BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13976_g1_i1 len=385 path=[1:0-102 104:103-384]

Length=385
                                                                      Score     E

dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     125   1e-31   Ipomoea nil [qian niu]
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                 97.4    2e-21   
gb|KDP32333.1|  hypothetical protein JCGZ_13258                       97.1    2e-21   
gb|KDO80407.1|  hypothetical protein CISIN_1g036755mg                 92.4    1e-20   
ref|XP_006451039.1|  hypothetical protein CICLE_v10010488mg           92.8    1e-20   
ref|XP_007013765.1|  Gibberellin 3-oxidase 3, putative                94.7    2e-20   
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  93.6    4e-20   
ref|XP_004291424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  93.2    5e-20   
ref|XP_002324270.1|  gibberellin 3 beta-hydroxylase family protein    92.8    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011026517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  92.4    9e-20   
ref|XP_004498636.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  91.3    2e-19   
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  90.9    4e-19   
gb|AFK49394.1|  unknown                                               89.0    2e-18   
gb|KDP32294.1|  hypothetical protein JCGZ_13219                       89.0    2e-18   
ref|XP_002515599.1|  gibberellin 3-beta hydroxylase, putative         88.6    2e-18   Ricinus communis
gb|ABI64150.1|  gibberellin 3-oxidase                                 87.8    4e-18   Pisum sativum [garden pea]
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg           87.8    4e-18   
gb|KCW53766.1|  hypothetical protein EUGRSUZ_J03019                   87.4    5e-18   
ref|XP_003588693.1|  Gibberellin 3-beta-dioxygenase                   87.0    8e-18   
ref|XP_007137070.1|  hypothetical protein PHAVU_009G097200g           86.7    9e-18   
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.7    1e-17   
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg           86.3    1e-17   
ref|NP_001274405.1|  gibberellin 3-beta-dioxygenase 1-like            85.9    2e-17   
ref|XP_002284981.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      85.9    2e-17   Vitis vinifera
gb|KGN62899.1|  hypothetical protein Csa_2G379300                     86.3    2e-17   
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.5    2e-17   
gb|AGQ42612.1|  GA3ox3                                                85.9    3e-17   
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative         85.5    3e-17   
ref|XP_003527798.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.1    4e-17   
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.1    4e-17   
ref|XP_006450547.1|  hypothetical protein CICLE_v10010629mg           84.7    4e-17   
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.1    5e-17   
emb|CAN73736.1|  hypothetical protein VITISV_025221                   85.5    5e-17   Vitis vinifera
ref|XP_006476223.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.3    7e-17   
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.3    8e-17   
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.3    8e-17   
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.0    9e-17   
ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      84.3    1e-16   
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.6    1e-16   
ref|XP_006382066.1|  gibberellin 3 beta-hydroxylase family protein    83.6    1e-16   
ref|XP_009117822.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.6    2e-16   
emb|CDX81720.1|  BnaC08g38810D                                        82.8    3e-16   
dbj|BAG32267.1|  gibberellin 3-oxidase                                82.8    3e-16   Allium fistulosum [Japanese bunching onion]
ref|XP_011082243.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.5    3e-16   
ref|XP_003544624.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.4    4e-16   
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg           82.4    4e-16   
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                 83.2    4e-16   
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.4    5e-16   
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg           81.6    6e-16   
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.0    6e-16   
dbj|BAJ65442.1|  gibberellin 3-oxidase                                82.4    6e-16   
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.3    8e-16   
ref|XP_003522638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.3    1e-15   
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.9    1e-15   
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.9    1e-15   
dbj|BAM73280.1|  gibberellin 3 oxidase 1                              80.5    2e-15   
ref|XP_009148952.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      80.5    2e-15   
ref|XP_007137069.1|  hypothetical protein PHAVU_009G097100g           80.5    2e-15   
ref|XP_011019738.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.5    2e-15   
emb|CDY36572.1|  BnaA06g10250D                                        80.5    2e-15   
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.5    2e-15   
emb|CDY39663.1|  BnaC05g11920D                                        80.1    3e-15   
ref|NP_001269085.1|  uncharacterized protein LOC100265167             80.1    3e-15   
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                       80.1    3e-15   Lactuca sativa [cultivated lettuce]
emb|CAN80137.1|  hypothetical protein VITISV_028510                   80.1    3e-15   Vitis vinifera
ref|XP_007161254.1|  hypothetical protein PHAVU_001G055000g           80.1    3e-15   
ref|XP_008445137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.7    5e-15   
gb|AGN95009.1|  gibberellin 3-beta-dioxygenase                        79.3    5e-15   
dbj|BAD91162.1|  gibberellin 3-beta hydroxylase                       79.3    7e-15   Prunus subhirtella [Higan cherry]
ref|XP_008228615.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      79.3    7e-15   
