYYPVCPDP  214

Query  350  TRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNG  529
            TRAMGLAPHTD+S+ TVL Q D + GLQV++  + W+ ++P+  A+V+NVGDLM + SNG
Sbjct  215  TRAMGLAPHTDTSVFTVLNQCD-ISGLQVFQEGIGWMSVQPIPGALVVNVGDLMHILSNG  273

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKD  706
            RFK+ +HRAVV+  HHRIS+AYFYGP  DVKI P +KL  +D  P+Y+ ++WKEYL +K 
Sbjct  274  RFKTTIHRAVVNELHHRISIAYFYGPPYDVKISPLMKLIGQDHPPLYRPVTWKEYLGIKG  333

Query  707  VYFFKSLEKVR  739
             +F ++LE +R
Sbjct  334  THFNRALELIR  344



>ref|XP_007013295.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
 gb|EOY30914.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
Length=355

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 188/252 (75%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            E KL A RSPE  TGYG+   S  F+  MW EGF+++G P  E A ++WPED++ FC+V+
Sbjct  107  ESKLLAVRSPEGFTGYGLARISPFFSKLMWSEGFSIIGSP-VEHASQLWPEDHAKFCEVM  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLS-SEDVEWFKP--GGLPESTGSILQMNSYPKCPDPT  352
            E++QE+MK L+EK+V+++  SLGL+  EDV+WF+P   G  +ST  +LQ+NSYP CPDP 
Sbjct  166  EQFQEEMKALSEKMVAIMLSSLGLTHEEDVKWFEPMKEGCDQST-CVLQLNSYPVCPDPG  224

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDL-NWVDIEPVKDAVVINVGDLMELASNG  529
            RAMGLAPHTDSS++T+LYQ + + GLQV R D   W+ +EPV+ A+V+NVGDLM + SNG
Sbjct  225  RAMGLAPHTDSSVLTLLYQGN-ISGLQVQRDDAAGWMPVEPVEGALVVNVGDLMHIVSNG  283

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKD  706
            RFKS+LHRA+V+N HHR+S AYFYGP  D K+ P  KL ++D  P+Y+ ++WK+YL  K 
Sbjct  284  RFKSVLHRALVNNEHHRVSTAYFYGPPRDAKVSPLRKLIDRDHPPLYRPVTWKDYLEAKS  343

Query  707  VYFFKSLEKVRF  742
             +F K+LE +R 
Sbjct  344  KHFSKALESIRL  355



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKLRA RSPE  TGYG+   S+NF   MW EGFT++G P +E AR++WP  ++ FC  +
Sbjct  122  DQKLRALRSPEGVTGYGLARISKNFPMLMWSEGFTIMGSP-AEHARQLWPRHHANFCGAM  180

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++MKGLA KL+ L+  SLGL+ EDV+W KP        ++LQ+NSYP CPDPTRA+
Sbjct  181  EEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKNR-SGPRALLQLNSYPVCPDPTRAI  239

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDSS++T+L QS ++ GLQV    + WV + P+  A+V+NVGDLM + SNG+FKS
Sbjct  240  GLAPHTDSSLLTLLNQS-SISGLQVLLDGIRWVPVHPIPGALVVNVGDLMHILSNGQFKS  298

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
             +HRAVV+  HHRIS+AYFYGP +DVKI P +  N    P+Y+ ++WKEYL  K  +F K
Sbjct  299  AVHRAVVNEVHHRISMAYFYGPPMDVKISPLIDHNH---PLYRPVTWKEYLEYKATHFDK  355

Query  722  SLEKVR  739
            +LE +R
Sbjct  356  ALEVIR  361



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 181/253 (72%), Gaps = 6/253 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWP-EDYSLFCDV  178
            E+KLR  RS ES TGYG+VP S+ F   MW EGF++ G P  E AR++WP ED   FC V
Sbjct  107  ERKLRVVRSAESVTGYGLVPISKFFPKMMWSEGFSMTGSP-EEYARQLWPHEDCRQFCSV  165

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E YQ++MKGL+EKL+ L+ +SLG++ ED++W  P     S  ++LQ+NSYP CPDPTRA
Sbjct  166  MEMYQKEMKGLSEKLLELILRSLGVNYEDIKWANPKNGLSSYQALLQLNSYPVCPDPTRA  225

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRP-DLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            MGLAPHTDSS++TVLYQS    GLQV R  D+ WV +  V  A+++N+GDLM + SNGRF
Sbjct  226  MGLAPHTDSSLLTVLYQS--CMGLQVQRKEDIGWVPVHTVDGALIVNLGDLMHIMSNGRF  283

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVY  712
            KS +HRAVV+  HHR+SVAYF GP  + KI   +++  D  P MY+ ++WKEYL ++  +
Sbjct  284  KSAMHRAVVNKTHHRVSVAYFCGPPKEEKISSLIQMIDDDRPRMYRGVTWKEYLEIRAAH  343

Query  713  FFKSLEKVRFNPV  751
            F K+LE ++ N +
Sbjct  344  FDKALEFIKNNNI  356



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 181/248 (73%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL A RSP+  TGYG+   S   N ++W EGFT++G P ++ A + WP DY+ FCDV+
Sbjct  92   DQKLLAARSPDGLTGYGMARISSFLNKQLWFEGFTIIGSP-AQHASQFWPNDYTTFCDVV  150

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPEST-GSILQMNSYPKCPDPTRA  358
            E+YQ++MKGL+E+L+ L+FKSLGL+ EDV+WF      +    S+LQ+NSYP CP+  +A
Sbjct  151  EEYQKEMKGLSERLIGLMFKSLGLAQEDVKWFTTKSETQHQPQSVLQLNSYPICPEAGQA  210

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+++T+++Q++   GLQV+R    WV + PV  A+V+N+GDLM++ SNGRFK
Sbjct  211  MGLAPHTDSTLLTLVHQNNA-SGLQVFREGSGWVPVHPVDGALVVNIGDLMQILSNGRFK  269

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+  +HR SV +FYGP +D ++ P + L     P +Y+ +SWKEYL  K ++F
Sbjct  270  SVLHRAVVNETYHRTSVVHFYGPPMDAEVSPLMHLIDFDHPVLYRAVSWKEYLDAKKIHF  329

Query  716  FKSLEKVR  739
             K+L+ ++
Sbjct  330  DKTLDFIK  337



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 172/246 (70%), Gaps = 3/246 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL A RSP   TGYG    S  F   MW EGFT++G P +E A ++WP   + FCD ++
Sbjct  104  QKLLAARSPGGLTGYGRARISDFFKREMWYEGFTIMGSP-AEHASQLWPNQDTSFCDAVK  162

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++MKGL+E+++ L+FKSLGL  EDV++       +     LQ+NSYPKCPDP RAMG
Sbjct  163  AYQKEMKGLSERIIGLMFKSLGLIEEDVKFLGLKDESQYPQGALQLNSYPKCPDPDRAMG  222

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTDSS+ITVL+Q D + GLQV++  + W+ + PV  A+V+N+GDLM + SNGRFK  
Sbjct  223  LAPHTDSSLITVLHQ-DGVSGLQVFKDGIGWMPVCPVDGALVVNIGDLMHIISNGRFKCA  281

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
             H+AVV+  HHRISVAYFYGP  DVKI P ++L     P +Y+ ++WKEYL  K +YF K
Sbjct  282  QHQAVVNKTHHRISVAYFYGPPGDVKISPLMQLVDFDHPVLYRPVTWKEYLDAKTIYFDK  341

Query  722  SLEKVR  739
            +L+ ++
Sbjct  342  ALDFIK  347



>ref|XP_009771250.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
 gb|AAM12873.1|AF494090_1 gibberellin 3-oxidase 2 [Nicotiana sylvestris]
Length=370

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 180/268 (67%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  TGYG+   S  F+  MW EGFT+VG P  E AR++WP+DY  FCD I
Sbjct  105  QQKLKAARSPDGVTGYGVARISSFFSKLMWSEGFTIVGSP-LEHARQIWPQDYKKFCDAI  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+ +M+ LA +L+ L+  SLG++ EDV W   P G  +   + LQ+NSYP CPDP RA
Sbjct  164  EEYEREMEKLAGRLMWLMLGSLGITKEDVNWAVGPKGESKGGSAALQLNSYPACPDPDRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQV++    WV + P   A+V+NVGDL+ + SNG + 
Sbjct  224  MGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPFLGALVVNVGDLLHILSNGSYP  282

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP   VKI P  KL ++   P+Y+ ++W EYL  K  +F
Sbjct  283  SVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLAKLVDQRHPPLYRAITWSEYLGTKAKHF  342

Query  716  FKSLEKVRF-NPV-----AEEYNAITSG  781
             K+L  VR   P+     A+++N +  G
Sbjct  343  DKALSSVRLCAPLTGFADAKDHNGVQVG  370



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 178/246 (72%), Gaps = 9/246 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKLR  RSP+  +GYG    S NF   MW EGF+++G P  E AR++WP  ++ FC+V+
Sbjct  93   DQKLRVLRSPDGFSGYGSARISDNFPKLMWSEGFSMMGSP-LEHARQLWPRHHANFCNVM  151

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++MKGLA KL+ L+ +SLGL++EDV+W           S+LQ+NSYP CPDPTRAM
Sbjct  152  EEYQKEMKGLAAKLIELMLRSLGLNNEDVKWLT------HPQSLLQLNSYPVCPDPTRAM  205

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDSS++T+LYQ+ T  GLQV    ++W  + P   A+V+NVGDLM + SNG FKS
Sbjct  206  GLAPHTDSSLLTLLYQTTT-GGLQVLVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKS  264

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            ++HRA+V+  HHRIS+AYFYGP  DVKI P +KL  D  P+YQ ++WKEYL  K  +F K
Sbjct  265  VVHRAIVNKVHHRISIAYFYGPPWDVKISPLMKLT-DHPPLYQPVTWKEYLGYKATHFNK  323

Query  722  SLEKVR  739
            +LE +R
Sbjct  324  ALELIR  329



>ref|XP_009588350.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 180/268 (67%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSPE  TGYG+   S  F+  MW EGFT+VG P  E AR++WP DY  FCDVI
Sbjct  106  HQKLKAARSPEGVTGYGVARISSFFSKLMWSEGFTIVGSP-LEHARQIWPHDYQKFCDVI  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+ +M+ LA +L+ L+  SLG++ E+V+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  165  EEYEREMEKLAGRLMWLMLGSLGITKEEVKWAVCPKGESKGGSAALQLNSYPACPDPDRA  224

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQV++    WV + P   A+V+NVGDL+ + SNG + 
Sbjct  225  MGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPFPGALVVNVGDLLHILSNGLYP  283

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP   VK+ P  KL ++   P+Y+ ++W EYL  K  +F
Sbjct  284  SVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPLAKLVDQRHPPLYRAVTWSEYLGTKAKHF  343

Query  716  FKSLEKVRF-NPV-----AEEYNAITSG  781
             K+L  VR   P+     A+++N +  G
Sbjct  344  DKALSSVRLCAPISGFADAKDHNGVQVG  371



>dbj|BAA89316.1| gibberellin 3beta-hydroxylase [Nicotiana tabacum]
Length=371

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 181/268 (68%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSPE  TGYG+   S  F+  MW EGFT+VG P  E AR++WP DY  FCDVI
Sbjct  106  QQKLKAARSPEGVTGYGVARISSFFSKLMWSEGFTIVGSP-LEHARQIWPHDYQKFCDVI  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+ +M+ LA +L+ L+  SLG++ E+V+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  165  EEYEREMEKLAGRLMWLMLGSLGITKEEVKWAVCPKGESKGGSAALQLNSYPACPDPDRA  224

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQV++    WV + P   A+V+NVGDL+ + SNG + 
Sbjct  225  MGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPFPGALVVNVGDLLHILSNGLYP  283

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP   VK+ P  KL ++   P+Y+ ++W EYL  K  +F
Sbjct  284  SVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPLAKLVDQRHPPLYRAVTWSEYLGTKARHF  343

Query  716  FKSLEKVRF-NPV-----AEEYNAITSG  781
             K+L  VR   P+     A+++N +  G
Sbjct  344  DKALSSVRLCAPLSGFTDAKDHNGVQVG  371



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 171/246 (70%), Gaps = 3/246 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL A RSP   TGYG    S  F   MW EGFT++G P +E A ++WP   + FC+V+E
Sbjct  104  QKLLAARSPGGLTGYGRARISDFFTREMWYEGFTIMGSP-AEHASQLWPNQDTSFCNVME  162

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
              Q++MKGL+E+++ ++FKSLGL+ EDV++       +     LQ+NSYPKCPDP RAMG
Sbjct  163  ACQKEMKGLSERIIGIMFKSLGLNEEDVKFLGLKDGSQYPQGALQLNSYPKCPDPDRAMG  222

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTDSS+ITVL+Q   + GLQV++  + WV + PV DA+V+N+GDLM + SNGRFK  
Sbjct  223  LAPHTDSSLITVLHQGG-VSGLQVFKEGIGWVPVSPVDDALVVNIGDLMHIISNGRFKCA  281

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
             H+AVV+   HRISVAYFYGP  DVKI P ++L     P +Y  ++WKEYL  K +YF K
Sbjct  282  QHQAVVNKTRHRISVAYFYGPPGDVKISPLMQLVDFDHPVLYCPVTWKEYLDAKAIYFDK  341

Query  722  SLEKVR  739
            +L+ ++
Sbjct  342  ALDFIK  347



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 179/247 (72%), Gaps = 9/247 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKLR  RSP+  TGYG    S NF   MW EGF+++G P  E AR++WP  ++ FC+V+
Sbjct  94   DQKLRVLRSPDGFTGYGSARISDNFPKLMWSEGFSMMGSP-LEHARQLWPLHHANFCNVM  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ +MKGLA KL+ L+ +SLGL++EDV+W +         S+LQ+NSYP CPDPTRAM
Sbjct  153  EEYQMEMKGLAAKLIELMLRSLGLNNEDVKWLR------HPRSLLQLNSYPVCPDPTRAM  206

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDSS++T+LYQ+ T  GLQV    ++W  + P   A+V+NVGDLM + SNG FKS
Sbjct  207  GLAPHTDSSLLTLLYQTTT-GGLQVLVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKS  265

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++HRA+V+  HHRIS+AYFYGP  DVKI P +KL + +  P+YQ ++WKEYL  K  +F 
Sbjct  266  VVHRAIVNKVHHRISIAYFYGPPWDVKISPLMKLIDHNHPPLYQPVTWKEYLGYKATHFN  325

Query  719  KSLEKVR  739
            K+LE +R
Sbjct  326  KALELIR  332



>dbj|BAG48321.1| gibberellin 3-oxidase2 [Chrysanthemum x morifolium]
Length=358

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 172/249 (69%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R+P+  +GYG V  S  F+  MW EGFT++G P  E A+++WP DY  FC+V+
Sbjct  94   QQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTIIGSP-YEHAKKLWPHDYKNFCEVV  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y ++MK L  +L+ L+  SLG++  DV+W  P G  +     LQ+NSYP CPDP RAM
Sbjct  153  DEYNKEMKKLTNRLMWLVLGSLGITEGDVKWAGPAGDLKEACPALQLNSYPACPDPDRAM  212

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS++T+L+Q++T  GLQV R  + WV + P+K A+V++VGDL+ + SNG + S
Sbjct  213  GLAAHTDSSLLTILHQNNT-SGLQVQREGMGWVTVPPIKGALVVHVGDLLHILSNGLYSS  271

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR S+AY YGP  +V+I P  KL      P+YQ ++W EYLA+K  YF 
Sbjct  272  VLHRAIVNRTQHRFSIAYLYGPPSNVRISPLSKLTSIVRPPLYQPVTWSEYLAIKAKYFN  331

Query  719  KSLEKVRFN  745
            K+L  VR +
Sbjct  332  KTLSVVRLS  340



>ref|XP_010110310.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC25830.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=372

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 171/252 (68%), Gaps = 4/252 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DYS FCDVI
Sbjct  108  QQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFTIVGSPVDHF-RQLWPQDYSKFCDVI  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ ++K LA +L+ L+  SLG+S  D++W  P G  +   + LQ+NSYP CPDP RAM
Sbjct  167  EEYEAEVKRLAGRLMWLMLGSLGISRADIKWAGPKGNFKGASAALQLNSYPACPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ+ T  GLQV R    WV + P+  A V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQNST-SGLQVLREGTGWVTVPPIHGAFVVNVGDLLHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY YGP   VKI P  +L   G  P+Y+ ++W EYL  K  +F 
Sbjct  286  VLHRAVVNRTRHRLSIAYLYGPPSSVKISPLPRLVGPGQPPLYRPITWTEYLGTKAKHFN  345

Query  719  KSLEKVR-FNPV  751
            K+L  VR F+PV
Sbjct  346  KALSSVRVFSPV  357



>ref|XP_006356177.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=372

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 183/268 (68%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  TGYG+   S  F+  MW EGFT+VG P  E AR++WP+DY  FC+VI
Sbjct  107  QQKLKAARSPDGVTGYGVARISSFFSKLMWSEGFTIVGSP-IEHARQLWPKDYKKFCEVI  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+++M+ LA +L+ L+  SLG++ +DV+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  166  EEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACPDPGRA  225

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQVY+    WV + P+  A+V+NVGDL+ + SNG + 
Sbjct  226  MGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWVTVPPIPGALVVNVGDLLHILSNGSYP  284

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP   V++ P  K L+    P+Y+ ++W EYL  K  YF
Sbjct  285  SVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPLSKLLDHRHPPLYRAVTWSEYLGTKAKYF  344

Query  716  FKSLEKVRFN-PV-----AEEYNAITSG  781
             K+L  VR   P+     A+++N +  G
Sbjct  345  DKALSSVRLCVPLSGFADAKDHNGVQVG  372



>gb|AGN95009.1| gibberellin 3-beta-dioxygenase, partial [Prunus salicina]
Length=331

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 169/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY+ FC++I
Sbjct  87   QQKLKAARSPDGISGYGFARISSFFQKLMWSEGFTIVGSPLDHF-RQLWPQDYNKFCNII  145

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S EDV+W  P G      + LQ+NSYP CPDP RAM
Sbjct  146  EEYEKEMKKLAGRLMWLMLGSLGISKEDVKWAGPKGDFRDASAALQLNSYPACPDPDRAM  205

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  206  GLAAHTDSTLLTILYQNNT-SGLQVLREGTRWVTVPPLPGALVVNVGDLIHILSNGLYPS  264

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+ + HR+S+AY YGP   V+I P  K L     P+Y+ ++W EYL  K  +F 
Sbjct  265  VLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSKLLGPSQPPLYRPITWNEYLGTKAKHFN  324

Query  719  KSLEKVR  739
            K+L  VR
Sbjct  325  KALSSVR  331



>gb|ACN89834.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=356

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 170/248 (69%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+ G P  E AR++WP +Y+ FCDVI
Sbjct  95   QQKLKAARSSDGIAGYGVARISSFFSKLMWSEGFTIFGSP-LEHARQLWPHNYNKFCDVI  153

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +M+ LA  L+ L+  SLG++ EDV+W      P S  S LQ+NSYP CPDP RAM
Sbjct  154  EEYENEMEKLAGTLMGLMLGSLGITKEDVKWAVG---PRSGCSALQLNSYPACPDPDRAM  210

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+I+T+L+Q++T  GLQV+R    WV + P++ A+VINVGDL+ + SNG + S
Sbjct  211  GLAAHTDSTILTILHQNNT-SGLQVFREGNGWVTVPPLRGALVINVGDLLHILSNGLYPS  269

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP   VKI P  KL ++   PMY+ ++W EYL  K  +F 
Sbjct  270  VLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFD  329

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  330  KALSSVRL  337



>gb|ACN89835.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=372

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 182/268 (68%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  TGYG    S  F+  MW EGFT+VG P  E AR++WP+DY  FC+VI
Sbjct  107  QQKLKAARSPDGVTGYGAAQISSLFSKLMWSEGFTIVGSP-IEHARQLWPKDYKKFCEVI  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+++M+ LA +L+ L+  SLG++ ++V+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  166  EEYEKEMEKLAGRLMWLILGSLGITKDEVKWAVGPKGETKEGCAALQLNSYPACPDPGRA  225

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQVY+    WV + P+  A+V+NVGDL+ + SNG + 
Sbjct  226  MGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWVTVPPIPGALVVNVGDLLHILSNGSYP  284

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP   V++ P  K L+    P+Y+ ++W EYL  K  YF
Sbjct  285  SVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPLSKLLDHRHPPLYRAVTWSEYLGTKAKYF  344

Query  716  FKSLEKVRFN-PV-----AEEYNAITSG  781
             K+L  VR   P+     A+++N +  G
Sbjct  345  DKALSSVRLCVPLSGFADAKDHNGVQVG  372



>ref|XP_006341659.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=356

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 170/248 (69%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+ G P  E AR++WP +Y+ FCDVI
Sbjct  95   QQKLKAARSSDGIAGYGVARISSFFSKLMWSEGFTIFGSP-LEHARQLWPHNYNKFCDVI  153

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +M+ LA +L+ L+  SLG++ EDV+W      P S  S LQ+NSYP CPDP RAM
Sbjct  154  EEYENEMEKLAGRLMGLMLGSLGITKEDVKWAVG---PRSGCSALQLNSYPACPDPDRAM  210

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+I+T+L+Q++T  GLQV+R    WV + P+  A+VINVGDL+ + SNG + S
Sbjct  211  GLAAHTDSTILTILHQNNT-SGLQVFREGNGWVTVPPLCGALVINVGDLLHILSNGLYPS  269

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP   VKI P  KL ++   PMY+ ++W EYL  K  +F 
Sbjct  270  VLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFD  329

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  330  KALSSVRL  337



>gb|ACF71491.1| gibberellin 3-beta hydroxylase [Chrysanthemum x morifolium]
Length=358

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 173/249 (69%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R+P+  +GYG V  S  F+  MW EGFT++G P  E A+++WP+DY  FC V+
Sbjct  94   QQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTIIGSP-YEHAKKLWPQDYKNFCVVV  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y ++MK L  +L+ L+  SLG++  DV+W +     +     LQ+NSYP CPDP RAM
Sbjct  153  DEYNKEMKKLTNRLMWLVLGSLGITEGDVKWARQTRDTKEACPALQLNSYPACPDPDRAM  212

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS++T+L+Q++T  GLQV R  + WV + P+K A+V++VGDL+ + SNG + S
Sbjct  213  GLAAHTDSSLLTILHQNNT-SGLQVQREGMGWVTVPPIKGALVVHVGDLLHILSNGLYSS  271

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+ A HR+S+AY YGP  +V+I P  KL      P+YQ ++W EYLA+K  YF 
Sbjct  272  VLHRAIVNRAQHRLSIAYIYGPPSNVRISPLSKLTSIVRPPLYQPVTWSEYLAIKAKYFN  331

Query  719  KSLEKVRFN  745
            K+L  VR +
Sbjct  332  KTLSIVRLS  340



>ref|XP_010249916.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=378

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 176/255 (69%), Gaps = 7/255 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A R P+  +GYG+   S  F   MW EGFT+VG P  E AR++WP DYS FCDV+
Sbjct  111  HQKLKAARPPDGISGYGLARISSFFPKLMWSEGFTIVGSP-VEHARQLWPLDYSNFCDVM  169

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTG--SILQMNSYPKCPDPTR  355
            E+Y+++MK LA +L+ L+  SLG+S +D++W       ES G  + LQ+NSYP CPDP+R
Sbjct  170  EEYEKEMKQLAGRLMWLMLGSLGISKDDIKWAAAASKGESGGVCAALQLNSYPACPDPSR  229

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDL-NWVDIEPVKDAVVINVGDLMELASNGR  532
            AMGLA HTDS+++TVLYQ+ T  GLQV R     WV + P++ A+V+NVGDL+ + SNG+
Sbjct  230  AMGLAAHTDSTLLTVLYQNST-SGLQVLRDGAAGWVTVPPLRGALVVNVGDLLHILSNGK  288

Query  533  FKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDV  709
            + S+LHRA+V+  HHR+SVAY YGP  + +I P   L + +  P+Y+ ++W EYL  K  
Sbjct  289  YPSVLHRAIVNRTHHRLSVAYLYGPPTNAQISPISSLVDPNHPPLYRPVTWAEYLGTKAK  348

Query  710  YFFKSLEKVRF-NPV  751
            +F K+L  VR  NPV
Sbjct  349  HFNKALSSVRLCNPV  363



>dbj|BAD91162.1| gibberellin 3-beta hydroxylase [Prunus subhirtella]
Length=372

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 168/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY+ FC++I
Sbjct  108  QQKLKAARSPDGISGYGFARISSFFQKLMWSEGFTIVGSPLDHF-RQLWPQDYNKFCNII  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y++ MK LA +L+ L+  SLG+S EDV+W  P G      + LQ+NSYP CPDP RAM
Sbjct  167  EEYEKVMKRLAGRLMWLMLGSLGISMEDVKWAGPKGDFRDASAALQLNSYPACPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQNNT-SGLQVLREGTGWVTVPPLPGALVVNVGDLIHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+ + HR+S+AY YGP   V+I P  K L     P+Y+ ++W EYL  K  +F 
Sbjct  286  VLHRAVVNRSRHRLSIAYLYGPPASVQISPLSKLLGPSQPPLYRPITWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_008228615.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Prunus mume]
Length=372

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 168/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY+ FC++I
Sbjct  108  HQKLKAARSPDGISGYGFARISSFFQKLMWSEGFTIVGSPLDHF-RQLWPQDYNKFCNII  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S EDV+W  P G      + LQ+NSYP CPDP RAM
Sbjct  167  EEYEKEMKRLAGRLMWLMLGSLGISMEDVKWAGPRGDFRDASAALQLNSYPACPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQNNT-SGLQVLREGTGWVTVPPLPGALVVNVGDLIHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+ + HR+S+AY YGP   V+I P  K L     P+Y+ ++W EYL  K  +F 
Sbjct  286  VLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSKLLGPSQPPLYRPITWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>gb|AHC32022.1| gibberellin 3-oxidase 1 [Camellia sinensis]
Length=361

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 172/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSPE  +GYG+   S  F   MW EGFT+ G P  E A ++WP+DYS FCDVI
Sbjct  109  QQKLKAARSPEGVSGYGVARISPFFPKLMWSEGFTIFGSP-LEHACQLWPQDYSNFCDVI  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SL +S EDV+W  P G  +   + +Q+NSYP CP+P RAM
Sbjct  168  EEYEKEMKILARRLMWLMLGSLDISKEDVKWAGPKGDFKGANAAVQLNSYPACPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GL+V+R    WV + P+ D +V+N+GDL+ + SNG + S
Sbjct  228  GLAAHTDSTLLTILYQNNT-SGLEVHRDGYGWVTVPPIPDTLVVNIGDLLHILSNGLYPS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP  +V+I P  KL +    P+Y+ ++W EYL  K  YF 
Sbjct  287  VLHRAMVNRTRHRLSVAYLYGPPPNVQISPLSKLVDLTHPPLYRPVTWTEYLGTKAKYFD  346

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  347  KALSSVRL  354



>gb|AAR12160.1| gibberellin 3-oxidase [Populus tremula x Populus tremuloides]
Length=373

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 171/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E  R++WP+DY+ FCDVI
Sbjct  109  QQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFTIVGSP-LEHFRQLWPQDYTKFCDVI  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++++M+ LA +L  L+  SLG++ +D+ W  P G  +  G+ LQ+NSYP CPDP  AM
Sbjct  168  EEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPACPDPDLAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV +  + WV + P+   +V+NVGDL+ + SNG + S
Sbjct  228  GLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY YGP   V+I P  KL   +  P+Y+ ++W EYL  K  +F 
Sbjct  287  VLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQKLVGPNHPPLYRPITWNEYLVAKAKHFN  346

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  347  KALSSVRI  354



>ref|XP_010254240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=352

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 171/247 (69%), Gaps = 4/247 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+  RSP+  TGYG+   S  +   +W EGFT+ G P  E AR++WP+DY+ FCDVIE
Sbjct  106  QKLKTLRSPDGFTGYGLANHSSFYPKLLWSEGFTIFGSP-VEHARQLWPQDYTNFCDVIE  164

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +YQ++M  L+ +L  LL  SLGL+++D+EW    G      S L++NSYP CP+PTRAMG
Sbjct  165  EYQKEMSKLSGRLTVLLLNSLGLTTDDLEWVGATGEINGARSALRLNSYPPCPEPTRAMG  224

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTDSS+ TV+YQ+ T  GLQV    + WV + PV  A+V+NVGD++ + SNGRF S 
Sbjct  225  LAPHTDSSLFTVIYQNGT-TGLQVSVEGVGWVTVRPVTGALVVNVGDILHIISNGRFVSS  283

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNK--DGFPMYQTLSWKEYLAVKDVYFF  718
            +HRAVV  A HR+S+A+FYGP ++ ++ P  KL    D   +Y+T++ +EYLA+K  +F 
Sbjct  284  VHRAVVDRAQHRLSIAHFYGPPVNAQLSPAKKLVDPPDHPILYRTVTSQEYLAIKAKHFD  343

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  344  KALALIR  350



>ref|XP_002303276.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE78255.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=373

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 171/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E  R++WP+DY+ FCDVI
Sbjct  109  QQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFTIVGSP-LEHFRQLWPQDYTKFCDVI  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++++M+ LA +L  L+  SLG++ +D+ W  P G  +  G+ LQ+NSYP CPDP  AM
Sbjct  168  EEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPACPDPDLAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV +  + WV + P+   +V+NVGDL+ + SNG + S
Sbjct  228  GLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY YGP   V+I P  KL   +  P+Y+ ++W EYL  K  +F 
Sbjct  287  VLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQKLVGPNHPPLYRPITWNEYLVAKAKHFN  346

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  347  KALSSVRI  354



>ref|XP_007215556.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
 gb|EMJ16755.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
Length=372

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 169/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY+ FC++I
Sbjct  108  QQKLKAARSPDGISGYGFARISSFFQKLMWSEGFTIVGSPLDHF-RQLWPQDYNKFCNII  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S EDV+W  P G      + LQ+NSYP CPDP RAM
Sbjct  167  EEYEKEMKKLAGRLMWLMLGSLGISKEDVKWAGPKGDFRDASAALQLNSYPACPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQNNT-SGLQVLREGTRWVTVPPLPGALVVNVGDLIHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LH+AVV+ + HR+S+AY YGP   V+I P  K L     P+Y+ ++W EYL  K  +F 
Sbjct  286  VLHQAVVNRSRHRLSIAYLYGPPDSVQISPLSKLLGPSQPPLYRPITWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 174/249 (70%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R  +  +GYGI   S  F   MW EGFT+VG P  E  R++WP+DY+ FC ++
Sbjct  105  QQKLKAARPADGISGYGIHRISSFFQKLMWSEGFTLVGSP-LEHFRQLWPQDYNKFCCMV  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +MK LA +L+ L+F SLG+S EDV W  P G  E   + LQ+NSYP CPDP+RAM
Sbjct  164  EEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGGFEDASNALQLNSYPACPDPSRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+++QS+ + GLQV R    W+ + PV  A+VIN+GDL+ + SNG +++
Sbjct  224  GLAEHTDSTLLTIIHQSN-ISGLQVLREGAGWLTVPPVAGALVINIGDLIHILSNGEYQN  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+ +  R+SVAY YGP I+V+I P  KL     P +Y+ ++WKEYL +K   + 
Sbjct  283  VLHRAIVNRSQQRLSVAYLYGPPINVQISPHSKLVTPSHPSLYRPVTWKEYLGIKGKLYN  342