ref|XP_007215556.1|  hypothetical protein PRUPE_ppa007336mg           79.3    7e-15   
gb|AEK70424.1|  GA3ox2                                                79.3    7e-15   
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.0    7e-15   
gb|AGQ42610.1|  GA3ox2                                                79.0    8e-15   
emb|CDX76441.1|  BnaA08g09590D                                        79.0    8e-15   
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      79.0    8e-15   Vitis vinifera
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative         79.0    8e-15   Ricinus communis
ref|XP_009108486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      79.0    8e-15   
emb|CDY31424.1|  BnaC03g64000D                                        78.6    8e-15   
emb|CDP19027.1|  unnamed protein product                              78.6    8e-15   
gb|AAF80661.1|AF074710_1  putative gibberellin 3 beta hydroxylase     78.6    9e-15   Citrullus lanatus [wild melon]
ref|XP_004240225.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  78.6    1e-14   
ref|XP_007024019.1|  Gibberellin 3-oxidase 1, putative                78.6    1e-14   
gb|AEW67998.1|  gibberellin 3 oxidase 1                               78.6    1e-14   
ref|XP_008785607.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  78.6    1e-14   
dbj|BAG48321.1|  gibberellin 3-oxidase2                               78.2    1e-14   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010520599.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      78.6    1e-14   
gb|ABN80396.1|  gibberellin beta-hydroxylase                          75.9    2e-14   Lactuca sativa [cultivated lettuce]
ref|XP_007227245.1|  hypothetical protein PRUPE_ppa018007mg           77.8    2e-14   
gb|ACF71491.1|  gibberellin 3-beta hydroxylase                        78.2    2e-14   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EYU21920.1|  hypothetical protein MIMGU_mgv1a009050mg              77.8    2e-14   
gb|AHC32022.1|  gibberellin 3-oxidase 1                               78.2    2e-14   
gb|AAB64347.1|  gibberellin 2beta,3beta-hydroxylase                   77.8    2e-14   Cucurbita maxima [Boston marrow]
gb|AEK70423.1|  GA3ox1                                                77.8    2e-14   
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                        78.2    2e-14   Medicago sativa subsp. caerulea
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                        78.2    2e-14   Medicago sativa subsp. caerulea
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative         77.8    2e-14   Ricinus communis
emb|CDP04846.1|  unnamed protein product                              77.4    2e-14   
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg           77.4    3e-14   
gb|ADM47337.1|  gibberellin 3-oxidase 1                               77.4    3e-14   
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                   77.8    3e-14   
gb|KDO58203.1|  hypothetical protein CISIN_1g043985mg                 77.4    3e-14   
ref|XP_009355033.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.4    3e-14   
gb|ABG46320.1|  gibberellin 3-oxidase 1                               77.4    3e-14   Rumex palustris
gb|AAR12160.1|  gibberellin 3-oxidase                                 77.4    3e-14   Populus tremula x Populus tremuloides
ref|XP_002303276.1|  gibberellin 3-beta-hydroxylase family protein    77.4    3e-14   Populus trichocarpa [western balsam poplar]
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                        77.4    4e-14   Medicago falcata [sickle alfalfa]
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.4    4e-14   
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    4e-14   
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein        77.0    4e-14   
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein    77.0    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                 77.0    5e-14   
ref|XP_008356836.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    5e-14   
ref|XP_008347459.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  76.6    5e-14   
ref|XP_010249916.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    5e-14   
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      76.3    5e-14   
emb|CDP17660.1|  unnamed protein product                              75.5    6e-14   
emb|CBL59327.1|  Gibberellin 3-oxidase                                76.3    7e-14   
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  76.6    7e-14   
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                         76.3    8e-14   Lactuca sativa [cultivated lettuce]
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  76.3    8e-14   
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  76.3    8e-14   
gb|KFK43811.1|  hypothetical protein AALP_AA1G176200                  76.3    9e-14   
gb|EYU21574.1|  hypothetical protein MIMGU_mgv1a017804mg              76.3    9e-14   
ref|XP_006416894.1|  hypothetical protein EUTSA_v10008008mg           75.9    1e-13   
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.9    1e-13   
ref|XP_008377587.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      75.9    1e-13   
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                        74.7    1e-13   
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      75.5    1e-13   
ref|XP_003550162.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.1    2e-13   
emb|CAH69705.1|  gibberellin 3-oxidase                                75.1    2e-13   Phaseolus coccineus [scarlet runner bean]
ref|XP_004292966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.1    2e-13   
ref|XP_006285095.1|  hypothetical protein CARUB_v10006427mg           75.1    2e-13   
gb|KGN62900.1|  hypothetical protein Csa_2G379310                     72.8    2e-13   
ref|XP_010449018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  75.1    2e-13   
dbj|BAD30035.1|  gibberellin 3beta-hydroxylase1                       74.7    2e-13   Daucus carota [carrots]
ref|XP_008804067.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    2e-13   
ref|XP_008219863.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
gb|ABB00360.1|  gibberellin 3-oxidase                                 74.7    3e-13   Fragaria x ananassa
ref|XP_004291423.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
ref|XP_006465424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
gb|AFS18537.1|  gibberellin 3-oxidase                                 74.7    3e-13   
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                        74.7    3e-13   Lactuca sativa [cultivated lettuce]
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.7    3e-13   
ref|XP_007208198.1|  hypothetical protein PRUPE_ppa020537mg           74.3    4e-13   
ref|XP_008218314.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  74.3    4e-13   
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                       73.9    5e-13   Daucus carota [carrots]
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                        73.2    5e-13   
emb|CDP18939.1|  unnamed protein product                              74.3    5e-13   
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.9    5e-13   
ref|XP_008344679.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  71.6    6e-13   
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                     73.9    6e-13   Nicotiana sylvestris
gb|ABO70984.1|  gibberellin 3-oxidase 2                               73.9    6e-13   Nicotiana tabacum [American tobacco]
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.9    6e-13   
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-13   
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                        72.8    7e-13   
ref|XP_008461056.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.6    7e-13   
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-13   
ref|NP_193900.1|  gibberellin 3-beta-dioxygenase 3                    73.6    8e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-13   
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-13   
ref|XP_008461419.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.6    8e-13   
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                        72.4    8e-13   
gb|ABK28643.1|  unknown                                               73.2    8e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                        72.4    8e-13   
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-13   
ref|XP_010434144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      73.2    9e-13   
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-13   
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-13   
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-13   
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-13   
ref|NP_001275523.1|  gibberellin 3-beta-dioxygenase 1-like            73.2    9e-13   
emb|CDP17661.1|  unnamed protein product                              73.2    1e-12   
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.2    1e-12   
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                        72.4    1e-12   
ref|XP_010459098.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.8    1e-12   
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      72.8    1e-12   
ref|XP_010476647.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      72.8    1e-12   
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  73.2    1e-12   
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                        72.0    1e-12   
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.8    1e-12   
ref|XP_009345720.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  72.8    1e-12   
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                        71.6    1e-12   
ref|XP_011039983.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.6    1e-12   
ref|XP_008232563.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  72.8    2e-12   
ref|XP_010497240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.8    2e-12   
ref|XP_010439443.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  72.4    2e-12   
ref|XP_003546239.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    2e-12   
gb|KDP37169.1|  hypothetical protein JCGZ_06225                       72.8    2e-12   
ref|XP_008387508.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    2e-12   
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                        71.6    2e-12   
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                        71.6    2e-12   
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
ref|XP_008352044.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.0    2e-12   
gb|ADM47339.1|  gibberellin 3-oxidase 3                               72.4    2e-12   
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    2e-12   
ref|XP_010049018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    2e-12   
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|AFK37640.1|  unknown                                               72.4    2e-12   
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
ref|XP_008359473.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  72.4    2e-12   
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-12   
gb|ADK70957.1|  gibberellin 3-beta-hydroxylase                        70.9    2e-12   
gb|AAC96016.1|  truncated gibberellin 3B-hydroxylase                  70.1    2e-12   
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                        71.2    3e-12   
dbj|BAD30036.1|  gibberellin 3beta-hydroxylase2                       72.0    3e-12   Daucus carota [carrots]
ref|XP_009128433.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2      72.0    3e-12   
emb|CDM81908.1|  unnamed protein product                              72.0    3e-12   
emb|CDY37589.1|  BnaA02g19810D                                        72.0    3e-12   
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-12   
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                        71.2    3e-12   
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-12   
gb|ADK70967.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-12   
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-12   