Query  719  KSLEKVRFN  745
            K+L  ++F+
Sbjct  343  KALSSIKFH  351



>gb|ABO70984.1| gibberellin 3-oxidase 2 [Nicotiana tabacum]
Length=360

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 170/248 (69%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+VG P  + AR++WP DY  FCDVI
Sbjct  98   QQKLKAARSADGIAGYGVARISSFFSKLMWSEGFTIVGSP-FDHARQLWPHDYKKFCDVI  156

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++M+ LA +L+ L+  SLG+S +D++W   G  P    S LQ+NSYP CPDP RAM
Sbjct  157  EEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG--PRGECSALQLNSYPACPDPDRAM  214

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+I+T+L+Q++T  GLQV++    WV + P+  A+VINVGDL+ + SNG + S
Sbjct  215  GLAAHTDSTILTILHQNNT-SGLQVFKEGNGWVTVPPLSGALVINVGDLLHILSNGLYPS  273

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP   VKI P  KL   G  P+Y++++W EYL  K  +F 
Sbjct  274  VLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQGHPPLYRSVTWSEYLGTKAKHFD  333

Query  719  KSLEKVRF  742
            K+L   + 
Sbjct  334  KALSSFQL  341



>gb|AEK70424.1| GA3ox2 [Gossypium hirsutum]
Length=368

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 176/269 (65%), Gaps = 11/269 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F+  MW +GFT+VGPP     + +WP+D+S  CDVI
Sbjct  102  HQKLKAARSPDGVSGYGFARISSFFSKLMWSQGFTIVGPPDEHFCQ-LWPQDFSYHCDVI  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGL-SSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            ++Y+E+MK LA +L+ L+  SLG+ + ED++W  P    +   + LQ+N YP CPDP RA
Sbjct  161  KEYKEEMKKLAGRLMWLMLGSLGIIAKEDIKWAGPKADFKGASAALQLNYYPACPDPDRA  220

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+++T+LYQ+ T  GLQV++    WV + PV   +VINVGDLM + SNG ++
Sbjct  221  MGLAPHTDSTLLTILYQNST-SGLQVFKEGAGWVAVPPVPGGLVINVGDLMHILSNGSYQ  279

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+ +HHR+S AY YGP   V+I P  KL      P+Y+ ++W EYL  K  +F
Sbjct  280  SVLHRAMVNRSHHRLSSAYLYGPPSTVEISPHPKLVGPTHPPLYRPVTWNEYLHTKAKHF  339

Query  716  FKSLEKVR-------FNPVAEEYNAITSG  781
             K+L  VR          V E+ N++T G
Sbjct  340  NKALSSVRVCVPLNGLGDVNEQNNSVTVG  368



>gb|ABG46320.1| gibberellin 3-oxidase 1 [Rumex palustris]
Length=368

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 172/249 (69%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A R+P+  TGYG    S  F   +W EGFT+ G P  + AR++WP+DY  FC++I
Sbjct  105  HQKLKAARAPDGVTGYGPARISSFFPKLLWSEGFTIFGSP-EDHARQLWPQDYQNFCEII  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP-GGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y   MK LA +L+ L+  SLG++ +DVEW  P G   ++  + LQ+NSYPKCP+P RA
Sbjct  164  EEYDRDMKRLAGRLMWLVLGSLGIAKDDVEWAGPTGDFNDTCSAALQLNSYPKCPNPGRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ++T  GLQV+R  L WV + PV  A+V+N+GDL+ + SNG + 
Sbjct  224  MGLAAHTDSTLLTILYQNNTT-GLQVHRDGLGWVMVPPVPGALVVNIGDLLHILSNGLYP  282

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+  HHR+SVAY +GP   V+I P  +L + D   +Y+ +SW EYL+ K  +F
Sbjct  283  SVLHRAVVNRTHHRLSVAYLFGPPQSVRISPLERLVDPDHPALYRPISWTEYLSTKAKHF  342

Query  716  FKSLEKVRF  742
             K+L  VR 
Sbjct  343  NKALSSVRL  351



>ref|NP_001233848.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34124.1| 3b-hydroxylase [Solanum lycopersicum]
Length=373

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 174/249 (70%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  TGYG    S  F+  MW EGFT+VG P  E AR++WP+DY+ FC+VI
Sbjct  108  QQKLKAARSPDGVTGYGAARISSFFSKLMWSEGFTIVGSP-IEHARQLWPKDYNKFCEVI  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+++M+ LA +L+ L+  SLG++ +DV+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  167  EEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACPDPGRA  226

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQVY+    W+ + P+  A+V+N+GDL+ + SNG + 
Sbjct  227  MGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWITVPPIPGALVVNIGDLLHILSNGSYP  285

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   +R+SVAY YGP   V++ P  KL +    P+Y+ ++W EYL  K  YF
Sbjct  286  SVLHRAVVNRTRYRLSVAYLYGPPSGVRVSPLSKLVDHRHPPLYRAVTWSEYLGTKAKYF  345

Query  716  FKSLEKVRF  742
             K+L  VR 
Sbjct  346  DKALSSVRL  354



>gb|ACT99991.1| gibberellin 3-oxidase [Malus domestica]
Length=369

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY  FC++I
Sbjct  107  QQKLKAARSPDGISGYGFARISSFFKKLMWSEGFTIVGSPVDHF-RQLWPQDYDKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S ED++W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQS+T  GLQV R    WV + P+  A+VINVGDL  + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMPGALVINVGDLFHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY +GP   ++I P  KL      P+Y+ +SW EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKLVGPSHPPLYRPISWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>ref|XP_009788819.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
Length=360

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 170/248 (69%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+VG P  + AR++WP DY  FCDVI
Sbjct  98   QQKLKAARSADGIAGYGVARISSFFSKLMWSEGFTIVGSP-FDHARQLWPHDYKKFCDVI  156

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++M+ LA +L+ L+  SLG+S +D++W   G  P    S LQ+NSYP CPDP RAM
Sbjct  157  EEYEKEMEKLAGRLMWLMLGSLGISKDDMKWAVVG--PRGGCSALQLNSYPACPDPDRAM  214

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+I+T+L+Q++T  GLQV++    WV + P+  A+VINVGDL+ + SNG + S
Sbjct  215  GLAAHTDSTILTILHQNNT-SGLQVFKEGNGWVTVPPLSGALVINVGDLLHILSNGLYPS  273

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP   VKI P  KL   G  P+Y++++W EYL  K  +F 
Sbjct  274  VLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQGHPPLYRSVTWSEYLGTKAKHFD  333

Query  719  KSLEKVRF  742
            K+L   + 
Sbjct  334  KALSSFQL  341



>ref|XP_010254241.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=370

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 169/249 (68%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R P+  +GYG+   S  F   MW EGFT+VG P  E AR++WP+D++ FCDV+
Sbjct  105  QQKLKAARLPDGISGYGLARISSFFPKLMWSEGFTIVGSP-IEHARQLWPQDHTRFCDVM  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP-GGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y + MK LA KL  L+  SLG++ +D+ W  P GG   +  + LQ+NSYP CPDPTRA
Sbjct  164  EEYGKCMKQLARKLFWLMLGSLGINKDDINWASPQGGESGAMCAALQLNSYPACPDPTRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++TVLYQ+ T  GLQV R    WV + P+  A+V+NVGDL+ + SNG F 
Sbjct  224  MGLAAHTDSTLLTVLYQNST-SGLQVLRDGAGWVTVPPLPGALVVNVGDLLHILSNGIFP  282

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR+SVAY YGP  + +I P   L + +  P+Y+ ++W EYL  K  +F
Sbjct  283  SVLHRAVVNRTRHRLSVAYLYGPPTNAQISPLSSLVDPNHPPLYRPVTWAEYLGTKAKHF  342

Query  716  FKSLEKVRF  742
             K+L  VR 
Sbjct  343  NKALSSVRL  351



>ref|XP_008365721.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=371

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+VG P     R++WP+DY  FC++I
Sbjct  107  QQKLKAARSPDGISGYGFARISSFFKKLMWSEGFTIVGSPVDHF-RQLWPQDYDKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S ED++W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQS+T  GLQV R    WV + P+  A+VINVGDL  + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMPGALVINVGDLFHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY +GP   ++I P  KL      P+Y+ +SW EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKLVGPSHPPLYRPISWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>gb|AAM12872.1|AF494089_1 gibberellin 3-oxidase 1 [Nicotiana sylvestris]
Length=360

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 170/248 (69%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+VG P  + AR++WP DY  FCDVI
Sbjct  98   QQKLKAARSADGIAGYGVARISSFFSKLMWSEGFTIVGSP-FDHARQLWPHDYKKFCDVI  156

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++M+ LA +L+ L+  SLG+S +D++W   G  P    S LQ+NSYP CPDP RAM
Sbjct  157  EEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG--PRXECSALQLNSYPACPDPDRAM  214

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+I+T+L+Q++T  GLQV++    WV + P+  A+VINVGDL+ + SNG + S
Sbjct  215  GLAAHTDSTILTILHQNNT-SGLQVFKEGNGWVTVPPLSGALVINVGDLLHILSNGLYPS  273

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP   VKI P  KL   G  P+Y++++W EYL  K  +F 
Sbjct  274  VLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQGHPPLYRSVTWSEYLGTKAKHFD  333

Query  719  KSLEKVRF  742
            K+L   + 
Sbjct  334  KALSSFQL  341



>dbj|BAA37129.1| gibberelin 3beta-hydroxylase [Lactuca sativa]
Length=363

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 168/248 (68%), Gaps = 7/248 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R+P+  +GYG+   S  F   MW EGFT++G P  E AR++WP  YS FCDVI
Sbjct  103  QQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTIIGSP-YEHARKLWPNRYSRFCDVI  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E Y+ +M  LA++L+ L+  SLG+++EDV+W    G    +   LQ+NSYP CPDP RAM
Sbjct  162  EGYKHEMNNLAQRLMWLMLGSLGVTTEDVKWDGSQG----SCPALQLNSYPACPDPDRAM  217

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQ +R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  218  GLAAHTDSTLLTILYQNNT-SGLQAHREGAGWVTVPPIPGALVVNVGDLLHILSNGLYPS  276

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP  +V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  277  VLHRAMVNRTQHRLSVAYLYGPPSNVQISPLSKLTDHVHPPLYRPVTWSEYLGTKAKHFN  336

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  337  KALSSVRL  344



>dbj|BAD30036.1| gibberellin 3beta-hydroxylase2 [Daucus carota]
Length=353

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 172/248 (69%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A+R  E   GYG    S  F  RMW EGFT+VG P    AR +WPEDYS+FCDV 
Sbjct  109  EQKLKAERQ-EGGCGYGPFRISSFFPKRMWSEGFTIVGSPLQH-ARLLWPEDYSVFCDVT  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++MK LA K++ ++ ++LG++ ED+ W  P G  E++G+ LQ+NSYP CPDP RAM
Sbjct  167  EEYQKEMKKLAGKIMWIMLEALGITKEDIIWAGPNGEFEASGAALQLNSYPVCPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++++L+QS+   GLQV++ ++ WV + PV+ A+V+N+GDL+ + +NG + S
Sbjct  227  GLADHTDSTLLSILHQSNQ-SGLQVFQEEMGWVTVPPVEGALVVNIGDLLHILTNGSYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR  V+   HR S+AY YGP    +I P  KL +    P+Y+ ++W EYL +K + F+
Sbjct  286  VLHRVTVNRERHRYSMAYLYGPPHSAEISPLSKLVDHQHPPLYRPVTWSEYLGMKAILFY  345

Query  719  KSLEKVRF  742
             +L  +R 
Sbjct  346  NALSSLRL  353



>ref|NP_001275412.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
 gb|AAK91506.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
Length=355

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 169/248 (68%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+ G P  E AR++WP DY+ FCDVI
Sbjct  94   QQKLKAARSSDGIAGYGVARISSFFDKLMWSEGFTIFGSPL-EHARQLWPYDYNKFCDVI  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +M+ LA +L+ L+  SLG++ EDV+W      P S  S LQ+NSYP CPDP RAM
Sbjct  153  EEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVG---PRSGSSALQLNSYPACPDPDRAM  209

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++T  GLQV++    WV + P++ A+V+NVGDL+ + SNG + S
Sbjct  210  GLAAHTDSTLLTILHQNNT-SGLQVFKEGNGWVTVLPLRGALVLNVGDLVHILSNGLYPS  268

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP   VKI P  KL     P MY+ ++W EYL  K  +F 
Sbjct  269  VLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPQMYRPVTWSEYLGTKAKHFD  328

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  329  KALSSVRL  336



>ref|XP_010061961.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW69008.1| hypothetical protein EUGRSUZ_F02568 [Eucalyptus grandis]
Length=370

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP    GYG+   S  F   MW EGFT++G P  E AR++WP D++ FCDVI
Sbjct  107  HQKHKAARSPNGVPGYGVARISSFFPKLMWSEGFTIIGSP-LEHARQLWPNDHAEFCDVI  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++M+ LA +L+ L+  SLG+   D++W  P G      + LQ+NSYP CPDP RAM
Sbjct  166  EEYQKEMRKLAGRLMWLMLGSLGICKGDIKWAGPKGDFAGACNALQLNSYPACPDPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+++T+L+Q+ T  GLQV +    WV I P+  A+VINVGDL+ + SNG + S
Sbjct  226  GLAPHTDSTLLTILFQNST-SGLQVLKEGSGWVTIPPIPGALVINVGDLLHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+SVAY YGP  +V+I P  +L N    P+Y+ ++W EYL  K  +F 
Sbjct  285  VLHRAVVNRTWHRLSVAYLYGPPSNVQISPLSQLINSSNPPLYRPVTWSEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>dbj|BAG48320.1| gibberellin 3-oxidase1 [Chrysanthemum x morifolium]
Length=356

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 172/264 (65%), Gaps = 10/264 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R+P+  +GYG+   S  F   MW EGFT++G P  E A ++WP  Y+ FCDVI
Sbjct  96   QQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTIMGSP-YEHALKLWPNSYTRFCDVI  154

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E+M  LA+ L+SL+  SLG++ EDV+W    G    +   LQ+NSYP CPDP RAM
Sbjct  155  EEYKEEMNKLAQTLMSLMLGSLGVTMEDVKWAGSQG----SCPALQLNSYPACPDPDRAM  210

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++T  GLQ +R    WV + P+  A+VINVGDL+ + SNG + S
Sbjct  211  GLAAHTDSTLLTILHQNNT-SGLQAHRDGAGWVTVPPIPGALVINVGDLLHILSNGLYPS  269

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP  +V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  270  VLHRAMVNRTKHRLSVAYLYGPPSNVQISPLSKLTDQVHPPLYRPVTWSEYLGTKAKHFN  329

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   V    N     N+ 
Sbjct  330  KALSSVR---VCAPLNGFADANDH  350



>gb|AEW67998.1| gibberellin 3 oxidase 1 [Castanea mollissima]
Length=368

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 173/248 (70%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P  E  R++WP++YS FCD+I
Sbjct  104  QQKLKAARSPDGVSGYGLARISSFFPKLMWSEGFTIVGSP-LEHFRQLWPQEYSKFCDII  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+ +ED++W  P G  +   + LQ+NSYP CPDP +AM
Sbjct  163  EEYEKEMKKLAGRLMWLILGSLGICNEDIKWAGPKGEFQGASAALQLNSYPACPDPDQAM  222

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++T  GLQV R    WV ++PV+ A+V+N+GDL+ + SNG + S
Sbjct  223  GLAAHTDSTLLTILHQNNT-SGLQVLREGTGWVTVDPVQGALVVNIGDLLHILSNGLYPS  281

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   +R+S+AY YGP   V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  282  VLHRAMVNRTRYRLSMAYLYGPPDSVQISPLSKLLGPSHPPLYRPVTWNEYLGTKAKHFN  341

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  342  KALSCVRL  349



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 173/249 (69%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R  +  +GYGI   S  F   MW EGFT+VG P  E  R++WP+DY+ FC ++
Sbjct  105  QQKLKAARPADGISGYGIHRISSFFQKLMWSEGFTLVGSP-LEHFRQLWPQDYNKFCCMV  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +MK LA +L+ L+F SLG+S EDV W  P G  E   + LQ+NSYP CPDP+RAM
Sbjct  164  EEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGDFEDASNALQLNSYPACPDPSRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+++QS+ + GLQV R    W+ + PV  A+VIN+GDL+ + SNG +++
Sbjct  224  GLAEHTDSTLLTIIHQSN-ISGLQVLREGAGWLTVPPVAGALVINIGDLIHILSNGEYQN  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            + HRA+V+ +  R+SVAY YGP I+V+I P  KL     P +Y+ ++WKEYL ++   + 
Sbjct  283  VFHRAIVNRSQQRLSVAYLYGPPINVQISPHSKLVTPSHPSLYRPVTWKEYLGIEGKLYN  342

Query  719  KSLEKVRFN  745
            K+L  ++F+
Sbjct  343  KALSSIKFH  351



>ref|NP_001233855.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34125.1| 3b-hydroxylase [Solanum lycopersicum]
Length=355

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 168/248 (68%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+ G P  E AR++WP DY+ FCDVI
Sbjct  94   QQKLKAARSSDGIAGYGVARISSFFDKLMWSEGFTIFGSPL-EHARQLWPYDYNKFCDVI  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +M+ LA +L+ L+  SLG++ EDV+W      P S  S LQ+NSYP CPDP RAM
Sbjct  153  EEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVG---PRSGSSALQLNSYPACPDPDRAM  209

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++T  GLQV++    WV +  ++ A+VINVGDL+ + SNG + S
Sbjct  210  GLAAHTDSTLLTILHQNNT-SGLQVFKEGNGWVTVPLLRGALVINVGDLLHILSNGLYPS  268

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP   VKI P  KL     P MY+ ++W EYL  K  +F 
Sbjct  269  VLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPQMYRPVTWSEYLGTKAKHFD  328

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  329  KALSSVRL  336



>gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Erythranthe guttata]
Length=380

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 172/254 (68%), Gaps = 9/254 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKLRA R+ +  +GYG+   S  F+ RMW EGFT+VG P  E AR++WP+DY+ FC  I
Sbjct  110  HQKLRAARAADGVSGYGVARISSFFSKRMWSEGFTIVGSP-LENARKIWPDDYNKFCQTI  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLS--SEDVEWFKPGGLPES---TGSILQMNSYPKCPD  346
            E Y+++MK LA +L+ L+  SLG++   E+V+W  P    ES     + LQMNSYP CPD
Sbjct  169  EDYEKEMKKLAGRLMWLMLGSLGITKEEEEVKWADPKEESESGSGCAAALQMNSYPACPD  228

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLN-WVDIEPVKDAVVINVGDLMELAS  523
            P RAMGLA HTDS+I+TVL+QS+ + GLQV R   N WV +EP   A+V++VGDLM + S
Sbjct  229  PDRAMGLAAHTDSTILTVLHQSN-ISGLQVLREGGNRWVTVEPHPGALVVHVGDLMHILS  287

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAV  700
            NG + S+LHRAVV+   HR+SVAY YGP   VKI P  KL ++   PMY+ ++W EYL  
Sbjct  288  NGSYPSVLHRAVVNRTRHRLSVAYLYGPPPGVKISPLSKLVDQYNPPMYRPVTWSEYLGT  347

Query  701  KDVYFFKSLEKVRF  742
            K  +F K+L  VR 
Sbjct  348  KAKHFDKALTSVRL  361



>dbj|BAG32267.1| gibberellin 3-oxidase [Allium fistulosum]
Length=365

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 168/250 (67%), Gaps = 10/250 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP S +GYG+ P S  F+  MW EGFT+ G P  + AR +WP+DY  FC+VI
Sbjct  103  QQKLKAGRSPNSISGYGLAPISSLFSKLMWSEGFTISGSP-LDHARSLWPDDYFNFCEVI  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y ++MK +AE+L+ L+  SLGL+ E ++W  P    +   S+LQ+NSYP CP+P RA+
Sbjct  162  EEYNKEMKRVAERLMQLMLLSLGLTEETIKWAGPMNELQDISSVLQLNSYPACPNPDRAI  221

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPD-----LNWVDIEPVKDAVVINVGDLMELASN  526
            GLA HTDSS++T+LYQS+T  GLQV RP+       WV + P+  A+V+NVGDL  + SN
Sbjct  222  GLAAHTDSSLLTILYQSNT-SGLQVLRPNKESSPTQWVTVPPIPGALVVNVGDLCHILSN  280

Query  527  GRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKD  706
            GRF S++HRAVV+   HR S AY  GP   VK+ P V   K   P Y+ ++W+EYL +K 
Sbjct  281  GRFHSVVHRAVVNRTEHRYSAAYICGPPAHVKVSPIV---KPVGPAYRPITWREYLGIKA  337

Query  707  VYFFKSLEKV  736
              F K+L  V
Sbjct  338  RLFDKALASV  347



>ref|XP_009596383.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=363

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 171/250 (68%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +   GYG+   S  F+  MW EGFT+VG P    AR++WP DY  FC++I
Sbjct  97   QQKLKAARSADGIAGYGVARISSFFSKLMWSEGFTIVGSPLDH-ARQLWPHDYKKFCEII  155

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTG-SILQMNSYPKCPDPTR  355
            E+Y+++M+ LA +L+ L+  SLG++ +DV+W   P G+    G S LQ+NSYP CPDP R
Sbjct  156  EEYEKEMEKLAGRLMWLMLGSLGINKDDVKWAVGPRGVESKGGCSALQLNSYPACPDPDR  215

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            AMGLA HTDS+I+T+L+Q++T  GLQV++    WV + P+  A+VINVGDL+ + SNG +
Sbjct  216  AMGLAAHTDSTILTILHQNNT-SGLQVFKEGNGWVAVPPLPGALVINVGDLLHILSNGLY  274

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVY  712
             S+LHRAVV+   HR+S+AY YGP   VKI P  KL   G  PMY+ ++W EYL  K  +
Sbjct  275  PSVLHRAVVNRTRHRLSMAYLYGPPSWVKISPLSKLVDQGHPPMYRPVTWSEYLGTKAKH  334

Query  713  FFKSLEKVRF  742
            F K+L  VR 
Sbjct  335  FDKALSSVRL  344



>ref|XP_009343425.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 165/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG    S  F   MW EGFT+ G P     R++WP+DY  FC++I
Sbjct  107  QQKLKAARSPDGISGYGFARISSFFKKLMWSEGFTIFGSPVDHF-RQLWPQDYDKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S ED++W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQS+T  GLQV R    WV + P+  A+VINVGDL  + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMPGALVINVGDLFHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY +GP   ++I P  KL      P+Y+ +SW EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSIAYLFGPPASLQISPLSKLVGPSHPPLYRPISWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>ref|XP_008377587.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Malus domestica]
Length=371

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 167/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A R P+  +GYG    S  F   MW EGFT+VG P     R++WP+DY  FC++I
Sbjct  107  EQKLKAARPPDGISGYGFARISSFFRKLMWSEGFTIVGSPVDHF-RQLWPQDYEKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S+EDV+W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKRLAGRLMWLMLGSLGISTEDVKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQNNT-SGLQVLRDGTGWVTVPPMPGALVVNVGDLIHILSNGVYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY +GP   ++I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSIAYLFGPPASIQISPLSKLVGPSHPPLYRPITWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>gb|AFS18537.1| gibberellin 3-oxidase [Pyrus communis]
Length=371

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A R P+  +GYG    S  F   MW EGFT+VG P     R++WP+DY  FC++I
Sbjct  107  EQKLKAARPPDGISGYGFARISSFFRKLMWSEGFTIVGSPVDHF-RQLWPQDYEKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S EDV+W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKRLAGRLMWLMLGSLGISPEDVKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQNNT-SGLQVLRDGTGWVTVPPMAGALVVNVGDLIHILSNGVYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY +GP   V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKLVGPSHPPLYRPITWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>ref|XP_008804067.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=359

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 168/250 (67%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP + +GYG+ P S  F+  MW EGFT+ G P  E AR++WP+D   FCDV+
Sbjct  103  HQKLKAARSPGNISGYGLAPISSFFSKFMWSEGFTIAGSP-LEHARKLWPKDSGGFCDVM  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E MK LA +L+ L+  SLGL+ ED+ W  P        ++LQ+NSYP CP+P RAM
Sbjct  162  EEYKEVMKELAGRLMHLMLLSLGLTEEDISWAGPVRDSGELSAVLQLNSYPACPEPDRAM  221

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            GLA HTDSS++TVLYQS T  GLQV RPD   WV + P+  A+V+NVGDL  + SNG+F+
Sbjct  222  GLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVTVPPLPGALVVNVGDLSHILSNGQFR  280

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLAVKDVYF  715
            ++LHRAVV+   HR+S AY  GP   V + P  KL   G  P Y+T++W EYL++K   F
Sbjct  281  TVLHRAVVNRTRHRLSAAYICGPPAHVGVSPVDKLVGPGQGPAYRTVTWPEYLSLKRKLF  340

Query  716  FKSLEKVRFN  745
              +L  ++ +
Sbjct  341  NNALASIKLS  350



>ref|XP_009339604.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A R P+  +GYG    S  F   MW EGFT+VG P     R++WP+DY  FC++I
Sbjct  107  EQKLKAARPPDGISGYGFARISSFFRKLMWSEGFTIVGSPVDHF-RQLWPQDYEKFCNII  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG+S EDV+W    G  +   + LQ+NSYP CP+P RAM
Sbjct  166  EEYEKEMKRLAGRLMWLMLGSLGISPEDVKWAGSKGEFKGASAALQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQNNT-SGLQVLRDGTGWVTVPPMAGALVVNVGDLIHILSNGVYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY +GP   V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  285  VLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKLVGPSHPPLYRPITWNEYLGTKAKHFN  344

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  345  KALSSVRL  352



>gb|AEK70423.1| GA3ox1 [Gossypium hirsutum]
Length=364

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 172/265 (65%), Gaps = 7/265 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F+  MW EGFT+VG P  E  R++WP DY+  CDVI
Sbjct  98   NQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIVGSP-DEHFRQLWPHDYTNHCDVI  156

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSS-EDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            ++Y+++MK LA +L+ L+  SLG+++ +D++W  P    +   + LQ+N YP CPDP RA
Sbjct  157  KEYKQEMKKLAGRLMCLMLGSLGITAKQDIKWAGPKSEFKEASAALQLNYYPACPDPDRA  216

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ+ T  GLQV +  + W+ + PV D +VINVGDLM + SNG + 
Sbjct  217  MGLAAHTDSTLLTILYQNST-SGLQVLKEGVGWIKVSPVPDGLVINVGDLMHILSNGSYP  275

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+   HR+S+AY YGP   VKI P  KL      P+Y+ ++W EYL  K  YF
Sbjct  276  SVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHPKLVGPTHPPLYRPITWNEYLDTKAKYF  335

Query  716  FKSLEKVRFNPVAEEYNAITSGNEE  790
             K+L  VR   V    N +   NE 
Sbjct  336  NKALSWVR---VCVPLNGLVDVNEH  357



>ref|XP_011039983.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=465

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 175/264 (66%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E  R++WP+DY+ FCDVI
Sbjct  201  QQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFTIVGSP-LEHFRQLWPQDYTKFCDVI  259

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++++M+ LA +L  L+  SLG++ +D+ W  P G  +  G+ LQ+NSYP CPDP  AM
Sbjct  260  EEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPACPDPDLAM  319

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV +  + WV + P+   +V+NVGDL+ + SNG + S
Sbjct  320  GLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPS  378

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY YGP   V I P  KL   +  P+Y+ ++W EYL  K  +F 
Sbjct  379  VLHRAVVNRNKHRLSIAYLYGPPSTVLISPIQKLVGPNHPPLYRPVTWNEYLVAKAKHFN  438

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   +    N +   N+ 
Sbjct  439  KALSSVR---ICAPLNGLVDVNDH  459



>emb|CDP18939.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 172/265 (65%), Gaps = 7/265 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSPE  +GYG+   S  F   MW EGFT+VG P  E AR++WP DY  FC+V+
Sbjct  107  HQKLKAARSPEGVSGYGVARISSFFPKLMWSEGFTIVGSP-LEHARQLWPHDYHKFCNVM  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+++MK LA KL+ L+  SLG++ E+V+W  P G  E   + +Q+NSYP CP+P RAM
Sbjct  166  KEYEKEMKKLAGKLMWLILGSLGVTEEEVKWASPKGAFEGGNAAIQLNSYPACPEPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRP-DLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            GLA HTDS+I+T+L+Q++T  GLQV R     WV + P+  A+V+N+GDL+ + SNG + 
Sbjct  226  GLAAHTDSTILTILHQNNT-SGLQVLRDGGAGWVTVPPLPGALVVNIGDLLHILSNGLYP  284

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   HR SVAY YGP   V I P  KL   G  P+Y+ ++W EYL  K  +F
Sbjct  285  SVLHRAVVNRTRHRFSVAYLYGPPSGVTISPLQKLVDQGRPPLYRPVTWTEYLGTKAKHF  344

Query  716  FKSLEKVRFNPVAEEYNAITSGNEE  790
             K+L  VR   V    N     N+ 
Sbjct  345  DKALSLVR---VCAPLNGFGDANDH  366



>ref|XP_006427125.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|ESR40365.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|KDO58202.1| hypothetical protein CISIN_1g036286mg [Citrus sinensis]
Length=352

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+   GYG+   S  F+  MW EGFTV G P     R++WP+D+   CD+I
Sbjct  104  QQKLKAARSPDGVAGYGLARISSFFSKLMWSEGFTVAGSPLDHF-RKLWPQDFCKHCDII  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SLG++++DV+W  P G      + LQ+N YP CPDP RAM
Sbjct  163  EEYEQEMKKLAGRLMWLVLGSLGITTQDVKWAGPKGHFTDASAALQLNYYPACPDPDRAM  222

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV +    WV + P+  A+V+NVGDL+ + SNG + S
Sbjct  223  GLAEHTDSTLLTILYQNNT-SGLQVLKEGTGWVMVPPIPGALVVNVGDLIHILSNGSYPS  281

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+ A HR+S+AY YGP   V+I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  282  VLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVGPSHPPLYRPITWSEYLDTKAKHFN  341

Query  719  KSLEKVR  739
            K+L  V+
Sbjct  342  KALSSVK  348



>gb|KHG10231.1| Gibberellin 3-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=364

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 172/265 (65%), Gaps = 7/265 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F+  MW EGFT+VG P  E  R++WP DY+  CDVI
Sbjct  98   NQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIVGSP-DEHFRQLWPHDYTNHCDVI  156

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSS-EDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            ++Y+++MK LA +L+ L+  SLG+++ +D++W  P    +   + LQ+N YP CPDP RA
Sbjct  157  KEYKQEMKKLAGRLMCLMLGSLGITAKQDIKWAGPKSDFKEASAALQLNYYPACPDPDRA  216

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ+ T  GLQV +  + W+ + PV D +VINVGDLM + SNG + 
Sbjct  217  MGLAAHTDSTLLTILYQNST-SGLQVLKEGVGWIKVPPVPDGLVINVGDLMHILSNGSYP  275

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+   HR+S+AY YGP   VKI P  KL      P+Y+ ++W EYL  K  YF
Sbjct  276  SVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHPKLVGPTHPPLYRPITWNEYLDTKAKYF  335

Query  716  FKSLEKVRFNPVAEEYNAITSGNEE  790
             K+L  VR   V    N +   NE 
Sbjct  336  NKALSWVR---VCVPLNGLVDVNEH  357



>ref|NP_001275108.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
 gb|AAK91507.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
Length=373

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 173/249 (69%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  TGYG    S  F+  MW EGFT+VG P  E AR++W +DY+ FC+VI
Sbjct  108  QQKLKAARSPDGVTGYGAARISSFFSKLMWFEGFTIVGSP-IEHARQLWLKDYNKFCEVI  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E+Y+++M+ LA +L+ L+  SLG++ +DV+W   P G  +   + LQ+NSYP CPDP RA
Sbjct  167  EEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACPDPGRA  226

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+I+T+L+Q++T  GLQVY+    W+ + P+  A+V+N+GDL+ + SNG + 
Sbjct  227  MGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWITVPPIPGALVVNIGDLLHILSNGSYP  285

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRAVV+   +R+SVAY YGP   V++ P  KL +    P+Y+ ++W EYL  K  YF
Sbjct  286  SVLHRAVVNRTRYRLSVAYLYGPPSGVRVSPLSKLVDHRHPPLYRAVTWSEYLGTKAKYF  345

Query  716  FKSLEKVRF  742
             K+L  VR 
Sbjct  346  DKALSSVRL  354



>ref|XP_010476647.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Camelina sativa]
 gb|ADE80896.1| GA3ox1-like protein [Camelina sativa]
Length=358

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 171/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+D+  +CD++
Sbjct  109  KRKLKAARSETGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQDHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E+MK LA KL+ L   SLG++ EDVEW +         + LQ+N YP CP+P RAM
Sbjct  168  EEYEERMKKLASKLMWLALNSLGVTEEDVEWARLTSDLSWAQAALQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R DL W+ + PV  ++V+NVGDL  + SNG FKS
Sbjct  228  GLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R+SVA+ +GP  D+KI P  KL +    P+Y++++W+EYL  K  +F 
Sbjct  287  VLHRARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPLESPLYRSVTWREYLQTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>ref|XP_011081703.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like, partial [Sesamum 
indicum]
Length=369

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 171/249 (69%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL A+R+P   +GYG+   S  F+  MW EGFT+VG P  E A ++WP DY  FC+ I
Sbjct  109  DRKLMAERTPNGVSGYGMARISSFFSKSMWSEGFTIVGSP-LEHAAKLWPHDYHNFCNTI  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++MK LA +L+ L+  SLG++ +DV+W +P G  +  G+ LQ+NSYP CPDP +AM
Sbjct  168  EEYQKEMKNLASRLMGLILGSLGVTEDDVKWVEPKGELKERGAALQLNSYPPCPDPDKAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            G+A HTDS+I+ +L+QS+T  GLQV+R D + WV ++P   A+++ +GDLM + SNG + 
Sbjct  228  GMAAHTDSTILNILHQSNT-SGLQVFRGDGIGWVTLQPHPGALIVVIGDLMHILSNGSYL  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            + LHRAVV+   HR+SV Y +GP   VK+ P P  ++ +  P+Y+ ++W EYL +K  YF
Sbjct  287  NALHRAVVNQTQHRLSVVYLHGPPSSVKMGPLPQLVDSNHPPLYRPITWNEYLGIKAQYF  346

Query  716  FKSLEKVRF  742
             K+L  +  
Sbjct  347  DKALTTISL  355



>ref|XP_007024019.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
 gb|EOY26641.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
Length=371

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 175/269 (65%), Gaps = 11/269 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F+  MW EGFT+VG P  E  R++WP+DYS +CDVI
Sbjct  105  HQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIVGSP-DEHFRQLWPQDYSNYCDVI  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGL-SSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            ++Y+E+MK LA +L+ L+  SLG+ + +D++W  P G      + LQ+N YP CPDP RA
Sbjct  164  KEYKEEMKKLAGRLMWLVLGSLGIRAKQDMKWAGPKGDFREASAALQLNFYPACPDPERA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ++T  GLQV +    WV + PV   +VINVGDLM + SNG + 
Sbjct  224  MGLAAHTDSTLLTILYQNNT-SGLQVLKEGAEWVTVPPVPGGLVINVGDLMHILSNGSYP  282

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+ + HR+S+AY YGP   VKI P  KL      P+Y+ ++W EYL  K  +F
Sbjct  283  SVLHRAMVNRSRHRLSIAYLYGPPSSVKISPHPKLVGPSHPPLYRPVTWNEYLDTKAKHF  342

Query  716  FKSLEKVR-------FNPVAEEYNAITSG  781
             K+L  VR          V E  N++T G
Sbjct  343  NKALSSVRVCVPLNGLVDVNEHNNSVTVG  371



>ref|XP_010925284.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=362

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 167/250 (67%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWP-EDYSLFCDV  178
             QKL+A RSP S +GYG+VP S  F   MW EGFT+ G P  E AR++WP E Y+ FC+V
Sbjct  105  HQKLKAARSPGSISGYGLVPISSFFPKLMWSEGFTIAGSP-LEHARKLWPNESYAEFCNV  163

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            IE+Y + MK LA +L+ L+  SLGL+ ED+ W  P        +++Q+NSYP CP+P RA
Sbjct  164  IEEYSKVMKKLAGRLMHLMLLSLGLTEEDISWAGPTKDSGDLSTVMQLNSYPACPEPDRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGRF  535
            +GLA HTDSS++TVLYQS T  GLQV RPD   WV + P+   ++++VGDL  + SNGRF
Sbjct  224  VGLAAHTDSSLLTVLYQSRT-SGLQVLRPDPPRWVTVPPLPGVLIVHVGDLSHILSNGRF  282

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVY  712
            +S+LHRAVV+  HHR+S AY  GP   VK+ P  K L     P Y+ ++W EYLA+K   
Sbjct  283  RSVLHRAVVNRTHHRLSAAYICGPPAHVKVSPVKKLLGPSQGPAYRAVTWPEYLALKGKL  342

Query  713  FFKSLEKVRF  742
            F ++L  ++ 
Sbjct  343  FNEALASIKL  352



>ref|XP_011045367.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=372

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 168/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E  R +W +DY+ FCD+I
Sbjct  108  QQKLKAARSPDGVSGYGVPRISSFFSKLMWSEGFTIVGSP-LEHFRHLWSQDYTKFCDII  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++M+ LA +L  L+  SLG++ +D++W    G  +   + LQ+N YP CPDP +AM
Sbjct  167  EEYKKEMQKLARRLTRLMLGSLGITKKDLKWAGSTGESKKGSAALQLNYYPACPDPDQAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQS+T  GLQV +  + WV + P+   +V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQSNT-SGLQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+A+ YGP   V+I P  KL   +  P+Y+ ++W EYL  K  YF 
Sbjct  286  VLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKLVGPNHPPLYRPVTWNEYLGTKATYFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRI  353



>emb|CAN80137.1| hypothetical protein VITISV_028510 [Vitis vinifera]
Length=365

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 166/248 (67%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+   GYG+   S  FN  MW EGFT+ G P  E AR++WP+DY+ FCDV 
Sbjct  104  QQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIFGSP-LEHARQLWPQDYTKFCDVT  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++++M  LAE+L+ L+  SLG++ EDV W    G      + LQ+NSYP CP+P RAM
Sbjct  163  EEFEKEMNQLAERLMWLMLGSLGITKEDVNW---AGSKGDFKAALQLNSYPACPEPDRAM  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS+ T+LYQ +T+ GLQV R    W+ + P+  A+VINVGDL+ + SNG F S
Sbjct  220  GLAAHTDSSLFTILYQ-NTVSGLQVQREGAGWITVPPLPGALVINVGDLLHILSNGXFPS  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++HRA+V+   HR+SVAY YGP   V I P  KL +    P+Y+ ++W EYL  K  +F 
Sbjct  279  VVHRALVNRTKHRLSVAYLYGPPAGVPISPVPKLVDSTHPPLYRPVTWSEYLCTKAKHFD  338

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  339  KALSLVRL  346



>dbj|BAD06943.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=372

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 174/250 (70%), Gaps = 8/250 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E +R +WP+D++ FC+V+
Sbjct  108  QQKLKAARSPDGVSGYGLARISSFFDKLMWSEGFTIVGSP-LEHSRLLWPQDFNSFCEVV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +++ L+ +SLG++ ED +W   G   +   S LQ+NSYP CPDP RAM
Sbjct  167  EEYEKEMKKLAGRMMKLILESLGVAEEDAKW---GVESKGRCSALQLNSYPACPDPGRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDL--NWVDIEPVKDAVVINVGDLMELASNGRF  535
            GLA HTDS+++T+L+Q++T  GLQV+R      WV + P+  A+VIN GDL+ + SNG +
Sbjct  224  GLAEHTDSTVLTILHQNNT-SGLQVFREGAAGGWVTVPPIPGALVINAGDLLHILSNGLY  282

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVY  712
             S+LHRAVV+ + HR+SVAY YGP   +KI P  KL  +G  P+++ ++W EYL  K  +
Sbjct  283  HSVLHRAVVNRSSHRLSVAYLYGPPPGIKISPLPKLVAEGQPPLFRAITWSEYLRTKAKH  342

Query  713  FFKSLEKVRF  742
            F K+L  VR 
Sbjct  343  FDKALSSVRL  352



>ref|XP_002299619.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE84424.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=372

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 169/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F+  MW EGFT+VG P  E  R++W +DY+ FCD+I
Sbjct  108  QQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFTIVGSP-LEHFRQLWSQDYTKFCDII  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++M+ LA +L  L+  SLG++ +D++W    G  +   + LQ+N YP CPDP +AM
Sbjct  167  EEYKKEMQKLARRLTWLMLGSLGIAKKDLKWAGSTGESKKGSAALQLNYYPACPDPDQAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQS+T  GLQV +  + W+ + P+   +V+NVGDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILYQSNT-SGLQVLKEGIGWITVPPIPGGLVVNVGDLLHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+A+ YGP   V+I P  KL   +  P+Y+ ++W EYL  K  YF 
Sbjct  286  VLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKLVGPNHPPLYRPVTWNEYLGTKAKYFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRI  353



>ref|XP_002892873.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69132.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 168/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSETGVSGYGVARIASFFNKKMWSEGFTITGSPLNDF-RKLWPQLHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+EQMK LA KL+ L  KSLG+S EDVEW           + LQ+N YP CP+P RAM
Sbjct  168  EEYEEQMKKLASKLMWLALKSLGVSEEDVEWASLNSDLNWAQAALQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L Q++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FKS
Sbjct  228  GLAAHTDSTLLTILCQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R+SVA+ +GP  D+KI P  KL +    P+Y++++W EYL  K  +F 
Sbjct  287  VLHRARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPVELPLYRSVTWTEYLRTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>emb|CDX81720.1| BnaC08g38810D [Brassica napus]
Length=358

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            + KL A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QHKLEAARSDAGFSGYGVARISSFFNKKMWSEGFTITGSPLNDF-RKLWPQLHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+EQM+ LA KL+ L   SLG+S ED++W +         S LQ+N YP CP+P RAM
Sbjct  168  EQYEEQMQKLASKLMWLSLNSLGVSEEDIKWARVSSDLNWAQSALQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+++T+LYQ++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FKS
Sbjct  228  GLAPHTDSTLLTILYQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++HR  V+    R+SVA+ +GP  D KI P  KL + D  P+Y++++W EYL  K  +F 
Sbjct  287  VIHRVRVNQTRPRLSVAFLWGPRSDTKISPVPKLVSPDESPLYRSVTWTEYLRTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>ref|NP_001269085.1| uncharacterized protein LOC100265167 [Vitis vinifera]
 emb|CBI36201.3| unnamed protein product [Vitis vinifera]
 gb|AGQ42611.1| GA3ox1 [Vitis vinifera]
Length=365

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 166/248 (67%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+   GYG+   S  FN  MW EGFT+ G P  E AR++WP+DY+ FCDV 
Sbjct  104  QQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIFGSP-LEHARQLWPQDYTKFCDVT  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++++M  LAE+L+ L+  SLG++ ED+ W    G      + LQ+NSYP CP+P RAM
Sbjct  163  EEFEKEMNQLAERLMWLMLGSLGITKEDLNW---AGSKGDFKAALQLNSYPACPEPDRAM  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS+ T+LYQ +T+ GLQV R    W+ + P+  A+VINVGDL+ + SNG F S
Sbjct  220  GLAAHTDSSLFTILYQ-NTVSGLQVQREGAGWITVPPLPGALVINVGDLLHILSNGVFPS  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++HRA+V+   HR+SVAY YGP   V I P  KL +    P+Y+ ++W EYL  K  +F 
Sbjct  279  VVHRALVNRTKHRLSVAYLYGPPAGVPISPVPKLVDSTHPPLYRPVTWSEYLCTKAKHFD  338

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  339  KALSLVRL  346



>ref|XP_009117822.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Brassica rapa]
 emb|CDY68965.1| BnaA09g57140D [Brassica napus]
Length=358

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 168/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSDTGFSGYGVARISSFFNKKMWSEGFTITGSPLNDF-RKLWPQLHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+EQM+ LA KL+ L   SLG++ ED++W           S LQ+N YP CP+P RAM
Sbjct  168  EQYEEQMQKLASKLMWLSLNSLGVTEEDIKWATVSSDLNWAQSALQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+++T+LYQ++T  GLQV+R D  WV + PV  ++V+NVGDL  + SNG FKS
Sbjct  228  GLAPHTDSTLLTILYQNNT-AGLQVFRDDFGWVTVPPVPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++HRA V+    R+SVA+ +GP  D KI P  KL + D  P+Y++++W EYL  K  +F 
Sbjct  287  VIHRARVNQTRPRLSVAFLWGPRSDTKISPVPKLVSPDESPLYRSVTWTEYLRTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>ref|NP_173008.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
 sp|Q39103.2|G3OX1_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; Short=AtGA3ox1; AltName: Full=Gibberellin 3 
beta-hydroxylase 1 [Arabidopsis thaliana]
 gb|AAF71980.1|AC013453_5 GA4 protein [Arabidopsis thaliana]
 gb|AAC37506.1| GA4 [Arabidopsis thaliana]
 gb|AAO64762.1| At1g15550 [Arabidopsis thaliana]
 dbj|BAE99582.1| Gibberillin 3 beta-hydroxylase [Arabidopsis thaliana]
 gb|AEE29335.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
Length=358

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL++ RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKSARSETGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E MK LA KL+ L   SLG+S ED+EW           + LQ+N YP CP+P RAM
Sbjct  168  EEYEEHMKKLASKLMWLALNSLGVSEEDIEWASLSSDLNWAQAALQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R DL WV + P   ++V+NVGDL  + SNG FKS
Sbjct  228  GLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWVTVPPFPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R+SVA+ +GP  D+KI P  KL +    P+YQ+++WKEYL  K  +F 
Sbjct  287  VLHRARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPVESPLYQSVTWKEYLRTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>gb|AHC32023.1| gibberellin 3-oxidase 2 [Camellia sinensis]
Length=373

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 168/248 (68%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F   MW EGFT+ G P  E AR++WP+D++ FC VI
Sbjct  99   QQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFTIFGSP-LEHARQLWPQDHNQFCHVI  157

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y++ M+ LA +L+ L+  SLG++ ED++W  P    +   + +Q+NSYP CPDP RAM
Sbjct  158  EEYEKVMQQLAGRLMWLMLGSLGITKEDIKWAGPKADFKGASAAIQLNSYPACPDPDRAM  217

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++T  GLQV R    WV + P    +V+N+GDL+ + SNG + S
Sbjct  218  GLAAHTDSTLLTILHQNNT-SGLQVLREGAGWVTVPPQPGTLVVNIGDLLHILSNGLYPS  276

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+S+AY YGP  +V+I P  KL +    P+Y+ ++W EYL  K  +F 
Sbjct  277  VLHRAMVNRTQHRLSIAYLYGPPTNVQISPLSKLVDPSHPPLYRPVTWTEYLGTKAKHFN  336

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  337  KALSSVRL  344



>ref|XP_011072274.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=378

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 168/251 (67%), Gaps = 7/251 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKLRA R P+  +GYG+   S  F+  MW EGFTVVG P  E AR++WP DY  FCD I
Sbjct  112  HQKLRAARPPDGISGYGVARISSFFSKLMWSEGFTVVGSP-LEHARQLWPHDYHEFCDTI  170

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSED-VEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            E YQ+ MK LA +L+ L+  SLG+++ED ++W  P G      + +Q+NSYP CPDP RA
Sbjct  171  EDYQKSMKKLAGRLMWLMLGSLGITNEDDIKWASPAGEAGGGNAAIQLNSYPACPDPDRA  230

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRP-DLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            MGLA HTDS+++T+L+QS+T  GLQV++     W+ + P   A+VI+VGDLM + SNG +
Sbjct  231  MGLAAHTDSTLLTILHQSNT-SGLQVFQEGSKRWITVPPHPGALVIHVGDLMHILSNGLY  289

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF--PMYQTLSWKEYLAVKDV  709
             S+LHRAVV+   HR+S+AY YGP   VKI P  KL  D F  P+Y+ ++W EYL  K  
Sbjct  290  PSVLHRAVVNRTRHRLSIAYLYGPPSSVKISPLPKL-VDHFHPPLYRPITWSEYLGTKAK  348

Query  710  YFFKSLEKVRF  742
            +F K+L  VR 
Sbjct  349  HFDKALTSVRL  359



>ref|XP_006305164.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
 gb|EOA38062.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
Length=362

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  113  QRKLKAARSETGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQLHLNYCDIV  171

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E+MK LA KL+ L   SLG+S EDV+W           + LQ+N YP CP P RAM
Sbjct  172  EEYEERMKKLASKLMWLALSSLGVSEEDVQWASLNSDSNWAQAALQLNHYPVCPQPDRAM  231

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FKS
Sbjct  232  GLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKS  290

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R+SVA+ +GP  D+KI P  KL +    P+Y++++W EYL  K  +F 
Sbjct  291  VLHRARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPVDTPLYRSVTWTEYLQTKATHFN  350

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  351  KALSMIR  357



>gb|KDP37169.1| hypothetical protein JCGZ_06225 [Jatropha curcas]
Length=375

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 166/264 (63%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYGI   S  F+  MW EGFT+VG P     R++WP+DY+ FC  I
Sbjct  107  QQKLKAARSPDGVSGYGIARISSFFSKLMWSEGFTIVGSPLDHF-RQLWPQDYTKFCGTI  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ +M+ LA KL+ L+  SL ++ ED+ W  P        + LQ+N YP CPDP +AM
Sbjct  166  EVYQVEMQKLAAKLMWLVLGSLDITKEDITWAGPKADFREASAALQLNYYPACPDPDQAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV R    WV + P+   +V+NVGDL+ + SNG + S
Sbjct  226  GLAAHTDSTLLTILYQNNT-SGLQVLREGTGWVTVPPISGGLVVNVGDLLHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+   HR+S+AY YGP   ++I P  KL      P+Y+ ++W EYL  K  +F 
Sbjct  285  VLHRAVVNRTKHRLSMAYLYGPPSSIQISPLSKLVGPSQPPLYRPITWNEYLGTKAKHFN  344

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   V    N I   N+ 
Sbjct  345  KALSWVR---VCAPLNGIVDVNDH  365



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 161/252 (64%), Gaps = 9/252 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R  +  +GYG+VP S  F   MW EGFT+ G P  + AR++WP D   FCD I
Sbjct  94   QQKLKAARPADGVSGYGLVPISSFFAKLMWSEGFTIAGSP-LDHARKLWPHDPDQFCDAI  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
            E+Y  +MK LA +L+ L+  SLGLS E+VEW   GG LP     +L++NSYP CPDP RA
Sbjct  153  ERYDREMKALAGRLIRLMLLSLGLSDEEVEWAGQGGELPPDLAGVLRLNSYPACPDPDRA  212

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPD-----LNWVDIEPVKDAVVINVGDLMELAS  523
            MG+A H DSS++T+LYQS T  GLQV R +       WV + P+  A+V+ VGDL  + S
Sbjct  213  MGMAAHADSSLVTILYQSST-SGLQVLRAEDQNSPARWVTVPPLPGALVVIVGDLFHILS  271

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLAV  700
            NGRFKS++HR VV+ +  R+S AYF GP   V + P  KL   G  P Y+ ++W EYL +
Sbjct  272  NGRFKSVVHRVVVNRSQQRVSAAYFCGPPAGVTVSPIEKLVGPGRAPAYRAVTWAEYLGL  331

Query  701  KDVYFFKSLEKV  736
            K   F K+L  +
Sbjct  332  KRELFDKALATI  343



>ref|XP_003543662.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=352

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 165/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+ + GYG+   S  F   MW EGFT+VG P  E  R++WP+DY  +CD++
Sbjct  103  HQKQKAARSPDGADGYGLARISSFFPKLMWSEGFTIVGSP-LEHFRQLWPQDYHKYCDIV  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y E MK L  KL+ L+  SLG++ ED++W    G  + T + LQ+NSYP CPDP RAM
Sbjct  162  KRYDEAMKKLVGKLMWLMLDSLGITKEDLKWAGSKGQFKKTCAALQLNSYPTCPDPDRAM  221

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++ + GLQV+R    WV + PV + +VINVGDL+ + SNG + S
Sbjct  222  GLAAHTDSTLLTILYQNN-ISGLQVHRKGGGWVTVAPVPEGLVINVGDLLHILSNGLYPS  280

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R+SVAY  GP  +V+I P  KL   +  P+Y+ ++W EYL  K  +F 
Sbjct  281  VLHRVLVNRIQQRLSVAYLCGPPPNVEICPHAKLVGPNKPPLYKAVTWNEYLGTKAKHFN  340

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  341  KALSTVRL  348



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 170/248 (69%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDY-SLFCDV  178
             +KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ + + +CD+
Sbjct  109  HRKLKAARSETGFSGYGVARISSFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNNYCDI  167

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y+EQM+ LA KL+ L   SLG+S ED++W       +   S LQ+N YP CP+P RA
Sbjct  168  VEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANSDSDWAQSALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+L+Q++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R+SVA+ +GP  D+KI P  KL +  G P+Y++++W EYL  K  +F
Sbjct  287  SVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHF  346

Query  716  FKSLEKVR  739
             ++L  +R
Sbjct  347  NEALSMIR  354



>ref|XP_010459098.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 169/247 (68%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSETGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPES-TGSILQMNSYPKCPDPTRA  358
            E+Y+E+MK LA KL+ L   SLG+S EDVEW        S   + LQ+N YP CP+P RA
Sbjct  168  EEYEERMKKLASKLMWLALNSLGVSEEDVEWASLNSADLSWAQAALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ++T  GLQV+R DL W+ + PV  ++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R+SVA+ +GP  D+KI P  KL +    P+Y++++W+EYL  K  +F
Sbjct  287  SVLHRARVNQTRARLSVAFLWGPQSDIKISPVSKLVSPLESPLYRSVTWREYLQTKATHF  346

Query  716  FKSLEKV  736
             K+L  +
Sbjct  347  NKALSMI  353



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 171/248 (69%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDY-SLFCDV  178
            ++KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ + + +CD+
Sbjct  109  QRKLKAARSETGFSGYGVARISSFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNNYCDI  167

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y+EQM+ LA KL+ L   SLG+S ED++W           S LQ+N YP CP+P RA
Sbjct  168  VEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANPDLNWAQSALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+L+Q++T  GLQV+R DL WV + PV D++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVPDSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R+SVA+ +GP  D+KI P  KL +  G P+Y++++W EYL  K  +F
Sbjct  287  SVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHF  346

Query  716  FKSLEKVR  739
             ++L  ++
Sbjct  347  NEALSMIK  354



>gb|AAN87570.1| gibberellin 3-oxidase [Spinacia oleracea]
Length=382

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 171/265 (65%), Gaps = 7/265 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RS    TGYG    S  F  RMW EGFT++G P    AR++WP +Y+ FCD+I
Sbjct  106  NQKLKAARSSCGVTGYGPAGISSFFPKRMWSEGFTILGSPLDH-ARQLWPNNYNKFCDII  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDV-EWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            EKYQ++M  LA+KL+ L+  SLG+S++D+  W     L E     +Q+NSYP  PDP RA
Sbjct  165  EKYQKEMNQLAKKLMQLVVGSLGISNQDIMNW---ADLLEGANGAMQLNSYPIRPDPNRA  221

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+L+QS+T  GLQV+R    WV + P+   +VIN+GDL+ + SNGR+ 
Sbjct  222  MGLAAHTDSTLLTILHQSNT-TGLQVFRERSGWVTVPPISGGLVINIGDLLHILSNGRYP  280

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+ HRA+V+   HR+SVAY YGP   V+++P P  ++    P+Y+ ++W EYL +K  + 
Sbjct  281  SVYHRAMVNRVQHRLSVAYLYGPASGVRVQPLPKLIDATHPPLYRPVTWSEYLGIKSEHL  340

Query  716  FKSLEKVRFNPVAEEYNAITSGNEE  790
             K+L  +R N           GN+E
Sbjct  341  TKALSLIRINHNTNPSLTGLIGNDE  365



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 163/248 (66%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P  E  R++WP+DY+ +CD++
Sbjct  108  HQKLKALRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSP-FEHFRQLWPQDYAKYCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+E MK LA KL+ L+  SLG++ ED++W       E   + +Q+NSYP CPDP RAM
Sbjct  167  LQYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKACAAMQLNSYPSCPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L Q+D + GLQV R  + WV + P+   +V+NVGDL  + SNG + S
Sbjct  227  GLAPHTDSTFLTILSQND-ISGLQVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R S+AY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSIAYLYGPPSNVEICPHTKLVGPTQPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSYVRI  353



>ref|XP_009377503.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 165/247 (67%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP  +TGYG    S  F+  MW EGFT++G P    A+++WP+DY  FCD I
Sbjct  102  DQKLKALRSPGGATGYGRPHISPFFDRHMWQEGFTIMGSPIDH-AKQLWPQDYQGFCDTI  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ QMK LAEKL+ + FKSL ++ +++ W    GL  S G+ LQ+NSYP CPDPTRAM
Sbjct  161  DDYQNQMKALAEKLIRIFFKSLNINFKELNWLNDSGL-SSPGTALQLNSYPPCPDPTRAM  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTD+S++T++ QS T  GLQV++  + WV ++PV  A+ +N+GD + + SNG + S
Sbjct  220  GMAAHTDTSLVTIVQQSKT-SGLQVFKDGVGWVLVQPVPGALTVNLGDYLHILSNGMYTS  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +LHRAVV+    R S+AYFY P  D  + P +       P Y++L+ KEY+ +K  +F K
Sbjct  279  VLHRAVVNQQIQRFSMAYFYAPPRDFTVSPVLSRVMGQMPKYRSLTVKEYVDIKGKHFEK  338

Query  722  SLEKVRF  742
            +L  ++ 
Sbjct  339  ALSLIQI  345



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 168/265 (63%), Gaps = 6/265 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P  E  R++WP+DY+ +CD++
Sbjct  108  HQKLKALRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSP-FEHFRQLWPQDYAKYCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+E MK LA KL+ L+  SLG++ ED++W       E   + +Q+NSYP CPDP RAM
Sbjct  167  LQYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKGCAAIQLNSYPSCPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L Q+D + GLQV R  + WV + P+   +V+NVGDL  + SNG + S
Sbjct  227  GLAPHTDSTFLTILSQND-ISGLQVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHTKLVGPTQPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRFNPVAEEYNAITSGNEEA  793
            K+L  VR   +    N +   NE  
Sbjct  346  KALSYVR---ICATINGLFDLNEST  367



>dbj|BAQ02990.1| gibberellin 3-oxidase [Rorippa aquatica]
Length=356

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 167/246 (68%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSDTGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQLHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+EQM+ LA KL+ L+  SLG+S EDV+W +         + LQ+N YP CP P +AM
Sbjct  168  EEYEEQMRKLASKLLWLVLNSLGVSEEDVKWARLNSDSNWAQAALQLNHYPVCPQPDQAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R DL WV + PV  ++V+NVGDL+ + SNG FKS
Sbjct  228  GLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLLHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R SVA+ +GP  D++I P P  +     P+YQ+++W  YL +K  +F 
Sbjct  287  VLHRARVNQTRSRFSVAFLWGPQSDIQISPIPKLVGPFESPLYQSVTWTHYLQIKATHFN  346

Query  719  KSLEKV  736
            K+L  +
Sbjct  347  KALSMI  352



>ref|XP_010249910.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=376

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 179/254 (70%), Gaps = 5/254 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A RSP+ +TGYG    +  F+  MW EGFT++G P +E A ++WP +Y+ FC V+
Sbjct  114  EQKLKALRSPDGATGYGRARITPFFSKLMWHEGFTIMGSP-AEHAHQLWPHNYTRFCGVM  172

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDV-EWFKPGG-LPESTGSILQMNSYPKCPDPTR  355
            ++YQ++MK L+ +L+ L+  SLGL+ ED+ +W  P G   +   + LQ+NSYP CPDP R
Sbjct  173  DEYQKEMKQLSVRLLRLILSSLGLAREDLTKWVGPAGEFTQGATTALQLNSYPACPDPNR  232

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
             MGLA HTD+S+ T+LYQS+T  GLQ++R    WV + P+  A+++NVGDL+++ SN RF
Sbjct  233  TMGLAAHTDTSMFTILYQSNT-SGLQIFRDGFGWVSVPPLAGALIVNVGDLLQILSNARF  291

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVY  712
             ++LHRAVV+  + R+S+AYFYGP+ + +I P  KL   G  P+Y++L+WKEY+ +K  +
Sbjct  292  PAVLHRAVVNRTNQRLSIAYFYGPSTETRIMPLSKLIGPGDPPLYRSLTWKEYIGIKAKH  351

Query  713  FFKSLEKVRFNPVA  754
             +++L  VR   +A
Sbjct  352  LYRALSLVRLQQLA  365



>ref|XP_010497240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 169/248 (68%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSDTGVSGYGVARIASFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPES-TGSILQMNSYPKCPDPTRA  358
            E+Y+E+MK LA KL+ L   SLG+S EDVEW        S   + LQ+N YP CP+P RA
Sbjct  168  EEYEERMKKLASKLMWLALNSLGVSEEDVEWASLNSADLSWAQAALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+LYQ++T  GLQV+R DL W+ + PV  ++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R+SV + +GP  D+KI P  KL +    P+Y++++WK+YL  K  +F
Sbjct  287  SVLHRARVNQTRARLSVDFLWGPQSDIKISPVPKLVSPLESPLYRSVTWKKYLQTKATHF  346

Query  716  FKSLEKVR  739
             K+L  +R
Sbjct  347  NKALSMIR  354



>ref|XP_009108486.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Brassica rapa]
Length=350

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 170/253 (67%), Gaps = 10/253 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+       A  +WP+D++ FC+VI
Sbjct  100  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMDSSLRRHATLIWPDDHAEFCNVI  159

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ++M  L+ +LVS++  SLGL+ +++ W  P   G   +S+ S LQ+NSYP CPDP 
Sbjct  160  EEYQKEMANLSHRLVSMVMGSLGLTHKELRWLVPNITGSRTDSSQSFLQLNSYPVCPDPD  219

Query  353  RAMGLAPHTDSSIITVLYQSDT----LRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELA  520
             AMGLAPHTDSS++T+LYQ +     ++ LQ  +    W+ +EPV+  +V+ +GDL  + 
Sbjct  220  LAMGLAPHTDSSLLTILYQGNIPGLEIQNLQAEKS--RWIGVEPVEGGLVVIMGDLSHII  277