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-12   
emb|CDY38661.1|  BnaC02g23180D                                        71.6    4e-12   
ref|NP_001267625.1|  gibberellin 3-beta-dioxygenase 1-like            71.6    4e-12   
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                        70.9    4e-12   
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                        70.9    4e-12   
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                        70.9    4e-12   
dbj|BAG48320.1|  gibberellin 3-oxidase1                               71.6    4e-12   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003533057.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  71.6    4e-12   
dbj|BAQ02990.1|  gibberellin 3-oxidase                                71.6    4e-12   
ref|XP_004158764.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  71.6    5e-12   
emb|CDP19904.1|  unnamed protein product                              71.2    6e-12   
ref|XP_009372969.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.9    6e-12   
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                        70.1    6e-12   
ref|XP_010925284.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  71.2    6e-12   
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.9    6e-12   
gb|ADM47338.1|  gibberellin 3-oxidase 2                               71.2    6e-12   
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                        70.1    7e-12   
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                        70.1    7e-12   
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      70.9    7e-12   
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                        69.7    8e-12   
emb|CDY37588.1|  BnaA02g19820D                                        70.9    8e-12   
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                        69.7    8e-12   
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  70.5    8e-12   
ref|XP_002525827.1|  leucoanthocyanidin dioxygenase, putative         70.5    8e-12   Ricinus communis
gb|ACN89834.1|  gibberellin 3-oxidase                                 70.5    9e-12   Solanum tuberosum subsp. andigenum
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                        69.7    9e-12   
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  70.5    1e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004296193.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  70.5    1e-11   
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.5    1e-11   
emb|CAC83089.1|  gibberellin 3-oxidase                                70.5    1e-11   Cucurbita maxima [Boston marrow]
ref|XP_002869872.1|  gibberellin 3-oxidase 3                          70.1    1e-11   
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-11   
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-11   
ref|XP_011081703.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.1    1e-11   
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-11   
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-11   
ref|XP_010670743.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.1    1e-11   
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-11   
ref|XP_004135830.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.1    1e-11   
ref|XP_004158763.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...  70.1    2e-11   
gb|AAT49060.1|  GA 3-oxidase 1                                        70.1    2e-11   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK06541.1|  predicted protein                                    70.1    2e-11   
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                        69.7    2e-11   Pisum sativum [garden pea]
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                  69.7    2e-11   Pisum sativum [garden pea]
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                        68.9    2e-11   
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...  69.7    2e-11   Pisum sativum [garden pea]
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  69.3    2e-11   
ref|XP_009375631.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  69.7    2e-11   
ref|XP_002892873.1|  hypothetical protein ARALYDRAFT_471756           69.3    2e-11   
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                        68.6    2e-11   
gb|AAN87570.1|  gibberellin 3-oxidase                                 69.3    3e-11   Spinacia oleracea
ref|XP_011048230.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  69.3    3e-11   
ref|XP_010277719.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  68.9    3e-11   
emb|CAB92914.1|  gibberellin 3-beta-hydroxylase                       68.9    3e-11   Cucurbita maxima [Boston marrow]
gb|AHC32023.1|  gibberellin 3-oxidase 2                               69.3    3e-11   
ref|XP_004136072.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  69.3    3e-11   
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                        68.9    4e-11   Pisum sativum [garden pea]
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  68.9    4e-11   
gb|KDP40922.1|  hypothetical protein JCGZ_24921                       69.7    4e-11   
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                        67.8    4e-11   
ref|XP_011048234.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  68.6    4e-11   
gb|KHN47796.1|  Gibberellin 3-beta-dioxygenase 1                      68.9    4e-11   
ref|XP_009620118.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  68.6    4e-11   
ref|XP_010691237.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  68.9    5e-11   
ref|NP_173008.1|  gibberellin 3-beta-dioxygenase 1                    68.6    5e-11   
ref|XP_009771649.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  68.6    5e-11   
gb|ACU16692.1|  unknown                                               67.0    5e-11   
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  68.2    6e-11   
ref|XP_009764116.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  68.2    6e-11   