Query  521  SNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAV  700
            SNGRFKS +HRAVV+  HHR+S AYF GP  +++I  P+  + D  P+Y+ L+W+EYLA 
Sbjct  278  SNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQIG-PLTADTDHPPLYRRLTWEEYLAA  336

Query  701  KDVYFFKSLEKVR  739
            K  +F K+L   R
Sbjct  337  KATHFNKALSLFR  349



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 166/255 (65%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R P+  +GYG+VP S  F   MW EGFT+ G P  + AR++WP D   FCDVI
Sbjct  95   QQKLKAARPPDGISGYGLVPISSFFAKLMWSEGFTIAGSP-LDHARKLWPHDPDQFCDVI  153

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG--LPESTGSILQMNSYPKCPDPTR  355
            E+Y + MK LA +L++L+  SLGL  E++EW    G  LP+  G +L++NSYP CPDP R
Sbjct  154  ERYDQVMKALAGRLITLMLLSLGLRHEELEWAGQTGKLLPDLAG-VLRLNSYPACPDPDR  212

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPD-----LNWVDIEPVKDAVVINVGDLMELA  520
            AMG+A H DSS++T+LYQS T  GLQ+ R +       WV + P+  A+V+ VGDL  + 
Sbjct  213  AMGMAAHADSSLLTILYQSST-SGLQLLRAEDQNGPARWVTVPPLPGALVVIVGDLFHIL  271

Query  521  SNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLA  697
            SNGRFKS++HR VV+ +  R+SVAYF GP   V++ P  KL   G  P Y+ ++W EYL 
Sbjct  272  SNGRFKSVVHRVVVNRSQQRVSVAYFSGPPAGVRVSPIGKLVGPGRAPAYRAVTWAEYLG  331

Query  698  VKDVYFFKSLEKVRF  742
            +K   F K+L  +  
Sbjct  332  LKRKLFDKALATIEM  346



>ref|XP_007150692.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
 gb|ESW22686.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
Length=365

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 166/255 (65%), Gaps = 3/255 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
              K RA RSP+   GYG+   S  F   MW EGFT+VG P  E  R++WP+DY+ +CD +
Sbjct  106  HHKHRAARSPDGVDGYGLARISSFFPKLMWSEGFTIVGSP-LERFRQLWPQDYNKYCDTV  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LAEKL+ L+ +SLG++ ED++W    G  ++T + LQ+NSYP CPDP RAM
Sbjct  165  MQYDETMKKLAEKLMWLMLESLGITKEDLKWAGAKGQFKNTCAALQLNSYPTCPDPDRAM  224

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++ + GLQV+R    WV + PV   +VINVGDL+ + SNG + S
Sbjct  225  GLAAHTDSTLLTILYQNN-ISGLQVHRKGTGWVTVPPVPGGLVINVGDLLHILSNGLYPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R+SVAY  GP  +V I P  KL     P +Y++++W EYL  K  +F 
Sbjct  284  VLHRVLVNRVQQRLSVAYLCGPPPNVSICPHEKLVGPNQPRLYKSVTWNEYLGTKAKHFN  343

Query  719  KSLEKVRFNPVAEEY  763
            K+L  V  +    E+
Sbjct  344  KALSTVLVSSAISEF  358



>dbj|BAJ65442.1| gibberellin 3-oxidase [Torenia fournieri]
 dbj|BAJ76663.1| gibberellin 3-oxidase [Torenia fournieri]
Length=382

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 169/251 (67%), Gaps = 6/251 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKLRA RSP+  +GYG+   S  F+  MW EGFT++G   SE AR +WP DY+ FCD I
Sbjct  110  QQKLRAARSPDGVSGYGVARISSFFSKLMWSEGFTILGSV-SEHARLLWPNDYNKFCDTI  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTG--SILQMNSYPKCPDPTR  355
            E+YQ+ MK LA +L+ L+  SLG++ +D   +     P+  G  + LQ+NSYP CPDP R
Sbjct  169  EEYQKAMKRLAGRLMWLMLGSLGITEDDDLKWAAQKEPDDQGGSAALQLNSYPSCPDPDR  228

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGR  532
            AMGLA HTDS+I+T+L+QS+T  GLQV R     WV + P+  A+V++VGDL+ + SNG 
Sbjct  229  AMGLAAHTDSTILTILHQSNT-SGLQVAREGRAGWVTVPPLAGALVVHVGDLLHILSNGL  287

Query  533  FKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDV  709
            + S++HRAVV+   HR+SVAY YGP   VKI P  KL +K   P+Y+ ++W EYL  K  
Sbjct  288  YPSVVHRAVVNRTRHRLSVAYLYGPPSSVKISPLRKLVDKYHPPLYRPITWSEYLGTKAK  347

Query  710  YFFKSLEKVRF  742
            +F K+L  VR 
Sbjct  348  HFDKALTSVRL  358



>ref|XP_003546239.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHM98787.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=353

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 162/248 (65%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+   GYG+   S  F   MW EGFT+VG P  E  R++WP+DY  +CD +
Sbjct  104  HQKHKAARSPDGVDGYGLARISSFFPKLMWSEGFTIVGSP-LEHFRQLWPQDYDKYCDFV  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK L  KL+ L+  SLG++ ED++W    G  E T + LQ+NSYP CPDP RAM
Sbjct  163  MQYDEAMKKLVGKLMLLMLDSLGITKEDLKWAGSKGQFEKTCAALQLNSYPTCPDPDRAM  222

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++ + GLQV+R  + WV + P+   +VINVGDL+ + SNG + S
Sbjct  223  GLAAHTDSTLLTILYQNN-ISGLQVHRKGVGWVTVPPLSGGLVINVGDLLHILSNGLYPS  281

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R+SVAY  GP  +V+I P  KL   +  P+Y+ ++W EYL  K  +F 
Sbjct  282  VLHRVLVNRIQRRLSVAYLCGPPPNVEICPHAKLVGPNKPPLYKAVTWNEYLGTKAKHFN  341

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  342  KALSTVRL  349



>ref|NP_193900.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
 sp|Q9SVS8.1|G3OX3_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 3; AltName: Full=GA 
3-oxidase 3; Short=AtGA3ox3; Short=AtGA3ox4; AltName: Full=Gibberellin 
3 beta-hydroxylase 3 [Arabidopsis thaliana]
 emb|CAB36813.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB81276.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 gb|ABE66082.1| gibberellin 3 beta-hydroxylase family protein [Arabidopsis thaliana]
 gb|AEE84490.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
Length=349

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 171/252 (68%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  99   HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMGSSLRRHATLLWPDDHAEFCNVM  158

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+S+L  SLGL+ ED+ W  P   G   +S  S LQ+NSYP CPDP 
Sbjct  159  EEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPVCPDPH  218

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD---LNWVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++V+ +GDL  + S
Sbjct  219  LAMGLAPHTDSSLLTILYQGN-IPGLEIESPQEEGSRWIGVEPIEGSLVVIMGDLSHIIS  277

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG+F+S +HRAVV+  HHR+S AYF GP  +++I  P+  +K+  P+Y+ L W+EYLA K
Sbjct  278  NGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQIG-PLTSDKNHPPIYRRLIWEEYLAAK  336

Query  704  DVYFFKSLEKVR  739
              +F K+L   R
Sbjct  337  ATHFNKALTLFR  348



>gb|ABK28643.1| unknown [Arabidopsis thaliana]
Length=350

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 171/252 (68%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  99   HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMGSSLRRHATLLWPDDHAEFCNVM  158

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+S+L  SLGL+ ED+ W  P   G   +S  S LQ+NSYP CPDP 
Sbjct  159  EEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPVCPDPH  218

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD---LNWVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++V+ +GDL  + S
Sbjct  219  LAMGLAPHTDSSLLTILYQGN-IPGLEIESPQEEGSRWIGVEPIEGSLVVIMGDLSHIIS  277

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG+F+S +HRAVV+  HHR+S AYF GP  +++I  P+  +K+  P+Y+ L W+EYLA K
Sbjct  278  NGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQIG-PLTSDKNHPPIYRRLIWEEYLAAK  336

Query  704  DVYFFKSLEKVR  739
              +F K+L   R
Sbjct  337  ATHFNKALTLFR  348



>emb|CDX76441.1| BnaA08g09590D [Brassica napus]
Length=350

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/253 (45%), Positives = 170/253 (67%), Gaps = 10/253 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+       A  +WP+D++ FC+VI
Sbjct  100  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMDSSLRRHATLIWPDDHAEFCNVI  159

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ++M  L+ +LVS++  SLGL+ +++ W  P   G   +S+ S LQ+NSYP CPDP 
Sbjct  160  EEYQKEMANLSHRLVSMVMGSLGLTHKELRWLVPNITGSRTDSSQSFLQLNSYPVCPDPD  219

Query  353  RAMGLAPHTDSSIITVLYQSDT----LRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELA  520
             AMGLAPHTDSS++T+LYQ +     ++ LQ  +    W+ +EPV+  +V+ +GDL  + 
Sbjct  220  LAMGLAPHTDSSLLTILYQGNIPGLEIQNLQAEKS--RWIGVEPVEGGLVVIMGDLSHII  277

Query  521  SNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAV  700
            SNGRFKS +HRAVV+  HHR+S AYF GP  +++I  P+  + D  P+Y+ L+W+EYLA 
Sbjct  278  SNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQIG-PLTADTDHPPLYRRLTWEEYLAA  336

Query  701  KDVYFFKSLEKVR  739
            K  +F ++L   R
Sbjct  337  KATHFNEALSLFR  349



>ref|XP_009148952.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Brassica rapa]
Length=359

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 170/248 (69%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDY-SLFCDV  178
            ++KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ + + +CD+
Sbjct  109  QRKLKAARSETGFSGYGVARISSFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLNNYCDI  167

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y+EQM+ LA KL+ L   SLG+S ED++W           S LQ+N YP CP+P RA
Sbjct  168  VEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANPDLNWAQSALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+L+Q++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R+SVA+ +GP  D+KI P  KL +  G P+Y++++W EYL  K  +F
Sbjct  287  SVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHF  346

Query  716  FKSLEKVR  739
             ++L  ++
Sbjct  347  NEALSMIK  354



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 168/247 (68%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+  RSPE +TGYG    S  F+  MW EGFT++G    + A+++WP DY  F DVI
Sbjct  102  KEKLKVLRSPEGATGYGAARISPFFSKFMWHEGFTIIGSSSVDHAKQLWPHDYESFTDVI  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ++MK LA +++ LL KSL +S ED+  +       + G+ LQ+NSYP CP+P+RA+
Sbjct  162  DVYQKKMKELAHQILLLLLKSLEISEEDITSWAASTHDSNNGA-LQLNSYPCCPNPSRAI  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS ++T+L Q+     LQ++R  + W+ + PV+DA+V+NVGDL+ + SNGRF S
Sbjct  221  GLAPHTDSLLLTILSQTHDSSALQIFRDGVGWIAVAPVRDALVVNVGDLLHILSNGRFPS  280

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + H+ +VS   HRISVAYFYGP  D ++ P   L++   P+Y++LS KE++ +K  +  K
Sbjct  281  VYHQVIVSEKEHRISVAYFYGPRTDAQVAP---LSRIEVPIYRSLSVKEFIGIKAKHLDK  337

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  338  ALSFVRI  344



>ref|XP_010691237.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 167/241 (69%), Gaps = 5/241 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP   TGYG    S  F  RMW EGFT++G P  + AR++WP DY+ FCD+I
Sbjct  170  HQKLKAARSPHGITGYGPARISSFFPKRMWSEGFTILGSP-LDHARQLWPNDYNKFCDII  228

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++M  LA++L+ L+  SLG+S++D+  +    L  + G+I Q+NSYP CPDP RAM
Sbjct  229  EEYQKEMNHLAKRLMQLILGSLGISNQDIMKWADLLLKGANGAI-QLNSYPVCPDPNRAM  287

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+QS T  GLQV++  + W+ + P+   +VIN+GDL+ + SNG++ S
Sbjct  288  GLAAHTDSTLLTILHQSST-TGLQVFKEQVGWITVPPLSGGLVINIGDLLHILSNGQYPS  346

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HRA+V+   HR+SVAY YGP   V+I+P    N    P+Y+ ++W EYL +K  +F K
Sbjct  347  VYHRAMVNRVQHRLSVAYLYGPAPGVRIQP--LPNTTHPPIYRPVTWSEYLGIKGEHFNK  404

Query  722  S  724
            +
Sbjct  405  A  405



>ref|XP_006416894.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
 gb|ESQ35247.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
Length=361

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 171/252 (68%), Gaps = 11/252 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDV  178
            ++KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+   L +CD+
Sbjct  109  QRKLKAARSETGVSGYGVARISSFFNKQMWSEGFTIAGSPLNDF-RKLWPKQLHLNYCDI  167

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPES----TGSILQMNSYPKCPD  346
            +E+Y+EQM+ LA KL+ L   SLG++ +D++W     + +S      S LQ+N YP CP 
Sbjct  168  VEEYEEQMQKLASKLMWLALNSLGVTEDDIKW---ASVDDSDLNWAQSALQLNHYPVCPQ  224

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASN  526
            P RAMGLA HTDS+++T+LYQ++T  GLQV+R DL W+ + P+  ++V+NVGDL  + +N
Sbjct  225  PDRAMGLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWITVPPIPGSLVVNVGDLFHILTN  283

Query  527  GRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVK  703
            G FKS+LHRA V+    R+SVA+ +GP  D KI P  KL +  G P+Y++++W EYL  K
Sbjct  284  GLFKSVLHRARVNQTRSRLSVAFLWGPQSDTKISPVPKLVSPVGSPLYRSVTWTEYLRTK  343

Query  704  DVYFFKSLEKVR  739
             V+F K+L  +R
Sbjct  344  AVHFNKALSMIR  355



>gb|KDO80406.1| hypothetical protein CISIN_1g043986mg, partial [Citrus sinensis]
Length=195

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +2

Query  176  VIEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTR  355
            V+ +YQ+++KGLAEK++ L+F+SLGL+ ED+ WFKP    +S   +LQ+NSYP CPDP R
Sbjct  2    VMVEYQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNR  61

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            AMGLAPHTDSS++T LYQ +T  GLQVYR ++ WV + PV  A+V+ VGDLM++  NGRF
Sbjct  62   AMGLAPHTDSSLLTSLYQGNT-SGLQVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRF  120

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVY  712
            KS LHRA+V+N  HRIS AYFYGP  DVKI P VKL     P +Y+ ++W+EYL  K  +
Sbjct  121  KSALHRALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATH  180

Query  713  FFKSLEKVRFN  745
            F K++E +R++
Sbjct  181  FNKAIELIRYD  191



>ref|XP_010434144.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Camelina sativa]
Length=351

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 171/252 (68%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  101  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVLGSSLRRHATLLWPDDHAEFCNVM  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+++L  SLGL+ ED+ W  P   G   +S  S LQ+NSYP CPDP 
Sbjct  161  EEYQKAMDDLSLRLITMLMASLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPVCPDPH  220

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD---LNWVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++VI +GDL  + S
Sbjct  221  LAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEEGSRWIGVEPIEGSLVIIMGDLSHIIS  279

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG+F++ +HRAVV+  HHR+S AYF GP  +++I  P+  +K+  P+Y+ L W+EYLA K
Sbjct  280  NGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQIG-PLACDKNHPPIYRRLLWEEYLAAK  338

Query  704  DVYFFKSLEKVR  739
              +F ++L   R
Sbjct  339  ATHFNRALTLFR  350



>emb|CDY31424.1| BnaC03g64000D [Brassica napus]
Length=350

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 167/253 (66%), Gaps = 10/253 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+       A  +WP+D++ FC+VI
Sbjct  100  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMDSSLRRHATLLWPDDHAEFCNVI  159

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ++M  L+ +LVS++  SLGL+ ++  W  P   G    S+ S LQ+NSYP CPDP 
Sbjct  160  EEYQKEMANLSHRLVSMVMGSLGLTHKEFRWLVPNITGSRTNSSQSFLQLNSYPVCPDPD  219

Query  353  RAMGLAPHTDSSIITVLYQSDT----LRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELA  520
             AMGLAPHTDSS++T+LYQ +     ++ LQ  +    W+ +EPV+  +V+ +GDL  + 
Sbjct  220  LAMGLAPHTDSSLLTILYQGNIPGLEIQNLQAEKS--RWIGVEPVEGGLVVIMGDLSHII  277

Query  521  SNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAV  700
            SNGRFKS +HRAVV+  HHR+S AYF GP  ++ I  P+  + D  P+Y+ L+W+EYLA 
Sbjct  278  SNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLHIG-PLTADTDHPPLYRRLTWEEYLAA  336

Query  701  KDVYFFKSLEKVR  739
            K  +F K+L   R
Sbjct  337  KATHFNKALSLFR  349



>sp|O24648.1|G3OX_PEA RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; AltName: Full=Gibberellin 3 beta-hydroxylase 
1 [Pisum sativum]
 gb|AAB65829.1| 2-oxoglutarate-dependent dioxygenase [Pisum sativum]
 gb|AAC49792.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 157/248 (63%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+  +GYGI   S  F   MW EGFT+VG P     R +WP+DY+ FCD++
Sbjct  108  HQKHKATRSPDGVSGYGIARISSFFPKLMWYEGFTIVGSPLDHF-RELWPQDYTRFCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LA  L+ L+  SLG++ ED++W       E   + LQ+NSYP CPDP  AM
Sbjct  167  VQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDHAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L Q+D + GLQV R    W+ + P++  +V+NVGDL  + SNG + S
Sbjct  227  GLAPHTDSTFLTILSQND-ISGLQVNREGSGWITVPPLQGGLVVNVGDLFHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_006451038.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
 gb|ESR64278.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
Length=193

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (76%), Gaps = 2/188 (1%)
 Frame = +2

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +YQ+++KGLAEK++ L+F+SLGL+ ED+ WFKP    +S   +LQ+NSYP CPDP RAMG
Sbjct  3    EYQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMG  62

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTDSS++T LYQ +T  GLQVYR ++ WV + PV  A+V+ VGDLM++  NGRFKS 
Sbjct  63   LAPHTDSSLLTSLYQGNT-SGLQVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRFKSA  121

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
            LHRA+V+N  HRIS AYFYGP  DVKI P VKL     P +Y+ ++W+EYL  K  +F K
Sbjct  122  LHRALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATHFNK  181

Query  722  SLEKVRFN  745
            ++E +R++
Sbjct  182  AIELIRYD  189



>gb|KFK43811.1| hypothetical protein AALP_AA1G176200 [Arabis alpina]
Length=358

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 166/247 (67%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFT+ G P ++  R++WP+ +  +CD++
Sbjct  109  QRKLKAARSETGVSGYGVARIASFFNKQMWSEGFTISGSPLNDF-RKLWPKLHLNYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E M+ LA KL+ L   SLG+S ED++W +         + LQ+N YP CP P RAM
Sbjct  168  EEYEEHMQKLASKLMWLALNSLGVSEEDIKWARLNSDYNWAQAALQLNHYPVCPQPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS++T+LYQ++T  GLQ++R D+ WV + PV  ++V+NVGDL  + SNG FKS
Sbjct  228  GLAAHTDSSLLTILYQNNT-AGLQLFRDDIGWVTVPPVPGSLVVNVGDLFHILSNGLFKS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V+    R+SVA+ +GP  D KI P  KL +    P+Y++++W EYL  K  +F 
Sbjct  287  VLHRARVNQTRSRLSVAFLWGPQSDTKISPVPKLVSPFESPLYRSVTWTEYLRTKATHFN  346

Query  719  KSLEKVR  739
            K+L  +R
Sbjct  347  KALSMIR  353



>ref|XP_007013765.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
 gb|EOY31384.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
Length=342

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 167/249 (67%), Gaps = 9/249 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QK++A R P  +TGYG+   S  F   MW EGFTV+G P    AR +WP D + FCDVI
Sbjct  101  QQKMKALREPAGATGYGLARISPFFPKYMWHEGFTVMGSPVDH-ARALWPNDNARFCDVI  159

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ++MK LAE+L  L+ +SL +S ED+ W    G P +    LQ+NSYP CPDP R M
Sbjct  160  ERYQKKMKVLAEQLTHLILESLDVSLEDLSW--DVGSPSTA---LQLNSYPSCPDPNRTM  214

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S +T+L+QS ++ GLQ+++  + W+ + P+  A+V+NVGDL+ + SN RF S
Sbjct  215  GLAPHTDTSFLTLLHQS-SISGLQIFKEGVGWLSVRPIAGALVVNVGDLLHILSNARFPS  273

Query  542  LLHRAVVS-NAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYF  715
            +LHRAVV+ +  HR+SVAYFYG   D  + P  KL   G  P Y++++ KEY+ +K   F
Sbjct  274  VLHRAVVNRDGCHRLSVAYFYGIPTDCNVSPLAKLLNSGHTPRYRSVTVKEYVILKAKNF  333

Query  716  FKSLEKVRF  742
             ++L  +R 
Sbjct  334  EEALSLIRI  342



>ref|XP_002869872.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46131.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 170/252 (67%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  98   HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVMGSSLRRHATLLWPDDHAEFCNVM  157

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+S+L  SL L+ ED+ W  P   G   +S  S LQ+NSYP CPDP 
Sbjct  158  EEYQKAMDDLSHRLISMLMGSLRLTREDLGWLVPDKTGSGTDSIQSFLQLNSYPVCPDPH  217

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD---LNWVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++V+ +GDL  + S
Sbjct  218  LAMGLAPHTDSSLLTILYQGN-IPGLEIESPQEEGSRWIGVEPIEGSLVVIMGDLSHIIS  276

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG+F+S +HRAVV+  HHR+S AYF GP  +++I  P+  +K+  P+Y+ L W+EYLA K
Sbjct  277  NGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQIG-PLTSDKNHPPIYRRLIWEEYLAAK  335

Query  704  DVYFFKSLEKVR  739
              +F K+L   R
Sbjct  336  ATHFNKALNLFR  347



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 167/248 (67%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDY-SLFCDV  178
            ++KL+A RS    +GYG+   S  FN +MW EGFT+ G P ++  R++WP+ +   +CD+
Sbjct  109  QRKLKAARSDTGFSGYGVARISSFFNKQMWSEGFTITGSPLNDF-RKLWPQHHLKNYCDI  167

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y+EQM+ LA KL+ L   SLG+S ED++W           S LQ+N YP CP+P RA
Sbjct  168  VEEYEEQMQTLASKLMWLSLTSLGVSEEDIKWATANPDLNWAQSALQLNHYPVCPEPDRA  227

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++T+L+Q++T  GLQV+R DL WV + PV  ++V+NVGDL  + SNG FK
Sbjct  228  MGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFK  286

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA V+    R SVA+ +GP  D+KI P  KL +    P+Y++++W EYL  K  +F
Sbjct  287  SVLHRARVNQTRSRFSVAFLWGPQSDIKISPVPKLVSLVESPLYRSVTWTEYLRTKATHF  346

Query  716  FKSLEKVR  739
             ++L  +R
Sbjct  347  NEALSMIR  354



>gb|AAC49794.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 157/248 (63%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+  +GYGI   S  F   MW EGFT+VG P     R +WP+DY+ FCD++
Sbjct  108  HQKHKATRSPDGVSGYGIARISSFFPKLMWYEGFTIVGSPLDHF-RELWPQDYTRFCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LA  L+ L+  SLG++ ED++W       E   + LQ+NSYP CPDP  AM
Sbjct  167  VQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDHAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L Q+D + GLQV R    W+ + P++  +V+NVGDL  + SNG + S
Sbjct  227  GLAPHTDSTFLTILSQND-ISGLQVNREGSGWITVPPLQGGLVVNVGDLFYILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_006301281.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
 gb|EOA34179.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
Length=355

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 164/247 (66%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A R     +GYG+   +  FN +MW EGFTVVG P  +  R++WP  +  +C++I
Sbjct  102  HQKLKAARLENGVSGYGVARIASFFNKKMWSEGFTVVGSPLHDF-RKLWPSHHLEYCEII  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E Y+E M+ LA KL+ L   SLG+   D++W  P    + T + +Q+N YP CP+P R+M
Sbjct  161  EAYKEHMQKLAAKLMWLALGSLGVEENDIKWAGPNSDFQGTQAAIQLNHYPICPEPERSM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R D+ WV + P+  ++V+NVGDL+ + +NG F S
Sbjct  221  GLAAHTDSTLLTILYQNNT-AGLQVFRDDVGWVTVPPIPGSLVVNVGDLLHILTNGIFPS  279

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP+ DV I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  280  VLHRARVNHVRSRFSMAYLWGPSSDVMISPLPKLVDPLQSPLYPSLTWKQYLATKATHFN  339

Query  719  KSLEKVR  739
             SL  +R
Sbjct  340  HSLSIIR  346



>gb|AAC96017.1| defective gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96015.1| gibberellin 3B-hydroxylase [Pisum sativum]
Length=374

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 157/248 (63%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+  +GYGI   S  F   MW EGFT+VG P     R +WP+DY+ FCD++
Sbjct  108  HQKHKATRSPDGVSGYGIARISSFFPKLMWYEGFTIVGSPLDHF-RELWPQDYTRFCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LA  L+ L+  SLG++ ED++W       E   + LQ+NSYP CPDP  AM
Sbjct  167  VQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDHAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L Q+D + GLQV R    W+ + P++  +V+NVGDL  + SNG + S
Sbjct  227  GLAPHTDSTFLTILSQND-ISGLQVNREGSGWITVPPLQGGLVVNVGDLFYILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_010439443.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=353

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 170/254 (67%), Gaps = 10/254 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  101  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVLGSSLRRHATLLWPDDHAEFCNVM  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP-----GGLPESTGSILQMNSYPKCPD  346
            E+YQ+ M  L+ +L+++L  SLGL+ ED+ W  P     G    S  S LQ+NSYP CPD
Sbjct  161  EEYQKAMDDLSLRLITMLMGSLGLTHEDLGWLVPDKTGSGTDSNSIQSFLQLNSYPVCPD  220

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD---LNWVDIEPVKDAVVINVGDLMEL  517
            P  AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++VI +GDL  +
Sbjct  221  PHLAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEEGSRWIGVEPIEGSLVIIMGDLSHI  279

Query  518  ASNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLA  697
             SNG+F++ +HRAVV+  HHR+S AYF GP  +++I  P+  +K+  P+Y+ L W+EYLA
Sbjct  280  ISNGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQIG-PLACDKNHPPIYRRLLWEEYLA  338

Query  698  VKDVYFFKSLEKVR  739
             K  +F ++L   R
Sbjct  339  AKATHFNRALTLFR  352



>gb|AAC86820.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
 gb|AAC49793.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 156/248 (63%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QK +A RSP+  +GYGI   S  F   MW EGFT+VG P     R +WP+DY+ FCD++
Sbjct  108  HQKHKATRSPDGVSGYGIARISSFFPKLMWYEGFTIVGSPLDHF-RELWPQDYTRFCDIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LA  L+ L+  SLG++ ED++W       E   + LQ+NSYP CPDP  AM
Sbjct  167  VQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDHAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GL PHTDS+ +T+L Q+D + GLQV R    W+ + P++  +V+NVGDL  + SNG + S
Sbjct  227  GLTPHTDSTFLTILSQND-ISGLQVNREGSGWITVPPLQGGLVVNVGDLFHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F 
Sbjct  286  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFN  345

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  346  KALSSVRL  353



>ref|XP_002324270.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEF02835.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=341

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 165/247 (67%), Gaps = 8/247 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A RSP  +TGYG+   S  F+ +MW EGFTV+G P  + AR +WP DY  FCDV+E
Sbjct  102  HKLKALRSPGGATGYGLARISPFFSKKMWHEGFTVMGSP-VDHARELWPNDYQRFCDVME  160

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDV-EWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             YQ++MK LA  L+ L+ KSL LS E++ +   PGG      + LQ+NSYP CPDP+R M
Sbjct  161  DYQKKMKELAITLMHLILKSLDLSEEEISKVVSPGG----ASTALQLNSYPFCPDPSRVM  216

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S++T+LYQS T+ GL++++  + WV + P   ++V+NVGDL+ + SN +F S
Sbjct  217  GLAPHTDTSLLTILYQS-TINGLEIFKDGVGWVLVSPTNGSLVVNVGDLLHILSNAQFPS  275

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +LHR V+     R+S+AYFY P  D  +  P+ LN    P+Y+++S +EY+ +K     K
Sbjct  276  VLHRVVLKEKQQRLSLAYFYSPPTDFDVS-PLALNPAQIPLYRSVSVREYIHIKAKNVEK  334

Query  722  SLEKVRF  742
            +L  +R 
Sbjct  335  ALSLIRI  341



>ref|XP_008352044.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 163/247 (66%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP  +TGYG    S  F+  MW EGFT++G P    A+++WP+DY  FCD I
Sbjct  102  DQKLKALRSPGGATGYGRPHISPFFDRHMWQEGFTIMGSPIDH-AKQLWPQDYQGFCDTI  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ QMK LAEK++ + FKSL ++ E++ W    GL  S G+ LQ+NSYP CPDPTRAM
Sbjct  161  DDYQNQMKALAEKIIRIFFKSLNINFEELNWLNDSGL-SSPGTALQLNSYPPCPDPTRAM  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTD+S++T++ QS T  GLQV++  + WV ++PV  A+ + +GD + + SNG + +
Sbjct  220  GMAAHTDTSLVTIVQQSKT-SGLQVFKDGVGWVLVQPVPGALTVXLGDYLHILSNGMYTN  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +LHRAVV+    R S+AYFY P  D  + P +       P Y++L+ KEY+ +K  +  K
Sbjct  279  VLHRAVVNQQIQRFSMAYFYAPPRDFTVSPVLSRVTGQMPKYRSLTVKEYVDLKGKHLEK  338

Query  722  SLEKVRF  742
            +L  ++ 
Sbjct  339  ALSLIQI  345



>ref|XP_010449018.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=351

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 171/252 (68%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  101  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVLGSSLRRHATLLWPDDHAQFCNVM  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+++L  SLGL+ ED+ W  P   G   +S  S LQ+NSYP CPDP 
Sbjct  161  EEYQKAMDDLSLRLITMLMVSLGLTHEDLGWLVPEKTGSGTDSIQSFLQLNSYPVCPDPH  220

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLN---WVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P  +   W+ +EP++ ++VI +GDL  + S
Sbjct  221  LAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEDGSKWIGVEPIEGSLVIIMGDLSHIIS  279

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG+F++ +HRAVV+  HHR S A+F GP  +++I  P+  +K+  P+Y+ L W+EYLA K
Sbjct  280  NGQFRTTMHRAVVNKTHHRFSAAFFAGPPKNLQIG-PLTGDKNHPPIYRRLIWEEYLAAK  338

Query  704  DVYFFKSLEKVR  739
              +F K+L   R
Sbjct  339  ATHFNKALTLFR  350



>ref|XP_006413746.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
 gb|ESQ55199.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
Length=354

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 172/254 (68%), Gaps = 10/254 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPE--DYSLFCD  175
             +K+ A RSP+ STGYG+   S  ++  MW EGF+V+G      A+ +WP+  D++ FC+
Sbjct  102  HRKILAIRSPDESTGYGVARISMFYDKLMWSEGFSVMGSSLQRHAKILWPDPDDHTDFCN  161

Query  176  VIEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPD  346
            V+E+YQ++M  L+ +LVS++  ++GL+ E++ W +P   G   +S  S LQ+NSYP C D
Sbjct  162  VMEEYQKEMGDLSHRLVSMVMGTIGLTHEELRWLEPDIAGTRTDSIQSFLQLNSYPVCSD  221

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRP---DLNWVDIEPVKDAVVINVGDLMEL  517
            P  AMGLAPHTDSS++T+LYQ + + GL++  P   +  W+ ++P++D +V+ +GDL  +
Sbjct  222  PHLAMGLAPHTDSSLLTILYQGN-ISGLEIQNPQEEESRWIGVDPIEDGLVVIMGDLSHI  280

Query  518  ASNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLA  697
             SNGRFKS +HR VV+  HHR++ AYF GP  +++I P +  +KD  P+Y+ L W+EYLA
Sbjct  281  ISNGRFKSTMHRVVVNKTHHRVTAAYFSGPPKNLQIGPLIN-DKDHPPIYRRLIWEEYLA  339

Query  698  VKDVYFFKSLEKVR  739
             K  +F K+L   R
Sbjct  340  AKATHFNKALTLFR  353



>gb|KCW53766.1| hypothetical protein EUGRSUZ_J03019 [Eucalyptus grandis]
Length=349

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 166/256 (65%), Gaps = 25/256 (10%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSPE  +GYG+   S  F  +MW EGFT++G P  E ARR+WP+DYSLFCDVI
Sbjct  104  QQKLKASRSPEGISGYGVAKISAFFPKQMWSEGFTIMGSP-MEHARRLWPQDYSLFCDVI  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSI--LQMNSYPKCPDPTR  355
            EKYQ++MK LAE+L+ L+  SLGL+ ED++W  P G  E TG++  LQ+NSYP CPDP R
Sbjct  163  EKYQKEMKQLAERLMWLMLGSLGLTKEDIKWSSPKG--EFTGAVAALQLNSYPACPDPDR  220

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            AMGLA HTDS+++T+L+Q++T  GLQV +    W+ + P+    V               
Sbjct  221  AMGLAAHTDSTLLTILHQNNT-SGLQVLKEGSGWITVPPLPVHFV---------------  264

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVY  712
               LHRA+V+   HR+SVAY YGP   V++ P P  ++ +  P+Y+ ++W EYL  K  +
Sbjct  265  ---LHRAMVNRTEHRLSVAYLYGPPSWVQVSPLPELIDSNHPPLYKPVTWSEYLGTKAKH  321

Query  713  FFKSLEKVRFNPVAEE  760
            F K+L  VR   +  E
Sbjct  322  FNKALSLVRLCALVNE  337



>ref|XP_002887835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64094.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 166/247 (67%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFTV+G P  +  R++WP  +  +C++I
Sbjct  102  QRKLKAARSENGVSGYGVARIASFFNKKMWSEGFTVIGSPLQDF-RKLWPSHHLKYCEII  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y E M+ LA KL+ L   SLG+  +D++W  P    + T +  Q+N YP CP+P RAM
Sbjct  161  EEYGEHMQKLAAKLMWLALGSLGVEEKDIKWAGPNSDFQGTQAATQLNHYPICPEPDRAM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R D+ WV + PV  ++V+NVGDL+ + +NG F S
Sbjct  221  GLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWVTVPPVPGSLVVNVGDLLHILTNGIFPS  279

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  280  VLHRARVNHVRSRFSMAYLWGPPSDIMISPLPRLVDPLQSPLYPSLTWKQYLATKATHFN  339

Query  719  KSLEKVR  739
            +SL  ++
Sbjct  340  QSLSIIK  346



>gb|KFK42430.1| hypothetical protein AALP_AA2G255300 [Arabis alpina]
Length=354

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 166/247 (67%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RS    +GYG+   +  FN +MW EGFTV+G P  +  R++WP  +  +C++I
Sbjct  106  HRKLKAARSENGVSGYGVARIASFFNKQMWSEGFTVIGSPLDDF-RKLWPNHHVKYCEII  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+E M+ LA KL+ L   SLG+  +D++W  P    +   + +Q+N YP CP+P RAM
Sbjct  165  KEYEEHMQKLAAKLMWLALGSLGVEEKDIKWAWPSSDFQGAQAAIQLNHYPICPEPDRAM  224

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ+DT  GLQV+R D+ WV + PV  ++V+NVGDL+ + +NG F S
Sbjct  225  GLAAHTDSTLLTILYQNDT-AGLQVFRDDVGWVTVPPVPGSLVVNVGDLLHILTNGIFPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  284  VLHRARVNHVRSRFSMAYLWGPPSDLMISPLPQLVDPLQSPLYPSLTWKQYLATKATHFN  343

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  344  QSLSFIR  350



>ref|XP_006285095.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
 gb|EOA17993.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
Length=353

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 169/252 (67%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+ A RSP+ STGYG+V  S  ++  MW EGF+V+G      A  +WP+D++ FC+V+
Sbjct  103  HRKILAVRSPDESTGYGVVRISMFYDKLMWSEGFSVLGSSLRRHATLLWPDDHADFCNVM  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPESTGSILQMNSYPKCPDPT  352
            E+YQ+ M  L+ +L+++L  SLG++ ED+ W  P   G    S  S LQ+NSYP CPDP 
Sbjct  163  EEYQKAMDDLSLRLITMLMGSLGITHEDLGWLVPDKTGSETNSIQSFLQLNSYPVCPDPH  222

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLN---WVDIEPVKDAVVINVGDLMELAS  523
             AMGLAPHTDSS++T+LYQ + + GL++  P      W+ +EP++ ++VI +GDL  + S
Sbjct  223  LAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEEGPRWIGVEPIEGSLVIIMGDLSHIIS  281

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            NG F++ +HRAVV+  HHR+S AYF GP  +++I P +  +K+  P+Y+ L W+EYLA K
Sbjct  282  NGLFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQIGPLIG-DKNHPPIYRRLVWEEYLAAK  340

Query  704  DVYFFKSLEKVR  739
              +F K+L   R
Sbjct  341  ATHFNKTLTLFR  352



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 167/248 (67%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RS +  +GYG+   S  F   MW EGFT++  P  + A+++WP+    FCDVI
Sbjct  95   QQKLKAARSLDGVSGYGVARISSFFPKLMWSEGFTLIDSP-HQHAQKLWPQGSGNFCDVI  153

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y ++M  L+ +++ L+  SLG+   D++W    G  +   + LQ+NSYP CPDP RAM
Sbjct  154  EEYNKEMNKLSNRVMWLILGSLGIKKGDIKWANQEGEIKEACAALQLNSYPSCPDPDRAM  213

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+QS+T  GLQV R  + WV ++P+  A+V+N+GDL+++ SNG + S
Sbjct  214  GLAAHTDSTLLTILHQSNT-SGLQVQR-GVGWVTVKPIAGALVVNIGDLIQILSNGLYSS  271

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWKEYLAVKDVYFF  718
            +LHRA+V+   HR+SVAY YGP  +V+I P  KL  +   P+Y+ ++W EYL  K  +F 
Sbjct  272  VLHRAMVNRTQHRLSVAYLYGPPSNVRIAPLSKLTDNVHPPLYRPVTWSEYLGTKAKHFN  331

Query  719  KSLEKVRF  742
            K+L  VR 
Sbjct  332  KALLFVRL  339



>ref|XP_008785607.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=362

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 161/250 (64%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDV  178
             QKL+A RSP    GYG+ P S  F   MW EGFT+ G P  E AR++ P++Y   FC+V
Sbjct  105  HQKLKAARSPGDIAGYGLAPISSFFPKLMWSEGFTIAGSP-FEHARKLLPKEYCAEFCNV  163

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            IE+Y +  K LA +L+ L+  SLGL+ ED+ W  P        +++Q+NSYP CP+P RA
Sbjct  164  IEEYNKVAKELAGRLMHLMLLSLGLTEEDISWAGPIRDSGDLSAVIQLNSYPACPEPDRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGRF  535
            +GLA HTDSS++TVLYQS T  GLQV RPD   WV + P+   ++++VGDL  + SNG F
Sbjct  224  LGLAAHTDSSLLTVLYQSGT-SGLQVLRPDPARWVTVPPLPGVLIVHVGDLSHILSNGHF  282

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVY  712
            +S+LHRAVV+  HHR+S AY  GP   VK+ P  + L     P Y+ ++W EYLA+K   
Sbjct  283  RSVLHRAVVNRRHHRLSAAYICGPPAHVKVSPIDIFLGPSQGPAYRAVTWPEYLALKGKL  342

Query  713  FFKSLEKVRF  742
            F K+L  ++ 
Sbjct  343  FNKALASIKL  352



>ref|XP_011026517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=341

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 163/247 (66%), Gaps = 8/247 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A RSP  +TGYG+   S  F+ +MW EGFTV+G P    AR +WP DY  FCDV+E
Sbjct  102  HKLKALRSPGGATGYGLARISPFFSKKMWHEGFTVMGSPVDH-ARELWPTDYQRFCDVME  160

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDV-EWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             YQ++MK LA  L+ L+ KSL LS E++ +   PG       + LQ+NSYP CPDP+R M
Sbjct  161  DYQKKMKELAITLMHLILKSLDLSEEEISKVVSPG----CASTALQLNSYPFCPDPSRVM  216

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S++T+L+QS T+ GL++++  + WV + P   ++V+NVGDL+ + SN +F S
Sbjct  217  GLAPHTDTSLLTILHQS-TINGLEIFKDGVGWVLVSPTNGSLVVNVGDLLHILSNAQFPS  275

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +LHR V+     R+S+AYFY P  D  +  P+ LN    P+Y+++S +EY+ +K     K
Sbjct  276  ILHRVVLKEKQQRLSLAYFYSPPTDFHVS-PLALNPAEIPLYRSVSVREYIHIKAKNLEK  334

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  335  ALSLVRI  341



>gb|KDO58203.1| hypothetical protein CISIN_1g043985mg [Citrus sinensis]
Length=350

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 165/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+  RSP++  GYG    S  F+  MW EGFT VG P     + +WP+DY++ C+V+
Sbjct  106  EQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFTNVGSPLDHFCQ-LWPQDYNMHCNVV  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LAE+L+ L+ +SLG + ED++W    G  +   S L  N YP CPDP RAM
Sbjct  165  EEYKKEMKKLAERLMCLILRSLGTTREDIKWPGLNGDFKDHPSPLNFNYYPACPDPDRAM  224

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS+ T+LYQ +++ GLQV R    WV + PV DA+V+NVGD++ + SNG + S
Sbjct  225  GLAAHTDSSLFTILYQ-NSVSGLQVLREGTGWVTVPPVSDALVVNVGDMLHILSNGLYPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAV +   +R+S+AYFYG   D++I P   L      P+Y+++SW EYL +K  +F 
Sbjct  284  VLHRAVATRK-NRLSIAYFYGLPSDLQISPLENLVGPSQPPLYRSISWSEYLRMKAKHFN  342

Query  719  KSLEKVR  739
            K+L  VR
Sbjct  343  KALSFVR  349



>ref|XP_009355033.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=362

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 160/251 (64%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R P+  +GYG    S       W E FT VG P  E  R++WP+DY+ FC + 
Sbjct  108  QQKLKATRLPDGFSGYGFHRISAFCEKLTWSESFTTVGSP-LEHFRQLWPQDYTKFCCIA  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +MK LA +L+ L+  SLG+S ED++W  P G  E   ++LQ NSYP CPDP R M
Sbjct  167  EEYEREMKRLAARLMWLMLGSLGISKEDIKWAGPRGEFEDASAVLQFNSYPACPDPDRTM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYR---PDLNWVDIEPVKDAVVINVGDLMELASNGR  532
            GLA HTDS++I++++QS    GLQV+R       W+ + PV  A VINVGD + + SNG 
Sbjct  227  GLAQHTDSTLISIVHQSSNASGLQVFRQGEQGRGWLMVPPVPGAFVINVGDFIHMLSNGL  286

Query  533  FKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDV  709
            ++++LHRAVV+ + HR+SVAY YGP+ +V++ P  K L     P+Y  L+W EYL  K  
Sbjct  287  YQNVLHRAVVNRSQHRVSVAYLYGPSENVQVSPLSKLLGPSCPPLYPPLTWNEYLGTKAK  346

Query  710  YFFKSLEKVRF  742
               K+LE +R 
Sbjct  347  LHNKALESLRL  357



>ref|XP_010914990.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=360

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 170/255 (67%), Gaps = 13/255 (5%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVW-PEDYSLFCDV  178
             QKL+A RSP + +GYG+ P S  F+  MW EGFT+ G P  E AR++W PED   FCDV
Sbjct  103  HQKLKAARSPGNISGYGLAPISSFFSKLMWSEGFTIAGSP-LEHARKLWRPEDSGEFCDV  161

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP----GGLPESTGSILQMNSYPKCPD  346
            IE+Y+E MK LA +L+ L+  SLGL+ ED+ W  P    G LP    ++LQ+NSYP CP+
Sbjct  162  IEEYKEVMKELAGRLLHLMLLSLGLTEEDISWAGPVRETGDLP----AVLQLNSYPACPE  217

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELAS  523
            P RA+GLA HTDSS++TVLYQS T  GLQV RPD   WV + P+  A+V+NVGDL  + S
Sbjct  218  PDRAIGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVTVPPLPGALVVNVGDLSHILS  276

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAV  700
            NG+F+S+LHRAVV+   HR+S AY  GP   VK+ P  KL      P Y+ ++W EYL +
Sbjct  277  NGQFRSVLHRAVVNRTRHRLSAAYICGPPAHVKVSPVDKLVGPSEGPAYRAVTWPEYLGL  336

Query  701  KDVYFFKSLEKVRFN  745
            K   F K+L  ++ +
Sbjct  337  KRKLFNKALASIKIS  351



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/260 (47%), Positives = 161/260 (62%), Gaps = 10/260 (4%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A RSP   TGYGI   S  F+   W EGFT+VG P  E AR++WP+D + FC  IE
Sbjct  96   QKLKAARSPGGVTGYGIANISAFFSKLFWSEGFTIVGSPHDE-ARKLWPDDSAEFCGAIE  154

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG--LPESTGSILQMNSYPKCPDPTRA  358
            +Y   MK L  +L+ L+  SLGLS  +++W  P      E+   ++Q+NSYP CPDP RA
Sbjct  155  EYTSWMKPLGCRLMLLMLASLGLSEGEIDWAVPSNDTTHEAPAPVIQLNSYPACPDPDRA  214

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPD-----LNWVDIEPVKDAVVINVGDLMELAS  523
            MGLA HTDSS+ TVLYQ  ++RGLQ+   +       WV + P+  A+V+NVGDL  + S
Sbjct  215  MGLAEHTDSSLFTVLYQG-SVRGLQLLHGNHPTRRARWVTVPPLPGALVVNVGDLSHILS  273

Query  524  NGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAV  700
            NGRF+S+ HRA+V+    RISVAYFYGP    KI P  KL      P Y+ ++W EYL +
Sbjct  274  NGRFQSVTHRAIVNRTQTRISVAYFYGPPAHFKIAPIEKLMGPQQGPAYRAVTWPEYLTL  333

Query  701  KDVYFFKSLEKVRFNPVAEE  760
            K   + ++L  +R     EE
Sbjct  334  KRRLYNQALASIRLPTEGEE  353



>ref|NP_001267625.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28484.1| GA 3-oxidase [Cucumis sativus]
 gb|KGN45325.1| hypothetical protein Csa_7G435500 [Cucumis sativus]
Length=374

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 162/248 (65%), Gaps = 3/248 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R+P+  TGYG+   S  F  RMW EGFT+VG P  E  +++WP +YS +CD+ E
Sbjct  112  HKLKAARTPDGVTGYGLPRISTFFPKRMWSEGFTIVGSP-LEHFQKLWPNEYSKYCDITE  170

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y  +MK L  +++ L    LG++ EDV W +  G  +++ +++Q+NSYP CPDP RAMG
Sbjct  171  EYSREMKSLCGRVIWLALGELGITREDVNWAEANGDFKTSNAVIQLNSYPVCPDPDRAMG  230

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L  HTD+S++T+LYQ++T RGLQV R    WV +EPV  A+V+ VGDL+ + +NG + S 
Sbjct  231  LGAHTDTSLLTILYQNNT-RGLQVLREGNRWVMVEPVTGALVVQVGDLLHILTNGLYPSS  289

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
             H+AVV+    RIS+AYF+GP+   +I P  KL     P +Y T++W EYL  K   F  
Sbjct  290  AHQAVVNQNRKRISIAYFFGPSESAEISPLNKLVTPTQPLLYPTVTWTEYLRKKAQLFNN  349

Query  722  SLEKVRFN  745
            +L  +R +
Sbjct  350  TLSSIRLS  357



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 156/249 (63%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  110  HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  169  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  228

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  229  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  287

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F
Sbjct  288  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHF  347

Query  716  FKSLEKVRF  742
             K+L  V  
Sbjct  348  NKALSSVSL  356



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 165/249 (66%), Gaps = 8/249 (3%)
 Frame = +2

Query  8    KLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIEK  187
            K++A RSP  +TGYG+   +  FN  MW EGFT++G P  E AR VWP  Y  FC+V+E 
Sbjct  110  KVKALRSPSGATGYGVARIAPFFNKFMWHEGFTMMGSP-LEHAREVWPHGYRKFCEVMED  168

Query  188  YQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMGL  367
            YQ++MK L+E+L++++ K LG+S  DV+W +   L  +  + LQ+NSYP+CPDP +AMGL
Sbjct  169  YQDKMKALSERLLAMILKYLGMSEHDVDWPR---LRSNACTALQLNSYPRCPDPRQAMGL  225

Query  368  APHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSLL  547
            APHTD+ ++T+L+Q+ +  GLQV+R    WV + P+  A+V+NVGD++ + SN  F S++
Sbjct  226  APHTDTFLLTILHQNHSAHGLQVHREGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVV  285

Query  548  HRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLN----KDGFPMYQTLSWKEYLAVKDVYF  715
            HRA+ S   HR++V YFYGP  D  + P  +L     ++    +++++ K+Y+ +K    
Sbjct  286  HRAIPSENTHRLTVGYFYGPPTDFHVGPIHRLTQASGREDAAQFRSVTVKDYIQMKAKNL  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  DKALSMIRI  354



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 164/247 (66%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+  RSP++  GYG    S  F+  MW EGFT VG P     + +WP+DY++ C+V+
Sbjct  106  EQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFTNVGSPLDHFCQ-LWPQDYNMHCNVV  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LAE+L+ L+ +SLG + ED++W    G  +   S L  N YP CPDP RAM
Sbjct  165  EEYKKEMKKLAERLMCLILRSLGTTREDIKWAGLNGDFKDHPSPLNFNYYPACPDPDRAM  224

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS+ T+L Q +++ GLQV R    WV + PV DA+V+NVGD++ + SNG + S
Sbjct  225  GLAAHTDSSLFTILCQ-NSVSGLQVLREGTGWVTVPPVSDALVVNVGDMLHILSNGLYPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAV +   +R+S+AYFYG   D++I P   L      P+Y+++SW EYL +K  +F 
Sbjct  284  VLHRAVATRK-NRLSIAYFYGLPSDLQISPLENLVGPSQPPLYRSISWSEYLRMKAKHFN  342

Query  719  KSLEKVR  739
            K+L  VR
Sbjct  343  KALSFVR  349



>ref|XP_006382066.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|ERP59863.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=342

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 160/246 (65%), Gaps = 6/246 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A RSP  +TGYG+   S  FN  MW EGFT++G      AR +WP DY  FCDV+E
Sbjct  103  QKLKALRSPGGATGYGLARISPFFNKYMWHEGFTIMGSSIDH-ARDLWPNDYQRFCDVME  161

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++MK LA  L+ L+ KSL +S E++      G      + LQ+NSYP CPDP RAMG
Sbjct  162  DYQKKMKELAVTLMHLVLKSLDISEEEISRVVSAG---GDSTALQLNSYPLCPDPNRAMG  218

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S++T+L+QS T+ GLQ+++  + WV + P   ++V+NVGDL+ + SN +F+S+
Sbjct  219  LAPHTDTSLLTILHQS-TVNGLQIFKEGVGWVLVSPTNGSLVVNVGDLLHILSNAQFRSV  277

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFKS  724
            LHR V+     R+S+AYFY    D  I  P+ LN    P+Y+++S ++Y+ +K     K+
Sbjct  278  LHRVVMKENQQRLSLAYFYCLPSDFHIS-PLALNSTQMPLYRSVSVRDYIGIKAKNLEKA  336

Query  725  LEKVRF  742
            L  +R 
Sbjct  337  LSLIRI  342



>ref|XP_009372969.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP  +TGYG    S  F+  MW EGFT++G P  + A+++WP+DY  FCD +
Sbjct  102  DQKLKALRSPGGATGYGCPHISPFFDKHMWQEGFTIMGSP-VDHAKQLWPQDYQGFCDTM  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ QMK LA+KL+ + FKSL ++ E+ +W    GL  S  + LQ+NSYP CPDPTRA+
Sbjct  161  DDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSGL-SSPSTALQLNSYPPCPDPTRAL  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTD+S++T++ QS T  GLQV++    WV ++P+  A+ +N+GD + + SNG F S
Sbjct  220  GMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALTVNLGDYLHILSNGMFTS  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HR VV+    R S+AYFY P  D  + P +    +  P Y++L+ KEY+ +K  +  K
Sbjct  279  VRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSRVLEKVPKYRSLTVKEYVDIKGKHLEK  338

Query  722  SLEKVR  739
            +   ++
Sbjct  339  AFSLIQ  344



>ref|XP_006465424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
Length=350

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 165/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+  RSP++  G G    S  F+  MW EGFT VG P     R+ WP+DY++ C+V+
Sbjct  106  EQKLKVARSPDAFEGNGFARISSFFSKLMWYEGFTNVGSPLDHF-RQFWPQDYNMHCNVV  164

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LAE+L+ L+ +SLG + ED++W    G  +   S L +N YP CPDP RAM
Sbjct  165  EEYKKEMKKLAERLMCLILRSLGTTREDIKWPGLNGDFKDHPSPLNLNYYPACPDPDRAM  224

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDSS+ T+LYQ +++ GLQV R    WV + PV DA+V+NVGD++ + SNG + S
Sbjct  225  GLAAHTDSSLFTILYQ-NSVSGLQVLREGTGWVTVPPVWDALVVNVGDMLHILSNGLYPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRAV +   +R+S+AYFYG   D++I P   L      P+Y+++SW EYL +K  +F 
Sbjct  284  VLHRAVATRK-NRLSIAYFYGLPSDLQISPLENLVGPSQPPLYRSISWSEYLRMKAKHFN  342

Query  719  KSLEKVR  739
            K+L  VR
Sbjct  343  KALSFVR  349



>gb|AGQ42612.1| GA3ox3 [Vitis vinifera]
Length=359

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 169/254 (67%), Gaps = 5/254 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDV  178
            EQKL+A R P+  +G+G    +  F  +MW EGFTV+G P  EL  ++WPE+Y   FC+V
Sbjct  104  EQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTVLGSP-LELVSKLWPEEYCTKFCEV  162

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
             E+Y +QMK LA KL+ LL  SLG++ EDVEW  P G  E   + LQ+NSYP CP P +A
Sbjct  163  TEEYDKQMKQLANKLLWLLLGSLGINKEDVEWAGPEGQLEGAHAALQLNSYPACPQPDKA  222

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDSS++T+LYQ  T  GLQV      W+ + P+  A+V+N+GDL+ + SN  F 
Sbjct  223  MGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWITVPPLPGALVVNIGDLLHILSNAAFP  281

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+N+  RISVAYFYGP   + + P P  ++    P+Y++++W E+LA K  +F
Sbjct  282  SVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKLVDSSHPPVYRSVTWSEFLATKAKHF  341

Query  716  FKSLEKVRFNPVAE  757
             K+L  VR  PV E
Sbjct  342  NKALSLVRM-PVPE  354



>ref|XP_002284981.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI36204.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 169/254 (67%), Gaps = 5/254 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDV  178
            EQKL+A R P+  +G+G    +  F  +MW EGFTV+G P  EL  ++WPE+Y   FC+V
Sbjct  104  EQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTVLGSP-LELVSKLWPEEYCTKFCEV  162

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
             E+Y +QMK LA KL+ LL  SLG++ EDVEW  P G  E   + LQ+NSYP CP P +A
Sbjct  163  TEEYDKQMKQLANKLLWLLLGSLGINKEDVEWAGPEGQLEGAHAALQLNSYPACPQPDKA  222

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDSS++T+LYQ  T  GLQV      W+ + P+  A+V+N+GDL+ + SN  F 
Sbjct  223  MGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWITVPPLPGALVVNIGDLLHILSNAAFP  281

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+N+  RISVAYFYGP   + + P P  ++    P+Y++++W E+LA K  +F
Sbjct  282  SVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKLVDSSHPPVYRSVTWSEFLATKAKHF  341

Query  716  FKSLEKVRFNPVAE  757
             K+L  VR  PV E
Sbjct  342  NKALSLVRM-PVPE  354



>ref|XP_008461055.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
2-like [Cucumis melo]
Length=375

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 160/248 (65%), Gaps = 4/248 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R+P+   GYG+   S  F  RMW EGFT+VG P  E  +++WP++YS +CD+ E
Sbjct  111  HKLKAARTPDGVAGYGLPRISTFFPKRMWSEGFTIVGSP-LEHFQKLWPDEYSKYCDLTE  169

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRAM  361
            +Y  +M  L  +L+ L    LG++ EDV W    G    ST +++Q+NSYP CPDP RAM
Sbjct  170  EYSREMGSLCGRLIWLALGELGITQEDVNWAGSNGDFKTSTNAVIQLNSYPICPDPDRAM  229

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GL  HTDSS++T+LYQ+++ RGLQV R    WV +EPV  A+V+ VGDL+ + +NG + S
Sbjct  230  GLGAHTDSSLLTILYQNNS-RGLQVLREGNRWVMVEPVNGALVVQVGDLLHILTNGLYLS  288

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
             +H+AVV+    RIS+AYF+GP+  V+I P  KL     P +Y T++W EYL  K   F 
Sbjct  289  SVHQAVVNQTQKRISIAYFFGPSEGVEISPINKLVTPTRPLLYPTITWTEYLRKKAKLFN  348

Query  719  KSLEKVRF  742
             +L  +R 
Sbjct  349  NTLSSIRL  356



>ref|XP_003597810.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 ref|XP_003597814.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 gb|AES68061.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=371

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 156/249 (63%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY+  CD +
Sbjct  104  HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKHCDTV  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  163  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  222

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  223  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  281

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  YF
Sbjct  282  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKYF  341

Query  716  FKSLEKVRF  742
             K+L  V  
Sbjct  342  NKALSSVSL  350



>ref|XP_004135830.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CBX88045.1| gibberellin 3-oxidase, partial [Cucumis sativus]
 gb|KGN45321.1| hypothetical protein Csa_7G434970 [Cucumis sativus]
Length=374

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 160/247 (65%), Gaps = 3/247 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R  +  +GYG+V  S  F  RMW EGFT+VG P  E  R++WP DY+ +CD++E
Sbjct  111  HKLKAARPSDGISGYGLVRISSFFPKRMWSEGFTIVGSP-LEHFRKLWPHDYTRYCDIVE  169

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y  +MK L  +L+ +    LG++ EDV W  P G  +++ +  Q+NSYP CPDP RAMG
Sbjct  170  EYDREMKSLCGRLMWVALGELGITREDVNWAGPNGDFKTSNAATQLNSYPVCPDPDRAMG  229

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L  HTD+S++T++YQ++T RGLQV R    WV +EPV  A+V+ VGDL+ + +NG + S 
Sbjct  230  LGAHTDTSLLTIVYQNNT-RGLQVLREGNRWVTVEPVPGALVVQVGDLLHILTNGLYPSP  288

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +H+AVV+    R+SVAY +GP    +I P  K L     P+Y+T++W EYL  K  +F  
Sbjct  289  VHQAVVNRTRKRLSVAYVFGPPESAEISPLKKLLGPTQPPLYRTVTWTEYLRKKAEHFNN  348

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  349  ALSSVRL  355



>ref|XP_002282411.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI20992.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 163/251 (65%), Gaps = 6/251 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K++A R P   TGYG    S  +   MW EGFT++G    + AR++WP+DY  FCDV+
Sbjct  107  HEKMKALRLPSGGTGYGQARISPFYPKFMWHEGFTIMGSA-VDHARKLWPDDYKGFCDVM  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ++MK LAE L+ +  +SL +S E+          E+  + LQ+NSYP CPDP RAM
Sbjct  166  EDYQKKMKELAESLLHIFLESLDISKEEYRSTTIQRGREACNTALQLNSYPPCPDPNRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS + T+++QS T  GLQ+ R  + W+ + P++ A+V+NVGDL+ + SNGR+ S
Sbjct  226  GLAPHTDSLLFTIVHQSHT-SGLQILRDGVGWITVFPLEGALVVNVGDLLHILSNGRYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG----FPMYQTLSWKEYLAVKDV  709
            +LHRAVV+ A HRIS+AYFYGP  D  I P   L   G     P Y+++S KEY+ +K+ 
Sbjct  285  VLHRAVVNQAEHRISLAYFYGPPADSLISPLCNLVSSGQQVVAPRYRSVSVKEYVDLKEK  344

Query  710  YFFKSLEKVRF  742
            +  K+L  +R 
Sbjct  345  HKEKALSLLRL  355



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 155/249 (62%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  110  HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  169  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  228

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV      WV + P+   +V+NVGDL  + SNG + 
Sbjct  229  MGLAPHTDSTFLTILSQND-ISGLQVQGEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  287

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F
Sbjct  288  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHF  347

Query  716  FKSLEKVRF  742
             K+L  V  
Sbjct  348  NKALSSVSL  356



>ref|XP_006389782.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
 gb|ESQ27068.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
Length=358

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 163/247 (66%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RS    +GYG+   +  FN +MW EGFTV+G P  +   ++WP  +  +C++I
Sbjct  104  HRKLKAARSENGISGYGVARIASFFNKQMWSEGFTVIGSPLDDF-HKLWPMHHLKYCEII  162

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+E M+ LA +L+ L   SLG+  +D+ W       +   + +Q+N YP CP+P RAM
Sbjct  163  TEYEEHMQKLAARLMWLALGSLGVDEKDINWAGLSSDFQGAQAAIQLNHYPICPEPDRAM  222

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T+ GLQV+R D+ WV + PV  ++V+NVGDL+ + +NG F S
Sbjct  223  GLAAHTDSTLMTILYQNNTI-GLQVFRDDVGWVTVPPVPGSLVVNVGDLLHILTNGIFPS  281

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  +N    P+Y +L+WK+YLA K  +F 
Sbjct  282  VLHRARVNHVRSRFSIAYLWGPPSDLMISPLPKLVNPLHSPLYPSLTWKQYLATKATHFN  341

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  342  QSLSFIR  348



>ref|XP_003529820.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN01362.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=378

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 164/264 (62%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F   MW E FT++  P  +L  ++WP+DY+ +CD++
Sbjct  107  HQKLKAARSPDGVSGYGRARISSFFPKLMWSECFTILDSP-LDLFLKLWPQDYAKYCDIV  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+  MK LA KL+ L+  SLG++ ED +W  P G      + L +NSYP CPDP RAM
Sbjct  166  VEYEAAMKKLAAKLMCLMLASLGITKEDTKWAGPKGEFNGACAALHLNSYPSCPDPDRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++ + GLQV +    WV + P+   +VINVGDL+ + SNG + S
Sbjct  226  GLAAHTDSTLLTILHQNN-VNGLQVLKEGEGWVAVPPLHGGLVINVGDLLHILSNGLYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHR  V+    R SVAY YGP  +V+I P VKL     P +Y+ ++W EYL  K   F 
Sbjct  285  VLHRVRVNRTQQRFSVAYLYGPPANVQISPHVKLVGPTRPALYRPVTWNEYLGTKANLFN  344

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   ++   N +   NE+
Sbjct  345  KALSAVR---LSASINGLFDINED  365



>ref|XP_007135716.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
 gb|ESW07710.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
Length=374

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 167/264 (63%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+   GYG    S  F   MW E FT++  P   L  ++WP++Y+ +C+++
Sbjct  108  HQKLKAARSPDGVAGYGRARISSFFPKLMWSECFTILDSP-LHLFLQLWPQEYAKYCEIV  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+  MK LA KL+ L+  SLG+S ED++W  P G      + L +NSYP CPDP RAM
Sbjct  167  KEYEAAMKKLAAKLMCLVLASLGISKEDIKWAGPRGEFNGACAALHLNSYPSCPDPDRAM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++ + GLQV +    WV + P+   +VIN+GDL+ + SNG + S
Sbjct  227  GLAAHTDSTLLTILHQNN-VSGLQVLKDGEGWVALPPLAGGLVINIGDLLHILSNGLYPS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHR  V+ +  R SVAY YGP  +V+I P  KL   G P ++Q+++W EYL  K  +F 
Sbjct  286  VLHRVRVNRSRQRFSVAYLYGPPTNVEISPNEKLVGPGRPSLFQSVTWNEYLGKKAKHFN  345

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   V+   N +   NE+
Sbjct  346  KALSAVR---VSSSINGLFDVNED  366



>ref|XP_008461056.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=374

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 159/247 (64%), Gaps = 3/247 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R  +  +GYG+V  S  F  RMW EGFT+VG P  E  R++WP DY+ +CD++E
Sbjct  111  HKLKAARPSDGISGYGLVRISSFFPKRMWSEGFTIVGSP-LEHFRKLWPHDYTRYCDIVE  169

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y ++MK L  +L+ +    LG++ EDV W  P G   ++ +  Q NSYP CPDP RAMG
Sbjct  170  EYDQEMKSLCGRLMWVALGELGITREDVNWAGPNGDFMTSNAATQFNSYPVCPDPERAMG  229

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L  HTD+S++T++YQ++T RGLQV R    WV +EPV  A+V+ VGDL+ + +NG + S 
Sbjct  230  LGAHTDTSLLTIVYQNNT-RGLQVLREGNRWVTVEPVPGALVVQVGDLLHILTNGLYPSP  288

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +H+AVV+    R+SVAY +GP    +I P  K L     P+Y+T++W EYL  K  +F  
Sbjct  289  VHQAVVNRTRKRLSVAYVFGPPESAEISPLKKLLGPTQPPLYRTVTWTEYLRKKAEHFNN  348

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  349  ALSSVRL  355



>emb|CDY38661.1| BnaC02g23180D [Brassica napus]
Length=358

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 165/247 (67%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A R  +  +GYG+   +  FN +MW EGFTV+G P  +   ++WP+ +  +C +I
Sbjct  105  HRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIGSPLDDF-HKLWPKQHLKYCKII  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+E M+ LA KL+ L   SLG+  +D+EW  P    +   + +Q+N YP CP+P RAM
Sbjct  164  QEYEEHMQKLAAKLMWLALGSLGVEEKDIEWAGPISDFQGAQAAIQLNHYPICPEPDRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R D+ W+ + PV  ++V+N+GDL+ + +NG F S
Sbjct  224  GLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWITVPPVPGSLVVNLGDLLHILTNGIFPS  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  283  VLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPLHSPLYPSLTWKQYLATKATHFN  342

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  343  QSLSFIR  349



>ref|XP_011019738.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=342

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 159/246 (65%), Gaps = 6/246 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A RSP  +TGYG+   S  FN  MW EGFT++G      AR +WP DY  FCDV+E
Sbjct  103  QKLKALRSPGGATGYGLARISPFFNKYMWHEGFTIMGSSIDH-ARDLWPNDYQRFCDVME  161

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++MK LA  L+ L+ KSL +S E++      G      + LQ+NSYP CPDP RAMG
Sbjct  162  DYQKKMKELAITLMHLVLKSLDISEEEISRVVSAG---GDSTALQLNSYPLCPDPNRAMG  218

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S++T+L+QS T+ GLQ+++  + WV + P   ++V+NVGDL+ + SN +F S+
Sbjct  219  LAPHTDTSLLTILHQS-TVNGLQIFKEGVGWVLVSPTNGSLVVNVGDLLHILSNAQFPSV  277

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFKS  724
            LHR V+     R+S+AYFY    D  I  P+ LN    P+Y+++S ++Y+ +K     K+
Sbjct  278  LHRVVMKENQQRLSLAYFYCLPSDFHIS-PLALNSTQMPLYRSVSVRDYIGIKAKNLEKA  336

Query  725  LEKVRF  742
            L  +R 
Sbjct  337  LSLIRI  342



>ref|XP_003533057.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=375

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 164/264 (62%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F   MW E FT++  P  +L  ++WP+DY+ +CD++
Sbjct  109  HQKLKAARSPDGVSGYGRARISSFFPKLMWSECFTILDSP-LDLFLKLWPQDYAKYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+  MK LA KL+ L+  SLG+  ED++W  P G      + L  NSYP CPDP RAM
Sbjct  168  VEYEAAMKKLAAKLMCLMLASLGIPKEDIKWAGPKGEFNGACAALHWNSYPSCPDPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++ + GLQV +    WV + P+   +VINVGDL+ + SNG + S
Sbjct  228  GLAAHTDSTLLTILHQNN-VNGLQVLKEGEGWVAVPPLPGGLVINVGDLLHILSNGLYPS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHR  V+    R SVAY YGP  +V+I P VKL     P +Y++++W EYL  K   F 
Sbjct  287  VLHRVRVNRTRQRFSVAYLYGPPTNVQISPQVKLVGPTRPVLYRSVTWNEYLGTKAKLFN  346

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   ++   N +   NE+
Sbjct  347  KALSAVR---LSSSINGLFDVNED  367



>ref|XP_004158763.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
1-like [Cucumis sativus]
Length=374

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 159/247 (64%), Gaps = 3/247 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R  +  +GYG+V  S  F  RMW EGFT+VG P  E  R++WP DY+ +CD++E
Sbjct  111  HKLKAARPSDGISGYGLVRISSFFPKRMWSEGFTIVGSP-LEHFRKLWPHDYTRYCDIVE  169

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y  +MK L  +L+ +    LG++ EDV W  P G  +++ +  Q+NSYP CPDP RAMG
Sbjct  170  EYDREMKSLCGRLMWVALGELGITREDVNWAGPNGDFKTSNAATQLNSYPVCPDPDRAMG  229

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L  HTD+S++T++YQ++T RGLQV R    WV +EPV  A+V+ VGDL+ + +NG + S 
Sbjct  230  LGAHTDTSLLTIVYQNNT-RGLQVLREGNRWVTVEPVPGALVVQVGDLLHILTNGLYPSP  288

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            +H+AVV+    R+SVAY +GP    +I P  K L     P Y+T++W EYL  K  +F  
Sbjct  289  VHQAVVNRTRKRLSVAYVFGPPESAEISPLKKLLGPTQPPXYRTVTWTEYLRKKAEHFNN  348

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  349  ALSSVRL  355



>gb|KHN47796.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=375

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 164/264 (62%), Gaps = 6/264 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG    S  F   MW E FT++  P  +L  ++WP+DY+ +CD++
Sbjct  109  HQKLKAARSPDGVSGYGRARISSFFPKLMWSECFTILDSP-LDLFLKLWPQDYAKYCDIV  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y+  MK LA KL+ L+  SLG+  ED++W  P G      + L  NSYP CPDP RAM
Sbjct  168  VEYEAAMKKLAAKLMCLMLASLGIPKEDIKWAGPKGEFNGACAALHWNSYPSCPDPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+Q++ + GLQV +    WV + P+   +VINVGDL+ + SNG + S
Sbjct  228  GLAAHTDSTLLTILHQNN-VNGLQVLKEGEGWVAVPPLPGGLVINVGDLLHILSNGLYPS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHR  V+    R SVAY YGP  +V+I P VKL     P +Y++++W EYL  K   F 
Sbjct  287  VLHRVRVNRTRQRFSVAYLYGPPTNVQISPQVKLVGPTRPVLYRSVTWNEYLGTKAKLFN  346

Query  719  KSLEKVRFNPVAEEYNAITSGNEE  790
            K+L  VR   ++   N +   NE+
Sbjct  347  KALSAVR---LSSSINGLFDVNED  367



>gb|ADK71024.1| gibberellin 3-beta-hydroxylase [Trifolium incarnatum]
Length=299

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 143/214 (67%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  TGYG+   S  F+  MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  81   HQKLKAIRSPDGVTGYGLARISSFFSKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  139

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LAEKL+ L+  SLG++ ED++W       E   + +Q+NSYP CPDP RAM
Sbjct  140  LQYDETMKKLAEKLMLLMLDSLGITKEDIKWASSKAQFEKACAAMQLNSYPICPDPDRAM  199

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L QSD + GLQV R    WV + P+   +V+NVGDL  + SNG + S
Sbjct  200  GLAPHTDSTFLTILSQSD-ISGLQVQREGFGWVTVPPLPGGLVVNVGDLFHILSNGLYPS  258

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            +LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  259  VLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKL  292



>gb|KDP32294.1| hypothetical protein JCGZ_13219 [Jatropha curcas]
Length=350

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 159/252 (63%), Gaps = 11/252 (4%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A RSP  + GYGI   S  FN  MW EGFT++G P    A ++WP  Y  FCDV+E
Sbjct  104  QKLKALRSPGGAIGYGIARISPFFNKYMWHEGFTIMGSPVDH-AMQLWPNGYQRFCDVME  162

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++M+ LA  L+ L+ +++ +S E+ +W    G P  + + LQ+NSYP CPDP RAMG
Sbjct  163  DYQKKMEELATTLIHLILQNISMSEEETKWL---GSPGGSSTALQLNSYPNCPDPHRAMG  219

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S++T+L+QS T+ GLQ+++    WV + P   A+V+N+GDL+ + SNGRF S+
Sbjct  220  LAPHTDTSLLTILHQS-TISGLQIFKEGFGWVLVYPTNGALVVNIGDLLHILSNGRFISV  278

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKD------GFPMYQTLSWKEYLAVKD  706
            LHR ++     R SVA+FY P  D  + P    + D        P+Y+++S  EY+ +K 
Sbjct  279  LHRVIMKEPKQRFSVAFFYCPRTDFHVFPLGLSSGDEDDDHGQVPLYRSVSVAEYVGIKS  338

Query  707  VYFFKSLEKVRF  742
                K+L  +R 
Sbjct  339  KNLDKALSLIRI  350



>ref|XP_008350339.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=260

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 159/246 (65%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP  +TGYG    S  F+  MW EGFT++G P  + A+++WP+DY  FCD +
Sbjct  17   DQKLKALRSPGGATGYGRPHISPFFDKHMWQEGFTIMGSP-VDHAKQLWPQDYQGFCDTM  75

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ QMK LA+KL+ + FKSL ++ E+ +W    G      + LQ+NSYP CPDPTRA+
Sbjct  76   DDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSG-SSXPSTALQLNSYPPCPDPTRAL  134

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTD+S++T++ QS T  GLQV++    WV ++P+  A+ +N+GD + + SNG F S
Sbjct  135  GMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALTVNLGDYLHIXSNGVFTS  193

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HR VV+    R S+AYFY P  D  + P +    +  P Y++L+ KEY+ +K  +  K
Sbjct  194  VRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSRVLEKVPKYRSLTVKEYVDIKGKHLEK  253

Query  722  SLEKVR  739
            +   ++
Sbjct  254  AFSLIQ  259



>ref|XP_009128433.1| PREDICTED: gibberellin 3-beta-dioxygenase 2 [Brassica rapa]
Length=358

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 164/247 (66%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A R  +  +GYG+   +  FN +MW EGFTV+G P  +   ++WP  +  +C +I
Sbjct  105  HRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIGSPLDDF-HKLWPRQHLKYCKII  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+E M+ LA KL+ L   +LG+  +D+EW  P    +   + +Q+N YP CP+P RAM
Sbjct  164  QEYEEHMQKLAAKLMWLALGALGVEEKDIEWAGPISDFQGAQAAIQLNHYPICPEPDRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQ++R D+ W+ + PV  ++V+NVGDL+ + +NG F S
Sbjct  224  GLAAHTDSTLLTILYQNNT-AGLQIFRDDVGWITVPPVPGSLVVNVGDLLHILTNGIFPS  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  283  VLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPLHSPLYPSLTWKQYLATKATHFN  342

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  343  QSLSFIR  349



>emb|CAN73736.1| hypothetical protein VITISV_025221 [Vitis vinifera]
Length=416

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 169/254 (67%), Gaps = 5/254 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDV  178
            EQKL+A R P+  +G+G    +  F  +MW EGFTV+G P  EL  ++WPE+Y   FC+V
Sbjct  161  EQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTVLGSP-LELVSKLWPEEYCTKFCEV  219

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
             E+Y +QMK LA KL+ LL  SLG++ EDVEW  P G  E   + LQ+NSYP CP P +A
Sbjct  220  TEEYDKQMKQLANKLLWLLLGSLGINKEDVEWAGPEGQLEGAHAALQLNSYPACPQPDKA  279

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDSS++T+LYQ  T  GLQV      W+ + P+  A+V+N+GDL+ + SN  F 
Sbjct  280  MGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWITVPPLPGALVVNIGDLLHILSNAAFP  338

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+N+  RISVAYFYGP   + + P P  ++    P+Y++++W E+LA K  +F
Sbjct  339  SVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKLVDSSHPPVYRSVTWSEFLATKAKHF  398

Query  716  FKSLEKVRFNPVAE  757
             K+L  VR  PV E
Sbjct  399  NKALSLVRM-PVPE  411



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 163/251 (65%), Gaps = 6/251 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K++A R P   TGYG    S  +   MW EGFT++G    + AR++WP+DY  FCDV+
Sbjct  107  HEKMKALRLPSGGTGYGQARISPFYPKFMWHEGFTIMGSA-VDHARKLWPDDYKGFCDVM  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ++MK LAE L+ +  +SL +S E+          ++  + LQ+NSYP CPDP RAM
Sbjct  166  EDYQKKMKELAESLLHIFLESLDISKEEYRSTTIQRGHKACNTALQLNSYPPCPDPNRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS + T+++QS T  GLQ+ R  + W+ + P++ A+V+NVGDL+ + SNGR+ S
Sbjct  226  GLAPHTDSLLFTIVHQSHT-SGLQILRDGVGWITVFPLEGALVVNVGDLLHILSNGRYPS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG----FPMYQTLSWKEYLAVKDV  709
            +LHRAVV+ A HRIS+AYFYGP  D  I P   L   G     P Y+++S KEY+ +K+ 
Sbjct  285  VLHRAVVNQAEHRISLAYFYGPPADSLISPLCNLVSSGQQVVAPRYRSVSVKEYVDLKEK  344

Query  710  YFFKSLEKVRF  742
            +  K+L  +R 
Sbjct  345  HKEKALSLLRL  355



>emb|CDY37589.1| BnaA02g19810D [Brassica napus]
Length=358

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 164/247 (66%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A R  +  +GYG+   +  FN +MW EGFTV+G P  +   ++WP  +  +C +I
Sbjct  105  NRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIGSPLDDF-HKLWPRQHLKYCKII  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+E M+ LA KL+ L   +LG+  +D+EW  P    +   + +Q+N YP CP+P RAM
Sbjct  164  QEYEEHMQKLAAKLMWLALGALGVEEKDIEWAGPISDFQGAQAAIQLNHYPICPEPDRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQ++R D+ W+ + PV  ++V+NVGDL+ + +NG F S
Sbjct  224  GLAAHTDSTLLTILYQNNT-AGLQIFRDDVGWITVPPVPGSLVVNVGDLLHILTNGIFPS  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  283  VLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPLHSPLYPSLTWKQYLATKATHFN  342

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  343  QSLSFIR  349



>emb|CAC83089.1| gibberellin 3-oxidase [Cucurbita maxima]
Length=377

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 158/247 (64%), Gaps = 3/247 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
             KL+A R+P+  +GYG+V  S  F  RMW EGFT+VG P     R++WP DY   C+++E
Sbjct  114  HKLKAARTPDGISGYGLVRISSFFPKRMWSEGFTIVGSPLDHF-RQLWPHDYHKHCEIVE  172

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y  +M+ L  +L+ L    LG++ +D++W  P G  +++ +  Q NSYP CPDP RAMG
Sbjct  173  EYDREMRSLCGRLMWLGLGELGITRDDMKWAGPDGDFKTSPAATQFNSYPVCPDPDRAMG  232

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L PHTD+S++T++YQS+T RGLQV R    WV +EPV   +V+ VGDL+ + +NG + S 
Sbjct  233  LGPHTDTSLLTIVYQSNT-RGLQVLREGKRWVTVEPVAGGLVVQVGDLLHILTNGLYPSA  291

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            LH+AVV+    R+SVAY +GP    +I P  K L     P+Y+ ++W EYL  K  +F  
Sbjct  292  LHQAVVNRTRKRLSVAYVFGPPESAEISPLKKLLGPTQPPLYRPVTWTEYLGKKAEHFNN  351

Query  722  SLEKVRF  742
            +L  VR 
Sbjct  352  ALSTVRL  358



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 160/249 (64%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+  RSP   +GYG    +  ++ + W E FT+VG P    A+ +WP+DY+ FC + 
Sbjct  108  QQKLKVARSPGQISGYGFHLIAAFWDKQQWSECFTIVGSPLEHYAQ-LWPQDYTKFCCIT  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+++ ++K LA +LV L+  SLG+S +DVEW  P G  ++  ++ Q NSYP CPDP R +
Sbjct  167  EEFEREIKRLASRLVWLMLASLGISKDDVEWDGPKGDDQNASAVFQFNSYPSCPDPDRTL  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GL PHTDSS++++++QS+ + GLQV+R    W  I+PV  A+VINVGDLM + SNG + S
Sbjct  227  GLVPHTDSSLVSIVHQSN-IDGLQVFREGTGWFTIQPVPGALVINVGDLMSILSNGLYSS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLS-WKEYLAVKDVYF  715
            +LHR +V  A HRIS+ Y YGP   VKI P  KL      P+Y  ++ W EY++ K    
Sbjct  286  VLHRVLVKRAQHRISLVYHYGPPAAVKIAPLAKLVGPSNSPLYPPVTNWNEYISTKAKLK  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  GKALPSLRL  354



>ref|XP_007227245.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
 gb|EMJ28444.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
Length=344

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 161/246 (65%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP    GYG+   S  FN  MW EGFT++G P     R++WP+ Y  FC+ +
Sbjct  105  DQKLKALRSPGGGAGYGLPHISPFFNKHMWHEGFTIMGSPIYH-TRQLWPQAYQGFCETM  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
              YQ Q+K L E+L+ ++FKSL ++SE+V+W K     + + + LQ+NSYP CPDPTRAM
Sbjct  164  VDYQNQLKALTEQLIRIIFKSLNINSEEVDWLKDS---QGSSTALQLNSYPACPDPTRAM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S+IT+L QS T  GLQV++    W+ ++P+  A+++NVGD + + SNG F +
Sbjct  221  GLAPHTDTSLITIL-QSKT-SGLQVFKEGAGWILVQPIPGALIVNVGDFLHILSNGVFTT  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HR VV++   R S A+FY P  DV + P +  +  G P Y ++S K Y+  K  +F K
Sbjct  279  VRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVMSKDFGGVPRYHSVSVKGYVESKGKHFEK  337

Query  722  SLEKVR  739
            +L  ++
Sbjct  338  ALSLIK  343



>ref|XP_010049018.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81481.1| hypothetical protein EUGRSUZ_C02840 [Eucalyptus grandis]
Length=355

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 163/249 (65%), Gaps = 8/249 (3%)
 Frame = +2

Query  8    KLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIEK  187
            K++A RSP  +TGYG+   +  FN  MW EGFT++G P  E AR VWP  Y  FC+V+E 
Sbjct  110  KVKALRSPSGATGYGVARIAPFFNKFMWHEGFTMMGSP-LEHAREVWPHGYRKFCEVMED  168

Query  188  YQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMGL  367
            YQ++MK L+E+L++++ K LG+S  DV+W +   L  +  + LQ+NSYP+CPDP +AMGL
Sbjct  169  YQDKMKALSERLLAMILKYLGISEHDVDWPR---LRSNACTALQLNSYPRCPDPGQAMGL  225

Query  368  APHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSLL  547
            APHTD+ ++T+L+Q+ +  GLQV+R    WV + P+  A+V+NVGD++ + SN  F S++
Sbjct  226  APHTDTLLLTILHQNHSAHGLQVHREGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVV  285

Query  548  HRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLN----KDGFPMYQTLSWKEYLAVKDVYF  715
            HR + S   HR++V YFYGP  D  + P   L     ++    +++++ K+Y+ +K    
Sbjct  286  HRVIPSENTHRLTVGYFYGPPTDFHVGPIHGLTQTSGQEDAARFRSITVKDYVQMKAKNL  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  DKALSMIRI  354



>ref|XP_010520599.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Tarenaya hassleriana]
Length=391

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 164/256 (64%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++K+ A RSP+ STGYG+   S  ++  MW EGF+V+G      A+ +WP D+ +F DV+
Sbjct  140  QRKILAVRSPDESTGYGLARISMFYDKFMWSEGFSVMGSSSVRHAKLLWPNDHKIFSDVM  199

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGS------ILQMNSYPKCP  343
            E+YQ+ M+ L  +L+ +L  SLGL+ EDV W     +P+ TGS       LQ+NSYP CP
Sbjct  200  EEYQKAMETLGRRLICMLMDSLGLAQEDVGW----TVPDRTGSRPEIQPFLQLNSYPVCP  255

Query  344  DPTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLN--WVDIEPVKDAVVINVGDLMEL  517
            +P  AMGLAPHTDSS+ T+L+Q++ + GLQ+ R +    W  ++P+   +V+ +GD+  +
Sbjct  256  EPDLAMGLAPHTDSSLFTILHQAN-IPGLQIQRSERGGAWSTVDPIPGGLVVIMGDVFHM  314

Query  518  ASNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYL  694
             SNGRF +++HR VV++  HR+S AYFYGP   V + P  KL  +  P MY+ +SW EYL
Sbjct  315  LSNGRFNNVMHRVVVNSTRHRVSAAYFYGPPRSVTVGPSSKLIDEDRPRMYRDVSWGEYL  374

Query  695  AVKDVYFFKSLEKVRF  742
              K  YF K+L   R 
Sbjct  375  ETKATYFDKALALFRL  390



>ref|XP_002515599.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47048.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=345

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 154/235 (66%), Gaps = 7/235 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A RS   + GYG    S  FN  MW EGFT++G P    AR++WP DY  FCDV+E
Sbjct  103  QKLKALRSAGGAVGYGRARISHFFNKHMWHEGFTIMGSPVDH-ARQLWPHDYQRFCDVME  161

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             Y+++MK LA  L+ ++FK LG+S E  +W    G P  + + LQ+NSYP CPDP RAMG
Sbjct  162  GYEKKMKELATTLMRVIFKYLGISEEQTKWV---GSPGCSSAALQLNSYPYCPDPNRAMG  218

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S +T+L+QS T +GLQ+++  + WV + P   A+V+NVGD + + SN RF ++
Sbjct  219  LAPHTDTSFLTILHQSST-KGLQIFKEGVGWVLVYPTSGALVVNVGDFLHILSNARFPNV  277

Query  545  LHRAVVSNA-HHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLAVK  703
            LHR ++      R SVA+F+ P+ D  + P    +  G FP+Y+++S  EY+ +K
Sbjct  278  LHRVIMKECKQQRFSVAFFHCPSTDFSLFPLGLSSSCGEFPLYRSVSAAEYIGIK  332



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 154/249 (62%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GY +   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  110  HQKLKAIRSPDGVSGYDLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  169  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  228

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV      WV + P+   +V+NVGDL  + SNG + 
Sbjct  229  MGLAPHTDSTFLTILSQND-ISGLQVQGEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  287

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHR +V+    R SVAY YGP  +V+I P  KL      P+Y++++W EYL  K  +F
Sbjct  288  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHF  347

Query  716  FKSLEKVRF  742
             K+L  V  
Sbjct  348  NKALSSVSL  356



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 163/249 (65%), Gaps = 8/249 (3%)
 Frame = +2

Query  8    KLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIEK  187
            K++A RSP  +TGYGI   +  FN  MW EGFT++G P  E AR VWP  Y  FC+V+E 
Sbjct  110  KVKALRSPSGATGYGIARIAPFFNKFMWHEGFTMMGSP-LEHAREVWPHGYRKFCEVMED  168

Query  188  YQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMGL  367
            YQ++MK L+E+L++++ K LG+S  DV+W +   L  +  + LQ+NSYP+CPDP +AMGL
Sbjct  169  YQDKMKALSERLLAMILKYLGISEHDVDWPR---LRSNACTALQLNSYPRCPDPRQAMGL  225

Query  368  APHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSLL  547
            APHTD+ ++T+L+Q+ +  GLQV+     WV + P+  A+V+NVGD++ + SN  F S++
Sbjct  226  APHTDTFLLTILHQNHSAHGLQVHMEGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVV  285

Query  548  HRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLN----KDGFPMYQTLSWKEYLAVKDVYF  715
            HR + S   HR++V YFYGP  D  + P  +L     ++    +++++ K+Y+ +K    
Sbjct  286  HRVIPSENTHRLTVGYFYGPPTDFHVGPIHELTQASGREDAARFRSITVKDYVQMKAENL  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  EKALSMIRI  354



>gb|ADK71017.1| gibberellin 3-beta-hydroxylase [Trigonella gladiata]
Length=301

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  77   HQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+SL+  SLG++ ED++W        E+  + LQ+NSYP CPDP  A
Sbjct  136  LQYDETMKKLAGKLMSLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSCPDPDHA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P++  +V+NVGDL  + SNG + 
Sbjct  196  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYT  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHRA+V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKL  289



>ref|XP_008387508.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP  +TGYG    S  F+  MW EGFT++G P  + A+++WP+DY  FCD +
Sbjct  102  DQKLKALRSPGGATGYGRPHISPFFDKHMWQEGFTIMGSP-VDHAKQLWPQDYQGFCDTM  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            + YQ QMK LA+KL+ + FKSL ++ E+ +W    G   +  + LQ+NSYP CPDPTRA+
Sbjct  161  DDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSG-SSNPSTALQLNSYPPCPDPTRAL  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTD+S++T++ QS T  GLQV++    WV ++P+  A+ +N+GD + + SNG F S
Sbjct  220  GMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALTVNLGDYLHIXSNGVFTS  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HR VV+    R S+AYFY P  D  + P +    +  P Y++L+ KEY+ +K  +  K
Sbjct  279  VRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSRVLEKVPKYRSLTVKEYVDIKGKHLEK  338

Query  722  SLEKVR  739
            +   ++
Sbjct  339  AFSLIQ  344



>gb|ADK71027.1| gibberellin 3-beta-hydroxylase [Trifolium subterraneum]
Length=272

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 141/214 (66%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+ G P     R++WP+DY+ +CD++
Sbjct  56   NQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIFGSPLDHF-RQLWPQDYAKYCDIV  114

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LAEKL+ L+  SLG++ ED +W       E   + LQ+NSYP CPDP RAM
Sbjct  115  LQYDETMKKLAEKLMLLMLDSLGITKEDFKWAGSKAQFEKACAALQLNSYPICPDPDRAM  174

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L QSD + GLQV R    WV + P++  +V+NVGDL  + SNG + S
Sbjct  175  GLAPHTDSTFLTILSQSD-ISGLQVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYPS  233

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            +LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  234  VLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKL  267



>dbj|BAD30035.1| gibberellin 3beta-hydroxylase1 [Daucus carota]
Length=344

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 163/250 (65%), Gaps = 10/250 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESS-TGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDV  178
            EQKL+   S  +  +GY +   S  F   MW EGFT+ G P  E A ++WP+DY  FCD+
Sbjct  96   EQKLKVSLSSSNDISGYRLPKISPFFPKFMWREGFTIFGSP-VEHAVKLWPQDYKPFCDL  154

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y ++MK LAE+L+ L+ KSLG++ ED+ W   GG      + +Q+NSYP CPDP RA
Sbjct  155  VEEYGKEMKNLAERLMWLMLKSLGITEEDINWSSLGG------AAIQLNSYPVCPDPDRA  208

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDSS++T+LYQ++T  GLQ++R    W+ ++P    +V+N+GDLM + SNG + 
Sbjct  209  MGLAEHTDSSLLTILYQNNT-TGLQIFREGTGWLTVQPHTGVLVVNIGDLMHILSNGLYP  267

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYF  715
            S+LHRA+V+    RISVAY Y P  +V I P P  ++     +++ ++W EYL +K  +F
Sbjct  268  SVLHRALVNRKQQRISVAYIYRPPANVLISPLPKLVDHYHLCLFRPITWTEYLELKSKHF  327

Query  716  FKSLEKVRFN  745
              +L  +R +
Sbjct  328  TNTLSLIRIS  337



>ref|XP_008347459.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 155/252 (62%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R P+  +GYG    S      MW E FT VG P  E  R++WP+DY+ FC + 
Sbjct  108  QQKLKAARLPDGFSGYGFHRISAFCEKLMWSESFTTVGSP-LEHFRQLWPQDYTKFCCIA  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+ +M  LA  L+ L+  SLG+S ED++W  P G  E   ++LQ NSYP CPDP R +
Sbjct  167  EEYEREMIRLAAXLMWLMLGSLGISKEDIKWAGPRGEFEDASAVLQFNSYPACPDPDRTI  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYR----PDLNWVDIEPVKDAVVINVGDLMELASNG  529
            GLA HTDSS+I++++QS    GLQV+R        W+ + PV  A VINVGD M + SNG
Sbjct  227  GLAQHTDSSLISIVHQSSNASGLQVFRQGEEEGRGWLMVPPVPGAFVINVGDFMHMLSNG  286

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKD  706
             ++++ HRAVV+ + HR+SVA  YGP  + ++ P  K L     P+Y  L+W EYL  K 
Sbjct  287  LYQNVFHRAVVNRSQHRVSVACLYGPPENAQVSPLSKLLGPSCPPLYPPLTWNEYLGTKA  346

Query  707  VYFFKSLEKVRF  742
                K+LE +R 
Sbjct  347  KLHNKALESLRL  358



>gb|ADK71025.1| gibberellin 3-beta-hydroxylase [Trifolium microdon]
Length=300

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 141/214 (66%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  TGYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD++
Sbjct  82   HQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPKDYAKYCDIV  140

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LAEKL+ L+  SLG++ ED+ W       E   + +Q+NSYP CPDP RAM
Sbjct  141  LQYDEAMKKLAEKLMLLMLDSLGITKEDIIWASSKAQFEKACAAMQLNSYPICPDPDRAM  200

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L QSD + GLQV R    WV + P+   +V+NVGDL  + SNG + S
Sbjct  201  GLAPHTDSTFLTILSQSD-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPS  259

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            +LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  260  VLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKL  293



>ref|XP_009400517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 170/270 (63%), Gaps = 18/270 (7%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSL-FCDVI  181
            +KL A R  +  +GYG    S  F   MW EGFT+ G P  + AR +WP+D +L FCDVI
Sbjct  103  RKLEAARPADGVSGYGRARISCFFPKLMWSEGFTIAGSP-VDHARTLWPDDDALAFCDVI  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVE------WFKPGGLPESTGSILQMNSYPKCP  343
            E+Y+E+MK LA KL+ ++  SLGL+  + E      W  PG       ++LQ+NSYP CP
Sbjct  162  EEYKEEMKQLARKLMRMMLMSLGLTEAEAEAETETGWIGPGDEAGGMSAVLQLNSYPVCP  221

Query  344  DPTRAMGLAPHTDSSIITVLYQSDTLRGLQVYR--------PDLNWVDIEPVKDAVVINV  499
            DP RAMG+A HTDS+++T+L+QS+T  GLQV +            WV + P+  A+++NV
Sbjct  222  DPDRAMGMAAHTDSTLLTLLFQSNT-SGLQVLQVVGDTGRDRAARWVTVPPMPGALIVNV  280

Query  500  GDLMELASNGRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTL  676
            GDL ++ SNGR++S++HRAVV+   HR+SVAY  GP    K++P VKL   G  P+Y+ +
Sbjct  281  GDLFQILSNGRYRSVIHRAVVNRTSHRVSVAYMCGPPAASKVEPIVKLVGPGSGPVYRPV  340

Query  677  SWKEYLAVKDVYFFKSLEKVRFNPVAEEYN  766
            +W EYL+VK   F K+L  V    V+ E+ 
Sbjct  341  TWPEYLSVKGKLFDKALASVMRTEVSLEHT  370



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 161/249 (65%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+  RSP   +GYG    +  ++ + W E FT+VG P  E   ++WP+DY+ FC + 
Sbjct  108  QQKLKVARSPGQISGYGFHLIAAFWDKQQWSECFTIVGSP-LEHYEQLWPQDYTKFCCIT  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E++++++K LA +L+ L+  SLG+S +DVEW  P G  ++  ++ Q NSYP CPDP R +
Sbjct  167  EEFEKEIKKLASRLMWLMLASLGISKDDVEWDGPKGDDQNASAVFQFNSYPSCPDPDRTL  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GL PHTDSS++++++QS+ + GLQV+R    W  I+PV  A+V+NVGDLM + SNG + S
Sbjct  227  GLVPHTDSSLVSIVHQSN-IDGLQVFREGTGWFTIQPVPGALVVNVGDLMSILSNGLYSS  285

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLS-WKEYLAVKDVYF  715
            +LHR +V  A HRIS+ Y YGP   VKI P  KL      P+Y  ++ W EY++ K    
Sbjct  286  VLHRVLVKRAQHRISLVYHYGPPAAVKIAPLEKLFGPSHPPLYPPVTNWNEYISTKAKLK  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  GKALPSLRL  354



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 162/249 (65%), Gaps = 8/249 (3%)
 Frame = +2

Query  8    KLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIEK  187
            K++A RSP  +TGYG+   +  FN  MW EGFT++G P  E AR VWP  Y  FC+V+E 
Sbjct  110  KVKALRSPSGATGYGVARIAPFFNKFMWHEGFTMMGSP-LEHAREVWPHGYRKFCEVMED  168

Query  188  YQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMGL  367
            YQ++MK L+E+L++++ K LG+S  D++W +   L  +  + LQ+NSYP+CPDP +AMGL
Sbjct  169  YQDKMKALSERLLAMILKYLGISEHDIDWPR---LRSNACAALQLNSYPRCPDPRQAMGL  225

Query  368  APHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSLL  547
            APHTD+ ++T+L+Q+ +  GLQV+     WV + P+  A+V+N+GD++ + SN  F S++
Sbjct  226  APHTDTFLLTILHQNHSAHGLQVHMEGRGWVPVFPMNGALVVNLGDMLHIMSNAMFPSVV  285

Query  548  HRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLN----KDGFPMYQTLSWKEYLAVKDVYF  715
            HR + S   HR++V YFYGP  D  + P   L     ++    +++++ K+Y+ +K    
Sbjct  286  HRVIPSEKRHRLTVGYFYGPPTDFHVGPIHGLTQSSGREDAARFRSVTVKDYVQMKAKNL  345

Query  716  FKSLEKVRF  742
             K+L  +R 
Sbjct  346  DKALSMIRI  354



>ref|XP_004136071.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 ref|XP_004158802.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
Length=342

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/263 (41%), Positives = 168/263 (64%), Gaps = 6/263 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+  RSPES +G+G+VP S+ +  R WGEGFT++G P   L +++WP+D   +CD++E
Sbjct  79   QKLKVVRSPESISGFGLVPLSKIYPKRPWGEGFTIIGNPVDHL-QKLWPQDCKKYCDLVE  137

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y ++MK L  KL+ L    LG++ ED+ W  P G  ++    ++MNSYP CP+P   +G
Sbjct  138  EYNKEMKSLCGKLLWLTLGELGITPEDIYWAGPDGDFKTNNQAIRMNSYPVCPEPDDLIG  197

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L PH+D+S +T+LYQ  T +GLQV      WVD+EP+  A+V+ VGD++ + +NG +   
Sbjct  198  LPPHSDTSALTILYQ--TTKGLQVSMEGKGWVDVEPINGALVVQVGDMLHILTNGMYPPS  255

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPM-YQTLSWKEYLAVKDVYFFK  721
            +H+AVV+    RIS AYF+GP    ++ P  KL     P+ Y T++W +YL  K V + K
Sbjct  256  VHQAVVNQTSDRISTAYFFGPPPKGEVSPLKKLVTPTQPLRYPTVTWADYLRKKYVLYEK  315

Query  722  SLEKVRFNPVAEEYNAITSGNEE  790
            +L  +R +  A     +++GN++
Sbjct  316  ALPSIRLS--APAPTGLSNGNDQ  336



>ref|XP_008337346.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Malus domestica]
Length=205

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = +2

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+YQ++MKGLA KL+ L+  SLGL+ EDV+W KP        ++LQ+NSYP CPDPTRA
Sbjct  1    MEEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKN-SSRPQTVLQLNSYPVCPDPTRA  59

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDSS++T+L QS ++ GLQV    + WV   P+  A+V+NVGDLM + SNG+FK
Sbjct  60   MGLAPHTDSSLLTLLNQS-SISGLQVLVDGIRWVPAHPIPGALVVNVGDLMHILSNGQFK  118

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            S  HRAVV+  HHRIS+AYFYGP +DVKI P +  N    P+YQ ++WKEYL  K  +F 
Sbjct  119  SAAHRAVVNEVHHRISMAYFYGPPMDVKISPLIDHNH---PLYQPVTWKEYLDYKATHFX  175

Query  719  KSLEKVR  739
            K+LE +R
Sbjct  176  KALEVIR  182



>gb|ADK71023.1| gibberellin 3-beta-hydroxylase [Trifolium albopurpureum]
Length=292

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 140/214 (65%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  TGYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD++
Sbjct  73   HQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKYCDIV  131

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y   MK LAEKL+ L+  SLG++ ED+ W       E   + +Q+NSYP CPDP RAM
Sbjct  132  LQYDGAMKKLAEKLMLLMLDSLGITKEDIIWANSKAQFEKACAAMQLNSYPICPDPDRAM  191

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L QSD + GLQV R    WV + P+   +VINVGDL  + SNG + S
Sbjct  192  GLAPHTDSTFLTILSQSD-ISGLQVQREGFGWVTVPPLHGGLVINVGDLFHILSNGLYPS  250

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            +LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  251  VLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKL  284



>gb|EPS71653.1| gibberellin 3-oxidase, partial [Genlisea aurea]
Length=322

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 161/247 (65%), Gaps = 8/247 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KLRA R P++ +GYG    SR F  RMW EGFTV G P  + A+ +WP D+  FC+ I
Sbjct  83   QRKLRAARGPDAISGYGTARISRFFPKRMWSEGFTVWGSP-RDNAQLLWPNDHHRFCETI  141

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            EKY+  MK LA +L+ L+   +G+  E  +W    G     GS LQ+N YP CPDP RAM
Sbjct  142  EKYERAMKNLAGELMRLMLGGMGVRRE-AKW----GSGSEPGSALQLNCYPPCPDPDRAM  196

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+L+QS    GLQV R D  WV + P+  A+V++VGDLM + SNG + S
Sbjct  197  GLAAHTDSTLLTILHQSGGACGLQVLRGD-RWVTMPPIPGALVVHVGDLMHILSNGLYPS  255

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            +LHRAVV+    R+SVAY YGP  +VKI P  +L  +  P +Y+ +SWKEYL  K  +F 
Sbjct  256  VLHRAVVNRNRRRVSVAYLYGPPANVKIGPLDELIDERHPALYREVSWKEYLGTKAQHFD  315

Query  719  KSLEKVR  739
            K+L  VR
Sbjct  316  KALSSVR  322



>ref|XP_010670743.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 157/246 (64%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            E+K++  RSPE++TGYG    +  F+  MW EGFT++G    + A+ +WP D+  FCDV+
Sbjct  109  EEKMKTLRSPEAATGYGYPRITPFFSKLMWNEGFTIMGNSLIDHAKILWPNDFQGFCDVM  168

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ +MK L++KL+ LL KSL +    ++      +     + LQ+NSYP CP+PTR M
Sbjct  169  EEYQTRMKDLSDKLMGLLLKSLNIPGPYMK-----EMDNDLCTALQLNSYPTCPNPTRTM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTD+ + T+L+QS    GLQV+     WV ++P   A+V+NVGDL+ + SN RF S
Sbjct  224  GLAQHTDTFLFTILHQSANASGLQVFIDGPGWVSVDPHPGALVVNVGDLLHIISNARFPS  283

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
             +HRAVV+NA  R+S AYFYGP +D ++ P +       P +++L  KEY+ +K  Y   
Sbjct  284  AIHRAVVNNATQRLSFAYFYGPPLDFQVAPFLDYPGCEGPTFKSLKVKEYVGIKSKYLDM  343

Query  722  SLEKVR  739
            +L  VR
Sbjct  344  ALSFVR  349



>ref|XP_009385827.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 161/251 (64%), Gaps = 10/251 (4%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A R P S +GYG+  +S  +++  W EGFT++G P  + AR++WPEDY  +C V+E
Sbjct  92   QKLKAARGPGSLSGYGLANTSSFYSNIFWSEGFTIIGSPYDD-ARKLWPEDYEEYCCVME  150

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y   +K L+ +L+  +  SLGL  ED++W    GL      +LQ+N YP CP+P RA+G
Sbjct  151  EYNRLIKALSGRLLRSMMLSLGLHEEDMDW---AGLLSKADPVLQLNYYPACPEPDRAIG  207

Query  365  LAPHTDSSIITVLYQSDTLRGLQ-VYRPDL----NWVDIEPVKDAVVINVGDLMELASNG  529
            +A HTDSS IT+LYQS    GLQ V+R D      WV + P + A+V+NVGDL E+  NG
Sbjct  208  IAHHTDSSFITILYQSSGESGLQLVHREDAAGPARWVTVPPRRGALVVNVGDLCEIVFNG  267

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKD  706
            R +S++HRA+V+    R+SVAYF GP     + P  KL   +  P Y+ +SW E+L++K 
Sbjct  268  RIRSVMHRAIVNRTQTRVSVAYFCGPPRQFNVAPIGKLVGPNERPAYRAMSWPEFLSLKR  327

Query  707  VYFFKSLEKVR  739
              + K+LE +R
Sbjct  328  KLYNKTLEYLR  338



>ref|XP_006829636.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
 gb|ERM97052.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
Length=369

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 162/243 (67%), Gaps = 9/243 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A+R P+   G+G    +  F  RMW EGFTV G P  E ARR+WP D+  FC+VI
Sbjct  101  DQKLKAERGPDEIAGFGAPRITHFFPKRMWTEGFTVFGSP-LEQARRLWPHDHMQFCEVI  159

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+YQ +MK L  KL+ L+ + +G   ED+ W     + +S+G + Q+NSYP CP+P+RAM
Sbjct  160  EEYQSEMKSLTVKLLELILEWVGAGKEDLNW----EVGDSSG-VTQLNSYPSCPEPSRAM  214

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPD-LNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            GLAPHTDSS++TV++QS+T  GLQ+       WV + PV  A+V+N+GDL+ + SNGR +
Sbjct  215  GLAPHTDSSLLTVIHQSNT-SGLQLLDASGQKWVTVPPVHGALVVNIGDLLHILSNGRCR  273

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            S +HRAVV+  HHR+S AYF  P+    ++P +  ++    +Y++++W EYL +K   F 
Sbjct  274  SSMHRAVVNRVHHRLSFAYFCFPSPGATVEPLIGPDEPT-ALYRSVTWTEYLRIKGTLFN  332

Query  719  KSL  727
             +L
Sbjct  333  NAL  335



>gb|ADK71016.1| gibberellin 3-beta-hydroxylase [Trigonella foenum-graecum]
Length=292

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  72   HQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  130

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E+  + LQ+NSYP CPDP  A
Sbjct  131  LQYDETMKILAGKLMFLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSCPDPDHA  190

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+ +T+L Q+D + GLQV R D  WV + P++  +V+NVGDL  + SNG + 
Sbjct  191  MGLARHTDSTFLTILSQND-ISGLQVQREDFGWVTVPPLQGGLVVNVGDLFHILSNGLYT  249

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHRA+V+    R SVAY YGP  +V+I P  KL
Sbjct  250  SVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKL  284



>ref|XP_008219863.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=344

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 159/246 (65%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP    GYG+   S  FN  MW EGFT++G P     R++WP+ Y  FC+ +
Sbjct  105  DQKLKALRSPGGGAGYGLPHISPFFNKHMWHEGFTIMGSPIYH-TRQLWPQAYQGFCETM  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
              YQ Q+K L E+L+ ++FKSL ++SE+V+W K     + + + LQ+NSYP CPDPTRAM
Sbjct  164  VDYQNQLKALTEQLIRIIFKSLNINSEEVDWLKDS---QGSSTALQLNSYPACPDPTRAM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S+IT+L QS T  GLQV++    W  ++ +  AV++NVGD + + SNG F +
Sbjct  221  GLAPHTDTSLITIL-QSKT-SGLQVFKEGAGWTLVQSIPGAVIVNVGDFLHILSNGVFTT  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
            + HR VV++   R S A+FY P  DV + P +  +    P Y+++S K Y+  K  +F K
Sbjct  279  VRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVMSKDFGEVPRYRSVSVKGYVETKGKHFEK  337

Query  722  SLEKVR  739
            +L  ++
Sbjct  338  ALSLIK  343



>gb|ABI64150.1| gibberellin 3-oxidase [Pisum sativum]
Length=349

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 158/235 (67%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++K++A RS   +TGYG    S  F   MW EGFT++G P +++ +++WP DY  FCD++
Sbjct  105  KEKIKALRSAGGATGYGRARISPFFPKYMWHEGFTIMGSPSNDV-KKIWPNDYEYFCDIM  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ+QMK LAEK+ +++F  LG+S E  +W       E+    LQ+N YP CPDP +AM
Sbjct  164  EDYQKQMKTLAEKITNIIFNILGISKEQNKWVGSNNHCEA----LQLNFYPCCPDPKKAM  219

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S+ T+L+QS T  GLQ+++  + +V ++P  + +V+N GD++ + SN RF+ 
Sbjct  220  GLAPHTDTSLFTILHQSQT-SGLQIFKEGVGYVTVDPHPNTLVVNTGDILHILSNSRFRC  278

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDG-FPMYQTLSWKEYLAVK  703
             LHRAVV++   R SVAYFYGP +D  + P V    DG  P +++LS K+Y+ +K
Sbjct  279  SLHRAVVNDVKDRYSVAYFYGPPVDYLVSPLV---VDGSLPRFRSLSVKDYIGIK  330



>ref|XP_010532144.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=354

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 158/247 (64%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K+RA R  +  +GYG+   +  F+ +MW EGFTV G       R++WP  +  +CDVI
Sbjct  105  HRKMRAARPVDGVSGYGVARIASFFHKQMWSEGFTVTGSARDHF-RKLWPLHHLKYCDVI  163

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+E M+ LA KL+ L+  SLG++  D++W  P        + +Q+N YP CP+P RAM
Sbjct  164  KEYEEHMQKLATKLMWLVLSSLGVTEADIKWAGPNSDFNGAQAAIQLNHYPVCPEPDRAM  223

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++TVLYQ+ T  GLQV++  + W+ + P+  ++V+N+GDL+ + SNGR  S
Sbjct  224  GLAAHTDSTLLTVLYQNIT-AGLQVFKDGVGWLTVSPIPGSLVVNIGDLLHILSNGRLPS  282

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL-NKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHR  V+    R SVAY +GP  DV+I P  KL +    P+Y+ ++WKEYL  K  +F 
Sbjct  283  VLHRVRVNKNRSRFSVAYLWGPQSDVQISPIWKLVSPVEPPLYRPVTWKEYLRTKATHFN  342

Query  719  KSLEKVR  739
             +L  +R
Sbjct  343  NALSVIR  349



>ref|NP_178150.1| gibberellin 3-beta-dioxygenase 2 [Arabidopsis thaliana]
 sp|Q9ZT84.2|G3OX2_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 2; AltName: Full=GA 
3-oxidase 2; Short=AtGA3ox2; AltName: Full=Gibberellin 3 
beta-hydroxylase 2 [Arabidopsis thaliana]
 gb|AAG52442.1|AC018848_13 gibberellin 3 beta-hydroxylase; 29683-28215 [Arabidopsis thaliana]
 gb|AEE36389.1| gibberellin 3-beta-dioxygenase 2 [Arabidopsis thaliana]
Length=347

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 168/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFTV+G P  +  R++WP  +  +C++I
Sbjct  102  QRKLKAARSENGVSGYGVARIASFFNKKMWSEGFTVIGSPLHDF-RKLWPSHHLKYCEII  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E M+ LA KL+     SLG+  +D++W  P    + T +++Q+N YPKCP+P RAM
Sbjct  161  EEYEEHMQKLAAKLMWFALGSLGVEEKDIQWAGPNSDFQGTQAVIQLNHYPKCPEPDRAM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R D+ WV   PV  ++V+NVGDL+ + +NG F S
Sbjct  221  GLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWVTAPPVPGSLVVNVGDLLHILTNGIFPS  279

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  D+ I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  280  VLHRARVNHVRSRFSMAYLWGPPSDIMISPLPKLVDPLQSPLYPSLTWKQYLATKATHFN  339

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  340  QSLSIIR  346



>ref|XP_010537951.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Tarenaya hassleriana]
Length=367

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 157/249 (63%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +K +A R     +GYG+   +  F+ +MW EGFT+ G P     R++WP  +  +C++I
Sbjct  109  HRKFKAARPENGISGYGVARIASFFHKQMWSEGFTLAGSPLDHF-RKLWPRHHLRYCNII  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y+EQM+ LA +L  L+  SLG++  D++W  P        + +Q+N YP CP+P RAM
Sbjct  168  KEYEEQMQKLARRLTWLVLGSLGVTEGDIKWAGPNSDFNGAQAAIQLNHYPVCPEPDRAM  227

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++TVLYQS+T  GLQV++    W+ + P+  ++V+N+GDL+ + SNGR  S
Sbjct  228  GLAAHTDSTLLTVLYQSNT-AGLQVFKDGFGWLTVPPIPGSLVVNIGDLLHILSNGRLSS  286

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
             LHR  V+    R SVAY +GP  DV+I P P  ++    P+Y+ ++WKEYL  K  +F 
Sbjct  287  ALHRVRVNQDRPRFSVAYLWGPQADVQISPLPKLVSPVKPPLYRPVTWKEYLGTKATHFN  346

Query  719  KSLEKVRFN  745
             +L  +R +
Sbjct  347  NALSAIRVD  355



>gb|ADK71026.1| gibberellin 3-beta-hydroxylase [Trifolium semipilosum]
Length=269

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 135/202 (67%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  TGYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD++
Sbjct  67   HQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGTPLDHF-QQLWPQDYAKYCDIV  125

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
             +Y E MK LAEKL+ L+  SLG++ ED+ W       E+  + +Q+NSYP CPDP RAM
Sbjct  126  LQYDETMKKLAEKLMLLMLDSLGITKEDIIWANSKAQFENACAAMQLNSYPICPDPDRAM  185

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTDS+ +T+L QSD + GLQV R    WV + P+   +V+NVGDL  + SNG + S
Sbjct  186  GLAPHTDSTFLTILSQSD-ISGLQVQREGFGWVTVPPIHGGLVVNVGDLFHILSNGLYPS  244

Query  542  LLHRAVVSNAHHRISVAYFYGP  607
            +LHR +V+    R SVAY YGP
Sbjct  245  VLHRVLVNRIRQRFSVAYLYGP  266



>ref|XP_006450547.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
 gb|ESR63787.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
Length=342

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 159/233 (68%), Gaps = 7/233 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A R+P  +TGYGI   +  F+  MW EGFT++G    + A+++WP +++ FCDV+E
Sbjct  104  QKLKALRAPAGATGYGIARITPFFDKYMWHEGFTIMGTSIHDHAKQLWPHNHAKFCDVME  163

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++M  LA++L  L+FKSL +S E  E     G    + S LQ+NSYP CP+P RA+G
Sbjct  164  TYQKKMNILADQLTQLIFKSLDISEEQAEEMNWVG----SSSALQLNSYPSCPEPNRAVG  219

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S+IT+L++ +++ GLQ+++ ++ WV ++PV  A+V+NVGDL  + SN RF ++
Sbjct  220  LAPHTDTSLITILHE-NSIAGLQIFKQEVGWVSVKPVDGALVVNVGDLFHILSNARFPNV  278

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            LHR  V+    R+S+AYFY P  D  + P VK  +     Y+ ++ KE++++K
Sbjct  279  LHRVSVNQKRQRLSLAYFYNPPTDSTVVPIVKSGQ--VARYRPVTVKEFISLK  329



>ref|XP_006476223.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
 gb|KDO79608.1| hypothetical protein CISIN_1g043251mg [Citrus sinensis]
Length=342

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 159/233 (68%), Gaps = 7/233 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A R+P  +TGYGI   +  F+  MW EGFT++G    + A+++WP +++ FCDV+E
Sbjct  104  QKLKALRAPAGATGYGIARITPFFDKYMWHEGFTIMGTSIHDHAKQLWPHNHAKFCDVME  163

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
             YQ++M  LA++L  L+FKSL +S E  E     G    + S LQ+NSYP CP+P RA+G
Sbjct  164  TYQKKMNILADQLTQLIFKSLDISEEQAEEMNWVG----SSSALQLNSYPSCPEPNRAVG  219

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+S+IT+L++ +++ GLQ+++ ++ WV ++PV  A+V+NVGDL  + SN RF ++
Sbjct  220  LAPHTDTSLITILHE-NSIAGLQIFKQEVGWVSVKPVDGALVVNVGDLFHILSNARFPNV  278

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
            LHR  V+    R+S+AYFY P  D  + P VK  +     Y+ ++ KE++++K
Sbjct  279  LHRVSVNQKRQRLSLAYFYNPPTDSTVVPIVKSGQ--VARYRPVTVKEFISLK  329



>gb|ADK71014.1| gibberellin 3-beta-hydroxylase [Trigonella cretica]
Length=296

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+  RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+D++ +CD+I
Sbjct  76   DEKLKVIRSPDGVSGYGLARISSXFPKLMWSEGFTIVGSPLDHF-RQLWPQDHAKYCDII  134

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   ++LQ+NSYP CPDP RA
Sbjct  135  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKASAVLQLNSYPSCPDPDRA  194

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+N+GDL  + SNG + 
Sbjct  195  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNIGDLFHILSNGLYP  253

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  254  SVLHRVLVNRTRQRFSVAYLYGPPSNVEIGPHAKL  288



>gb|AAC83647.1| gibberellin 3 beta-hydroxylase [Arabidopsis thaliana]
Length=347

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    +GYG+   +  FN +MW EGFTV+G P  +  R++WP  +  +C++I
Sbjct  102  QRKLKAARSENGVSGYGVARIASFFNKKMWSEGFTVIGSPLHDF-RKLWPSHHLKYCEII  160

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+E M+ LA KL+     SLG+  +D++W  P    + T + +Q+N YPKCP+P RAM
Sbjct  161  EEYEEHMQKLAAKLMWFALGSLGVEEKDIQWAGPNSDFQGTQAAIQLNHYPKCPEPDRAM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLA HTDS+++T+LYQ++T  GLQV+R D+ WV   PV  ++V+NVGDL+ + +NG F S
Sbjct  221  GLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWVTAPPVPGSLVVNVGDLLHILTNGIFPS  279

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKP-PVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            +LHRA V++   R S+AY +GP  DV I P P  ++    P+Y +L+WK+YLA K  +F 
Sbjct  280  VLHRARVNHVRSRFSMAYLWGPPSDVMISPLPKLVDPLQSPLYPSLTWKQYLATKATHFN  339

Query  719  KSLEKVR  739
            +SL  +R
Sbjct  340  QSLSIIR  346



>ref|XP_007161254.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
 gb|ESW33248.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
Length=351

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 154/234 (66%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS   +TGYG    S  F   MW EGFT++G P  + A+++WP D++ FC+++
Sbjct  111  DRKLKALRSAAGATGYGRARISSFFPKHMWHEGFTIMGSPCDD-AKKIWPNDHTRFCNIM  169

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ+QMK LAEKL  ++ + LG+  ++  W     L E+    +Q+N YP CP+P RAM
Sbjct  170  ENYQKQMKMLAEKLTQMMLRLLGICEDEKGWVGSRNLCEA----VQLNFYPCCPEPNRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S++T+L+QS T  GLQ+++    WV + P  + +V++ GD++ + SN RF  
Sbjct  226  GLAPHTDTSLLTILHQSQT-NGLQIFKEGAGWVPVHPHPNTLVVHTGDILHILSNSRFPC  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
             LHR +V++   R SVAYFYGP +D  + P   L    FP +++LS KEY+A+K
Sbjct  285  ALHRVMVNSERQRYSVAYFYGPPLDYVLSP---LLLSSFPRFRSLSVKEYIAIK  335



>gb|ADK71019.1| gibberellin 3-beta-hydroxylase [Trigonella kotschyi]
Length=297

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A R P+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  80   HEKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  138

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  139  LQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDEKASAAMQLNSYPSCPDPDHA  198

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV + D  WV + P+   +V+NVGDL  + SNG + 
Sbjct  199  MGLAPHTDSTFLTILSQND-ISGLQVQQEDFGWVTVPPLHGGLVVNVGDLFHILSNGLYT  257

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHRA+V+    R SVAY YGP  +V+I P  KL
Sbjct  258  SVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKL  292



>gb|ADK71010.1| gibberellin 3-beta-hydroxylase [Trigonella calliceras]
Length=299

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+D++ +CD++
Sbjct  79   HEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDHAKYCDIV  137

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ +D++W        E + + +Q+NSYP CPDP RA
Sbjct  138  LQYDEPMKKLAGKLMWLMLDSLGITKDDIKWASSKAQFEEKSCAAMQLNSYPSCPDPDRA  197

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  198  MGLAPHTDSTFLTILSQND-ISGLQVQREGLGWVTVPPLXGGLVVNVGDLFHILSNGLYT  256

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHRA+V+    R SVAY YGP  +V+I P  KL
Sbjct  257  SVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKL  291



>gb|AHW42464.1| GA3ox2 [Pinus tabuliformis]
Length=348

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 159/247 (64%), Gaps = 10/247 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QK++A+RSP+  TGYG+      F+  MW EGFT +G P  E A ++WP+DY  FC+ I
Sbjct  108  DQKIKARRSPDGVTGYGMARICTFFDRLMWSEGFTSIGSP-LEHAEKLWPDDYQDFCETI  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            ++Y   MK LA KL+SL+ +SLGL   D  W   GG      + LQMN YP CP P + M
Sbjct  167  DEYDHAMKDLASKLMSLILESLGLRQRDYSW---GG---DNCAALQMNHYPSCPRPAQTM  220

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            G+A HTDS+ +TVLYQ  +++GLQ+ R D  W  +  + +A V+N GDL+++ SNGR+KS
Sbjct  221  GMAEHTDSTFLTVLYQG-SVQGLQIKRSDGMWTVVPAIPNAFVVNAGDLLQVLSNGRYKS  279

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFF  718
            ++HRA V++   R+S AY +GP +   I+P  +L     P +Y+ L+W EYL V+  +F 
Sbjct  280  VVHRA-VNSIKPRLSFAYLWGPPLTAVIEPAPQLVDSKHPLLYRALNWNEYLVVRAKHFD  338

Query  719  KSLEKVR  739
            ++LE  R
Sbjct  339  RALEFFR  345



>ref|XP_008445137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=369

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 157/247 (64%), Gaps = 7/247 (3%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            +KL+A R+P   TGYG+   +  F+  MW EGFT++GPP  + A ++WP +Y  FCDV+E
Sbjct  129  RKLKALRTPRDVTGYGLPRITPFFSKYMWHEGFTIMGPP-IDHASQLWPSNYQPFCDVME  187

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +YQ +MK LAE++ +L+F  L +S +   W    G   +  + LQ+N YP+CPDPTR MG
Sbjct  188  EYQRKMKALAEQITNLIFNYLKIS-DCANWLHSTGAAAACSTALQLNCYPRCPDPTRVMG  246

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            LAPHTD+ ++T+L+Q+ T  GLQ++R    WV + P+  A+V+NVGDL  + SNGRF ++
Sbjct  247  LAPHTDTFLLTILHQTRTC-GLQIFRDGSGWVPVAPLPGALVLNVGDLFHILSNGRFPNV  305

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNK-DGFPMYQTLSWKEYLAVKDVYFFK  721
            LHR VV     R+S+AYFYGP  D  + P   LN     P Y+ +  K+Y+ +K      
Sbjct  306  LHRVVVDPTQRRLSMAYFYGPPPDFCVSP---LNDPPETPCYRPVVVKDYVRLKAKNLEN  362

Query  722  SLEKVRF  742
            +L  +R 
Sbjct  363  ALSMIRL  369



>ref|XP_008445138.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=351

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 158/241 (66%), Gaps = 11/241 (5%)
 Frame = +2

Query  5    QKLRAKRSPES--STGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDV  178
            QK++  RSP S  +TGYG+   S+     MW EGFT++G P +E A+++WP DY  FCDV
Sbjct  101  QKMKTLRSPGSLTATGYGMAGISKYHPKLMWHEGFTIIGSPINE-AKKLWPNDYKRFCDV  159

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGS---ILQMNSYPKCPDP  349
            +E+YQ QMKGL E+++ L+ K LG+S E++         ES G     L++NSYP CPDP
Sbjct  160  MEEYQRQMKGLGERIIRLILKFLGISEEEMMKLL-TSTDESIGKPYMALRLNSYPPCPDP  218

Query  350  TRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNG  529
             + MGLA HTD+S+ T+L+Q  +  GLQ+++    WV + P+   +V+NVGDL+ + SNG
Sbjct  219  GQVMGLAAHTDTSLCTILHQVRS-NGLQIFKDGTGWVPLSPMSGTLVVNVGDLLHILSNG  277

Query  530  RFKSLLHRAVVS-NAHHRISVAYFYGPNIDVKIKPPVKLNKDG--FPMYQTLSWKEYLAV  700
            RF S+LHR ++  N  HR S+AYFY P  D+ I P  K   D   FP+Y++++ KEY A+
Sbjct  278  RFTSILHRVMIQENKEHRFSLAYFYDPPGDIYISPYCKPLSDTPQFPLYRSVNVKEYFAI  337

Query  701  K  703
            K
Sbjct  338  K  338



>gb|ADK71006.1| gibberellin 3-beta-hydroxylase [Trigonella anguina]
Length=298

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  78   HEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  137  LQYGETMKKLAGKLMWLMLDSLGITKEDIKWVCSKAQFDEKACAAMQLNSYPSCPDPDRA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R  + WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYP  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEIWPHAKL  290



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDRA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYP  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKL  290



>gb|ADK71013.1| gibberellin 3-beta-hydroxylase [Trigonella corniculata]
Length=297

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY  +CD++
Sbjct  77   NQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYXKYCDIV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + LQ+NSYP CPDP RA
Sbjct  136  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPDRA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV +  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  196  MGLAPHTDSTFLTILSQND-ISGLQVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYP  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPNAKL  289



>ref|XP_008356836.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 158/253 (62%), Gaps = 6/253 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A R P+  +GYG    S      MW E FT+VG       + +WP+D++ FC V 
Sbjct  108  QQKLKAARLPDGISGYGFHRISAFCEKLMWSESFTIVGSXLQHFCQ-LWPQDHTKFCCVT  166

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E+Y+++MK LA +L+ L+  SL +S ED++W  P G  E   + LQ+NSYP CPDP R M
Sbjct  167  EEYEKEMKRLAARLMWLMLGSLXISKEDIKWAGPRGEFEDASAALQLNSYPACPDPDRTM  226

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLN----WVDIEPVKDAVVINVGDLMELASNG  529
            GLA HTDS+++++++QS    GLQV++   +    W+ + PV  A VINVGD + + SNG
Sbjct  227  GLAQHTDSNLLSIIHQSAKASGLQVFQEGKDEGRGWLMVPPVPGAFVINVGDFIHILSNG  286

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVK-LNKDGFPMYQTLSWKEYLAVKD  706
             +++ LHRAVV+ + HR+SVAY YGP  + ++ P  K L     P+Y  ++W EYL  K 
Sbjct  287  LYQTPLHRAVVNRSQHRVSVAYLYGPPENAQVSPLSKLLGPXCPPLYAPVTWNEYLGTKA  346

Query  707  VYFFKSLEKVRFN  745
                K+L+ +R N
Sbjct  347  KLNNKALQSLRLN  359



>gb|ADK70998.1| gibberellin 3-beta-hydroxylase [Medicago secundiflora]
Length=291

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  72   QQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYTKHCDTV  130

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  131  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHA  190

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R D  WV + P+   +V+NVGDL  + SNG + 
Sbjct  191  MGLAPHTDSTFLTILSQND-ISGLQVQREDSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  249

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+  + R SVAY YGP  +V+I P  KL
Sbjct  250  SVLHRVLVNRTYQRFSVAYLYGPPSNVEICPHEKL  284



>gb|AHW42463.1| GA3ox1 [Pinus tabuliformis]
Length=354

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 165/254 (65%), Gaps = 10/254 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+AKR+P+  TGYG    S  F+  MW EGFT VG P  E A+++WPED+  FC++I
Sbjct  94   EQKLKAKRAPDGVTGYGEARISPFFSKLMWSEGFTCVGSP-VEDAKKLWPEDHQNFCEII  152

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVE-----WFKPGGLPESTGSILQMNSYPKCPD  346
            E+Y+  MK L ++++SL+ +SLGLS+ D            G    TG+ LQMN YP CP 
Sbjct  153  EEYEHAMKNLVKRMMSLIGRSLGLSTGDFMRRCRIQDDSYGKALQTGA-LQMNYYPPCPQ  211

Query  347  PTRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASN  526
            P R MGLAPHTDS+ +T+LYQ + + GLQ+      WV +  + +A+++N+GDLM++ SN
Sbjct  212  PLRTMGLAPHTDSACLTLLYQGE-VAGLQIQHRG-EWVTVPVIPNALIVNIGDLMQILSN  269

Query  527  GRFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVK  703
            GR+KS LHRAV + +  R+S+AY +GP     I P  +L     P +Y++L+W EYL  K
Sbjct  270  GRYKSRLHRAVANRSRSRLSIAYLWGPPPRDVIMPVPQLVDSKHPLLYKSLTWNEYLVAK  329

Query  704  DVYFFKSLEKVRFN  745
             ++F ++L+   +N
Sbjct  330  SLHFDQALQLFSYN  343



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD +
Sbjct  79   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDTV  137

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  138  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDRA  197

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  198  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYP  256

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  257  SVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKL  291



>ref|XP_003550162.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=350

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 154/235 (66%), Gaps = 8/235 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS   +TGYG    S  F   MW EGFT++G P  + A+++WP DY+ FC ++
Sbjct  107  DRKLKALRSATGATGYGRARISPFFPKHMWHEGFTIMGSPCDD-AKKIWPNDYAPFCTIM  165

Query  182  EKYQEQMKGLAEKLVSLLFKSLG-LSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            + YQ+QMK LA+KL  ++F  LG +S E   W    G   +    +Q+N YP+CP+P RA
Sbjct  166  DNYQKQMKALADKLAHMIFNLLGGISEEQKRWIN--GSTNNLCEAVQLNFYPRCPEPNRA  223

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTD+S++T+L+QS T  GLQ+++    WV + P   ++V++ GD++ + SN RF+
Sbjct  224  MGLAPHTDTSLLTILHQSQT-NGLQIFKEGAGWVPVHPHPSSLVVHTGDILHILSNSRFR  282

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
              LHR +V++A  R SVAYFYGP +D  + P   L  D  P +++L+ KEY+ +K
Sbjct  283  CALHRVMVNSARERYSVAYFYGPPVDHVVSP---LVLDSLPRFRSLTVKEYIGIK  334



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 161/249 (65%), Gaps = 11/249 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESS-TGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDV  178
            +QK++A RSP  S +GYG+ P S  F   MW EG+ ++G P  + A+ +WP DY  FCD 
Sbjct  102  DQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEGYHIMGSP-IDHAKLLWPNDYQGFCDT  160

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTG-SI-LQMNSYPKCPDPT  352
            +  Y+ Q+K L E+L+ ++FKSL ++ ++V W K     ES G SI LQ+N YP CPDPT
Sbjct  161  MVHYRSQLKALTEQLIRIIFKSLNINPDEVAWLK-----ESQGLSIGLQLNCYPPCPDPT  215

Query  353  RAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGR  532
            RAMG+APHTD+S+ITVL QS  + GLQV++    WV ++PV  A+ +N+GD   + SNG 
Sbjct  216  RAMGIAPHTDTSLITVLQQS-KVSGLQVFKEGAGWVLVQPVPGAITVNLGDFFHILSNGV  274

Query  533  FKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVY  712
            F ++ HR VV+    R+S AYFY P  D  + P +  +    P YQTLS KEY+ +K  +
Sbjct  275  FTTVRHR-VVATRIRRLSFAYFYAPPGDFIVSPVLSKDFGEVPRYQTLSVKEYVGIKGKH  333

Query  713  FFKSLEKVR  739
            F K+L  ++
Sbjct  334  FEKALSVIQ  342



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/255 (41%), Positives = 165/255 (65%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL          GYG    +  F+S+MW EGFT+V     +    +WP DY  +C +I
Sbjct  83   EQKLETATQKNGIGGYGEARIAPFFDSKMWSEGFTIVAGSYRQHFPTLWPHDYDKYCGII  142

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPG--GLPESTGSILQMNSYPKCPDPTR  355
            E+Y+E+M+ LA KL+ L+  S+G++ ED++W  P   GL   +G+I ++N YP CP+P +
Sbjct  143  EEYEEEMQKLAGKLMGLILGSIGVTEEDIKWTGPNNSGLGSGSGAI-RLNHYPVCPEPDQ  201

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            AMGLA HTDS+++T+L+Q++   GLQ+++    WV ++PV   +V+NVGDL+ + SNG+ 
Sbjct  202  AMGLAAHTDSTMVTILHQNNA-AGLQMFKEGTGWVLVKPVPGLLVVNVGDLLHILSNGKL  260

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVY  712
            +S LH+A+V+    R S+AY +GP+ D+ I P  KL     P MY+ ++WKEYL +K  +
Sbjct  261  RSSLHQALVNKNKSRFSIAYLWGPSGDIDISPISKLVSPIEPAMYRPVTWKEYLEMKARH  320

Query  713  FFKSLEKVRFNPVAE  757
            F K+L  ++ +P+ +
Sbjct  321  FDKALSMIKASPLTD  335



>ref|XP_004291422.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=353

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/254 (42%), Positives = 166/254 (65%), Gaps = 12/254 (5%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            +QKL+  RSP + TGYG    S  F   MW EGFT++G   ++ A+ +WP DY  FC  +
Sbjct  103  DQKLKVLRSPGAGTGYGRAMISPFFPKHMWHEGFTIMGSA-ADHAKHLWPHDYEEFCVTM  161

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKP---GGLPEST-GSILQMNSYPKCPDP  349
            ++YQ+QMK L E+L+ ++ KSL +SS+ + W K    G    +T G+ LQ+NSYP CP+P
Sbjct  162  DEYQKQMKALIEQLIHIILKSLNISSQKLSWLKSQCSGHCTSTTPGTALQLNSYPPCPNP  221

Query  350  TRAMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNG  529
             RAMGLA HTD+S++T+L Q+ T  GLQ++R D+ W+ ++PV+ A+ +N+GD + + SNG
Sbjct  222  NRAMGLAQHTDTSLVTIL-QAQT-SGLQIFRDDVGWISVQPVRGALTVNIGDFLHILSNG  279

Query  530  RFKSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL----NKDGFPMYQTLSWKEYLA  697
            RF ++LHR VV N+  R S AYFYGP  D  I P +      +++    Y++++ KE++ 
Sbjct  280  RFVNVLHRVVV-NSIQRFSAAYFYGPPSDFLISPLLSETLCDSEEAVARYRSVTAKEFIG  338

Query  698  VKDVYFFKSLEKVR  739
            +K  +  ++L  ++
Sbjct  339  MKAKHLDRTLSLLK  352



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD +
Sbjct  79   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDTV  137

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  138  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDRA  197

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  198  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYP  256

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    ++SVAY YGP  +V+I P  KL
Sbjct  257  SVLHRGLVNRTRQKVSVAYLYGPPSNVEICPHEKL  291



>ref|XP_008461418.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=353

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 161/248 (65%), Gaps = 4/248 (2%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+  RS ES  G+G+VP S+ +  R WGEGFT++G P   L +++WPED   +CD+ E
Sbjct  91   QKLKIVRSRESIAGFGLVPLSQVYPKRPWGEGFTLIGNPVDHL-QKLWPEDCKKYCDLAE  149

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            +Y ++MK L  K++ L    LG++ ED+ W    G  +++   L+MNSYP CP+P  ++G
Sbjct  150  EYLKEMKNLCGKVMWLTLGELGITPEDINWAGSDGEFKTSNQALRMNSYPVCPEPDESIG  209

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            L PH+DSS++TVLYQ  T +GLQV      WV +EPVKDA+V+ VGD++ + +NG +   
Sbjct  210  LPPHSDSSVLTVLYQ--TTKGLQVLIEGKGWVTVEPVKDALVVQVGDMLHILTNGLYSPS  267

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
            +H+AVV+  H R+S A+F+G   + ++ P  KL     P MY T++W +YL+ K   F +
Sbjct  268  VHQAVVNQTHDRMSTAFFFGTPKNTEVSPLKKLVTPTRPLMYPTVTWADYLSKKYELFEE  327

Query  722  SLEKVRFN  745
            +L  +R +
Sbjct  328  TLPSIRLS  335



>gb|ADK71018.1| gibberellin 3-beta-hydroxylase [Trigonella glabra]
Length=294

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD++
Sbjct  77   HEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKYCDIV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E +K LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  136  LQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAAMQLNSYPSCPDPDRA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  196  MGLAPHTDSTFLTILSQND-ISGLQVQREGLGWVTVPPLHGGLVVNVGDLFHILSNGLYP  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKL  289



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 157/247 (64%), Gaps = 7/247 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESS-TGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDV  178
            +QK++A RSP  S +GYG+ P S  F   MW EG+ ++G P  E A+ +WP DY  FC  
Sbjct  102  DQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEGYHIMGSP-IEHAKLLWPNDYQGFCGT  160

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +  Y+ Q+K L E+L+ ++FKSL ++ E+V W K     E     LQ+N YP CPDPTRA
Sbjct  161  MVHYRSQLKALTEQLIRIIFKSLNINPEEVAWLKDT---EGLSIGLQLNCYPPCPDPTRA  217

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MG+APHTD+S+IT+L QS  + GLQV++    WV ++PV  A+ +N+GD+  + SNG F 
Sbjct  218  MGIAPHTDTSLITILQQSK-VSGLQVFKEGAGWVLVQPVPGAITVNLGDIFHILSNGVFT  276

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFF  718
            ++ HR VV+    R+S AYFY P  D  + P +  +    P YQTLS KEY+ +K  +F 
Sbjct  277  TVRHR-VVATPIRRLSFAYFYAPPGDFIVSPVLSKDFGEVPRYQTLSVKEYVGIKGKHFE  335

Query  719  KSLEKVR  739
            K+L  ++
Sbjct  336  KALSVIQ  342



>gb|ADK71022.1| gibberellin 3-beta-hydroxylase [Trigonella spruneriana]
Length=301

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A R P+  +GYG+   S      MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  81   HEKLKAIRPPDGVSGYGLARISSFXPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  139

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG+S ED++W        E+  + +Q+NSYP CPDP  A
Sbjct  140  LQYDETMKKLAGKLMLLMLDSLGISKEDIKWASSKAQFDENASAAMQLNSYPSCPDPDHA  199

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  200  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYT  258

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHRA+V+    R SVAY YGP  +V+I P VKL
Sbjct  259  SVLHRALVNRTRQRFSVAYLYGPPSNVEICPHVKL  293



>gb|ADK71007.1| gibberellin 3-beta-hydroxylase [Trigonella arabica]
Length=294

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP++Y+ +CD++
Sbjct  74   HEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQEYAKYCDIV  132

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  133  LQYDEIMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEKACAAMQLNSYPSCPDPDRA  192

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R  L WV + P+   +V+N+GDL  + SNG + 
Sbjct  193  MGLAPHTDSTFLTILSQND-ISGLQVQREGLGWVTVPPLHGGLVVNIGDLFHILSNGLYP  251

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  252  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKL  286



>gb|ADK71008.1| gibberellin 3-beta-hydroxylase [Trigonella balansae]
Length=302

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD++
Sbjct  80   HEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKYCDIV  138

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E +K LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP RA
Sbjct  139  LQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAAMQLNSYPSCPDPDRA  198

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  199  MGLAPHTDSTFLTILSQND-ISGLQVQREGLGWVTVPPLHGGLVVNVGDLFHILSNGLYP  257

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  258  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKL  292



>gb|EYU21920.1| hypothetical protein MIMGU_mgv1a009050mg [Erythranthe guttata]
Length=354

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 162/250 (65%), Gaps = 6/250 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A R+P  +TGYG+   S  F   MW EGFT++     E A+ +WP  Y  F D +
Sbjct  108  EQKLKAVRAPNGATGYGVARISPFFTKLMWHEGFTIMAGSAVEHAKLLWPLHYHEFWDAM  167

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
            + YQ++MK LA KL  ++ KSLG   ++ E       L +S G+ LQ+NSYP CP+P+RA
Sbjct  168  DNYQKKMKSLAYKLFLIILKSLGYDEDNQETSLLSASLNQSEGA-LQLNSYPSCPNPSRA  226

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRP-DLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            +GLAPHTDS ++T+L+Q+DT  GLQ++R   + WV + P+K A+VINVGDLM + SNG F
Sbjct  227  IGLAPHTDSLLLTILHQNDT-NGLQIFREGGVGWVPVTPLKGALVINVGDLMHILSNGCF  285

Query  536  KSLLHRAVVSNA-HHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVY  712
             ++ HR V +    HR SVAYFYGP  D  + P V + +  FP ++ ++ +EY+ +K+ +
Sbjct  286  PTVYHRVVPNETRRHRFSVAYFYGPPADSTVAPLVAVGRQ-FPRFRAVTVREYIGLKNKH  344

Query  713  FFKSLEKVRF  742
              K++  ++ 
Sbjct  345  LEKAIGLIKI  354



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGXGWVTVPPLHGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+   HR SVAY YGP   V+I P  KL
Sbjct  256  SVLHRVLVNRTRHRFSVAYLYGPPSKVEICPHEKL  290



>gb|ADK71015.1| gibberellin 3-beta-hydroxylase [Trigonella elliptica]
Length=282

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A R P+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  74   HQKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  132

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + LQ+NSYP CPDP RA
Sbjct  133  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPDRA  192

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+  T+L Q+D + GLQV +  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  193  MGLAPHTDSTFFTILSQND-ISGLQVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYP  251

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP  631
            S+LHR +V+    R SVAY YGP  +V+I P
Sbjct  252  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICP  282



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+  +S  F   MW E FT+VG P     R++WP+DY+ +CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARNSSFFPKLMWSEXFTIVGSPLDHF-RQLWPQDYAKYCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q NSYP CPDP RA
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQFNSYPSCPDPDRA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGFEWVTVPPLHGGLVVNVGDLFHILSNGLYP  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP+ +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPSSNVEICPHEKL  290



>gb|ADK70992.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=292

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD +
Sbjct  77   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDTV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  136  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  196  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYP  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKL  289



>ref|XP_003527798.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN16493.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=347

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 157/245 (64%), Gaps = 10/245 (4%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            EQKL+A RSP  +TGYG    S  F   MW EGFT++G P S  A+++WP D++ FCD++
Sbjct  111  EQKLKALRSPGGATGYGRARISPFFPKFMWHEGFTIIGSP-SHDAKKIWPNDHAGFCDLM  169

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E Y++QMK LAE+L  ++F  + +S E  +W    G    +G++ Q+N YP CP+P RAM
Sbjct  170  ENYEKQMKVLAERLTQMMFSLMDISEEKTKWV---GASNISGAV-QLNFYPSCPEPNRAM  225

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S+ T+L+QS  + GLQ+++    WV + P  + +V++ GDL+ + SN RF+S
Sbjct  226  GLAPHTDTSLFTILHQS-RITGLQIFKEGKEWVPVHPHPNTLVVHTGDLLHIISNARFRS  284

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVKDVYFFK  721
             LHR  V++   R SVAYFY P +D  + P V    D    ++ ++ KEY+ +K   F +
Sbjct  285  ALHRVTVNSTRERYSVAYFYSPPLDYVVSPLV----DSVARFRDVTVKEYIGIKAKNFGE  340

Query  722  SLEKV  736
            +L  +
Sbjct  341  ALSLI  345



>gb|ADK71004.1| gibberellin 3-beta-hydroxylase [Melilotus albus]
Length=302

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD+I
Sbjct  82   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDII  140

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + LQ+NSYP CPDP  A
Sbjct  141  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAALQLNSYPSCPDPDHA  200

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGD   + SNG + 
Sbjct  201  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDXFHILSNGLYP  259

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  260  SVLHRVLVNRTRQRFSVAYLYGPPSNVEIGPHAKL  294



>gb|ADK71003.1| gibberellin 3-beta-hydroxylase [Medicago turbinata]
Length=288

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY   CD +
Sbjct  71   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYDKHCDTV  129

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  130  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  189

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R D  WV + P+   +V+NVGDL  + SNG + 
Sbjct  190  MGLAPHTDSTFLTILSQND-ISGLQVQREDSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  248

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  249  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  283



>gb|ADK70963.1| gibberellin 3-beta-hydroxylase [Medicago fischeriana]
Length=281

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WPEDY+  CD +
Sbjct  65   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPEDYAKHCDTV  123

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  124  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHA  183

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  184  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  242

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  243  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  277



>emb|CAX46400.1| putative GA3OX protein [Rosa lucieae]
Length=240

 Score =   207 bits (527),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 152/230 (66%), Gaps = 4/230 (2%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYS-LFCDV  178
            +QKL+A R  +  +GYGI   S  F   MW EGFT+ G P  E  R++WP+DY+  F  +
Sbjct  13   QQKLKAARPADGISGYGIHRISSFFQKLMWSEGFTIAGSP-LEHFRQLWPQDYNKFFSCM  71

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRA  358
            +E+Y+++MK LA KL+ L+  SLG+  EDV W  P G  E   + +Q+NSYP CPDP RA
Sbjct  72   VEEYEKEMKRLAGKLMWLILGSLGIPKEDVIWAGPKGDFEDASNAVQLNSYPACPDPNRA  131

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLA HTDS+++++++Q++ + GLQV      W+ + PV  A+V+N+GDL  + SNG + 
Sbjct  132  MGLAEHTDSTLLSIIHQTN-ISGLQVLHEGAGWLTVPPVPGALVVNIGDLTHILSNGVYH  190

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGF-PMYQTLSWK  685
            ++LHRA+V+ +  R+S+AY YGP   V+I P  KL      P+Y+ ++WK
Sbjct  191  NVLHRAIVNRSQQRLSIAYLYGPPASVQISPQSKLVTPSHPPLYRPITWK  240



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHXKL  290



>gb|ADK71005.1| gibberellin 3-beta-hydroxylase [Melilotus indicus]
Length=299

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             +KL+  RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +C++I
Sbjct  80   HEKLKVIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCEII  138

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGG-LPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + LQ+NSYP CPDP RA
Sbjct  139  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAALQLNSYPSCPDPDRA  198

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  199  MGLAPHTDSTFMTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYP  257

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  258  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKL  292



>ref|XP_003588693.1| Gibberellin 3-beta-dioxygenase [Medicago truncatula]
 gb|AES58944.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=359

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 153/234 (65%), Gaps = 8/234 (3%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
            ++KL+A RS    TGYG    S  F   MW EGFT++G P ++ A+++WP DY  FCD +
Sbjct  115  KEKLKALRSAGGGTGYGRARISPFFPKFMWHEGFTIMGSPSND-AKKIWPNDYKRFCDTM  173

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAM  361
            E YQ+QMK LAEKL +++   LG+S E  +W    G     G+ +Q+N YP CPDP +AM
Sbjct  174  ENYQKQMKTLAEKLTNMILNILGISQEQNKWI---GSNNHVGA-MQLNFYPCCPDPKKAM  229

Query  362  GLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKS  541
            GLAPHTD+S+ T+L+QS T  GLQ+++  + +V ++P  + +V+N GD++ + SN RF+ 
Sbjct  230  GLAPHTDTSLFTILHQSQT-NGLQLFKEGVGYVPVDPHPNTLVVNTGDILHILSNSRFRC  288

Query  542  LLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFPMYQTLSWKEYLAVK  703
             LHR VV++   R SVAYFYGP +D  + P V  N    P ++ L+ K+Y+ +K
Sbjct  289  SLHRVVVNDISDRYSVAYFYGPPVDYLVSPCVGDNS--LPRFRALTVKDYIGIK  340



>gb|ADK70975.1| gibberellin 3-beta-hydroxylase [Medicago marina]
Length=275

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 137/211 (65%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+V  P     R++WP+DY+  CD +
Sbjct  67   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVESPLDHF-RQLWPQDYAKHCDTV  125

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E T + +Q+NSYP CPDP  A
Sbjct  126  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKSQFDEKTCAAMQLNSYPSCPDPDHA  185

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  186  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVSPLHGGLVVNVGDLFHILSNGLYT  244

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKP  631
            S+LHR +V+  H R SVAY YGP  +V+I P
Sbjct  245  SVLHRVLVNRTHQRFSVAYLYGPPSNVEICP  275



>gb|ADK70997.1| gibberellin 3-beta-hydroxylase [Medicago saxatilis]
Length=293

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  290



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  C+ +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCETV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+++T+L Q+D + GLQV R    WV + P++  +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTLLTILSQND-ISGLQVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  290



>ref|XP_004290878.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 160/252 (63%), Gaps = 11/252 (4%)
 Frame = +2

Query  2    EQKLRAKRSP-ESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDV  178
            +QKL+  R+P ++  GYG  P     + ++W EGFT++G P  + AR +WP DY   CD 
Sbjct  97   DQKLKTLRTPGKAIIGYGNPPFQARLSRKLWQEGFTIMGYPVDQ-ARVLWPHDYQGVCDT  155

Query  179  IEKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFK-PGGLPESTGSILQMNSYPKCPDPTR  355
            +++YQ+Q+K LAE+L+ ++FK L +S E+V+WF  P  +     S  Q+NSYP CPDPT+
Sbjct  156  MDEYQKQVKALAEQLIRIVFKFLSISQEEVDWFDDPTNM---CPSAFQLNSYPPCPDPTQ  212

Query  356  AMGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRF  535
            A+GL PHTD S+ T+L+      GLQV++  + W+ ++P  +A ++N+GD++ + SNGRF
Sbjct  213  ALGLPPHTDGSLFTILHSR--TEGLQVFKEGVGWITVQPNPEAFIVNLGDVLHIMSNGRF  270

Query  536  KSLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLN---KDGFPMYQTLSWKEYLAVKD  706
             S+LHRA V    HRIS AYFY P +D  I P +  N    +  P Y++++ KEY  +K 
Sbjct  271  VSVLHRAAVIQKDHRISAAYFYWPPMDFTISPILSKNSADSEQVPKYRSVTLKEYHVIKT  330

Query  707  VYFFKSLEKVRF  742
             +   +L  +R 
Sbjct  331  KHCQDTLSVIRI  342



>gb|ADK70966.1| gibberellin 3-beta-hydroxylase [Medicago hybrida]
 gb|ADK70996.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=295

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  77   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  136  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  196  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  289



>ref|XP_008461419.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=378

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 153/248 (62%), Gaps = 3/248 (1%)
 Frame = +2

Query  5    QKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVIE  184
            QKL+A R+P+   GYG    S  F   MW EGFTV G P  E  + +WP D + +CD+IE
Sbjct  115  QKLKAARAPDGVNGYGRFRISPFFPKSMWSEGFTVSGSP-LEHFQILWPHDCTKYCDIIE  173

Query  185  KYQEQMKGLAEKLVSLLFKSLGLSSEDVEWFKPGGLPESTGSILQMNSYPKCPDPTRAMG  364
            ++  ++K L  +LV L    LG++ EDV W  P G  E++  ++ +NSYP CPDP RAMG
Sbjct  174  EFDRELKALCGRLVWLALGELGITKEDVHWAGPNGDFETSSGVMNLNSYPVCPDPDRAMG  233

Query  365  LAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFKSL  544
            +  HTDS  +T+LYQ++T  GLQV R    WV +EPV  A+V+ V DL+++ +NG + S 
Sbjct  234  IGVHTDSCFLTLLYQNNT-SGLQVLREGKRWVTVEPVTGALVVQVADLLQILTNGLYSSP  292

Query  545  LHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKLNKDGFP-MYQTLSWKEYLAVKDVYFFK  721
             H+AVV+    R+SVAYF+GP  + +I P  KL     P +Y T++W EYL  K   F  
Sbjct  293  FHQAVVNRDRKRLSVAYFFGPPENAEISPIKKLVTPTQPLLYPTVTWAEYLRKKAELFND  352

Query  722  SLEKVRFN  745
            +L  +R +
Sbjct  353  TLPSIRLS  360



>gb|ADK70995.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=298

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED+EW        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  290



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY+ +CD +
Sbjct  71   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKYCDTV  129

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  130  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  189

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  190  MGLAPHTDSTFLTILSQND-ISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYT  248

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  249  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  283



>gb|ADK70988.1| gibberellin 3-beta-hydroxylase [Medicago praecox]
Length=293

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 137/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+ G P     R++WP+DY   CD +
Sbjct  76   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIAGSPLDHF-RQLWPQDYDKHCDTV  134

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  135  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  194

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  195  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  253

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+  H R SVAY YGP  +V+I P  KL
Sbjct  254  SVLHRVLVNRTHQRFSVAYLYGPPSNVEICPHEKL  288



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W      L E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  290



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+  CD +
Sbjct  78   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKHCDTV  136

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  137  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  196

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG F 
Sbjct  197  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFT  255

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  256  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  290



>gb|ADK70962.1| gibberellin 3-beta-hydroxylase [Medicago daghestanica]
Length=290

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 137/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY   CD +
Sbjct  74   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYDKHCDTV  132

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  133  LQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  192

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG F 
Sbjct  193  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFT  251

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  252  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  286



>gb|ADK70954.1| gibberellin 3-beta-hydroxylase [Medicago arabica]
Length=297

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     +++WP+DY+  CD +
Sbjct  77   HQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-QQLWPQDYAKHCDTV  135

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG+S ED++W        E   + +Q+NSYP CPDP  A
Sbjct  136  LQYDEAMKKLAGKLMWLMLDSLGISMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  195

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+++T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG F 
Sbjct  196  MGLAPHTDSTLLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFT  254

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  255  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  289



>gb|ADK71021.1| gibberellin 3-beta-hydroxylase [Trigonella sp. TU 33879]
Length=274

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 137/209 (66%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A R P+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY+ +CD++
Sbjct  67   HQKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF-RQLWPQDYAKYCDIV  125

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEW-FKPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + LQ+NSYP CPDP RA
Sbjct  126  LQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPDRA  185

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+  T+L Q+D + GLQV +  L WV + P+   +V+NVGDL  + SNG + 
Sbjct  186  MGLAPHTDSTFFTILSQND-ISGLQVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYP  244

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKI  625
            S+LHR +V+    R SVAY YGP  +V+I
Sbjct  245  SVLHRVLVNRTRQRFSVAYLYGPPSNVEI  273



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP++Y+ +CD +
Sbjct  67   HQKLKAIRSPDGVSGYGLARISSFFTKLMWSEGFTIVGSPLDHF-RQLWPQEYAKYCDTV  125

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  126  LQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  185

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  186  MGLAPHTDSTFLTILSQND-ISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYT  244

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  245  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  279



>gb|ADK71000.1| gibberellin 3-beta-hydroxylase [Medicago soleirolii]
Length=281

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 137/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    EQKLRAKRSPESSTGYGIVPSSRNFNSRMWGEGFTVVGPPPSELARRVWPEDYSLFCDVI  181
             QKL+A RSP+  +GYG+   S  F   MW EGFT+VG P     R++WP+DY   CD +
Sbjct  63   HQKLKAIRSPDGVSGYGLARISSFFTKLMWSEGFTIVGSPLDHF-RQLWPQDYDKHCDTV  121

Query  182  EKYQEQMKGLAEKLVSLLFKSLGLSSEDVEWF-KPGGLPESTGSILQMNSYPKCPDPTRA  358
             +Y E MK LA KL+ L+  SLG++ ED++W        E   + +Q+NSYP CPDP  A
Sbjct  122  LQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHA  181

Query  359  MGLAPHTDSSIITVLYQSDTLRGLQVYRPDLNWVDIEPVKDAVVINVGDLMELASNGRFK  538
            MGLAPHTDS+ +T+L Q+D + GLQV R    WV + P+   +V+NVGDL  + SNG + 
Sbjct  182  MGLAPHTDSTFLTILSQND-ISGLQVQREGSEWVTVPPLHGGLVVNVGDLFHILSNGLYT  240

Query  539  SLLHRAVVSNAHHRISVAYFYGPNIDVKIKPPVKL  643
            S+LHR +V+    R SVAY YGP  +V+I P  KL
Sbjct  241  SVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKL  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852