gb|KDP40921.1|  hypothetical protein JCGZ_24920                       68.2    6e-11   
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                        67.4    6e-11   
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  68.2    6e-11   
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                        67.4    6e-11   
ref|XP_009613782.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  68.2    7e-11   
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg           68.2    7e-11   
ref|NP_001146525.1|  GA 3-oxidase 2                                   68.2    8e-11   
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                        66.6    8e-11   
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                        67.0    8e-11   
ref|XP_004166949.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  65.9    9e-11   
ref|XP_002297642.1|  oxidoreductase family protein                    67.8    9e-11   
ref|XP_008647746.1|  PREDICTED: GA 3-oxidase 2 isoform X1             67.8    9e-11   
gb|KHN27813.1|  1-aminocyclopropane-1-carboxylate oxidase like 1      67.8    9e-11   
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                      67.0    9e-11   
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
gb|ACL54258.1|  unknown                                               67.8    1e-10   
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
dbj|BAL22344.1|  oxidoreductase                                       67.4    1e-10   
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
ref|XP_009400517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.4    1e-10   
ref|XP_002525828.1|  leucoanthocyanidin dioxygenase, putative         67.4    1e-10   
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
ref|XP_003530089.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1      67.4    1e-10   
ref|XP_003543662.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.4    1e-10   
emb|CDY38660.1|  BnaC02g23190D                                        67.4    1e-10   
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                        66.6    1e-10   
ref|XP_008445138.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.0    1e-10   
ref|XP_002887836.1|  gibberellin 3-oxidase 4                          67.0    2e-10   
ref|XP_008461055.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...  67.0    2e-10   
gb|KHN47324.1|  Gibberellin 2-beta-dioxygenase                        66.6    2e-10   
ref|XP_003542935.1|  PREDICTED: gibberellin 2-beta-dioxygenase-like   66.6    2e-10   
ref|XP_006368541.1|  hypothetical protein POPTR_0001s04390g           66.6    2e-10   
gb|ACU22843.1|  unknown                                               64.3    2e-10   
dbj|BAL22345.1|  oxidoreductase                                       67.0    2e-10   
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.0    2e-10   
ref|XP_002525830.1|  leucoanthocyanidin dioxygenase, putative         67.0    2e-10   
ref|XP_009798906.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  67.0    2e-10   
ref|XP_002299115.2|  oxidoreductase family protein                    66.6    2e-10   
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                        66.2    2e-10   
ref|XP_006413746.1|  hypothetical protein EUTSA_v10026853mg           66.6    2e-10   
gb|EPS71653.1|  gibberellin 3-oxidase                                 66.2    2e-10   
ref|XP_009385827.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  66.6    2e-10   
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                        65.9    3e-10   
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                        65.9    3e-10   
emb|CDX87303.1|  BnaA07g35700D                                        64.3    3e-10   
ref|XP_002862164.1|  hypothetical protein ARALYDRAFT_920152           64.3    3e-10   
ref|XP_004136777.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  65.9    3e-10   
ref|XP_006494135.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  64.3    3e-10   
ref|XP_010037118.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  66.2    3e-10   
dbj|BAL22343.1|  oxidoreductase                                       66.2    3e-10   
ref|XP_003593922.1|  Gibberellin 2-oxidase                            65.9    3e-10   
ref|XP_002525829.1|  leucoanthocyanidin dioxygenase, putative         66.2    3e-10   
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                        65.5    3e-10   
ref|XP_006305164.1|  hypothetical protein CARUB_v10009532mg           66.2    3e-10   
gb|AAC83647.1|  gibberellin 3 beta-hydroxylase                        65.9    3e-10   
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                    65.9    3e-10   
emb|CDP17662.1|  unnamed protein product                              65.9    3e-10   
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                        65.5    4e-10   
ref|XP_007025079.1|  Gibberellin 2-beta-dioxygenase isoform 2         64.7    4e-10   
ref|XP_006389781.1|  hypothetical protein EUTSA_v10019663mg           65.9    4e-10   
ref|XP_006420483.1|  hypothetical protein CICLE_v10005223mg           66.2    4e-10   
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                        65.1    4e-10   
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g           66.2    4e-10   
ref|XP_009146469.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1      65.9    4e-10   
ref|XP_010417722.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  65.9    4e-10   
emb|CDY23625.1|  BnaC05g39690D                                        65.9    4e-10   
gb|KGN59447.1|  hypothetical protein Csa_3G821020                     65.9    4e-10   
ref|XP_006420488.1|  hypothetical protein CICLE_v10005226mg           65.9    5e-10   
gb|ACT99991.1|  gibberellin 3-oxidase                                 65.9    5e-10   
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  65.9    5e-10   
ref|XP_006420444.1|  hypothetical protein CICLE_v10006781mg           63.2    5e-10   
ref|XP_010487121.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  65.5    6e-10   
ref|XP_007150692.1|  hypothetical protein PHAVU_005G173500g           65.5    6e-10   
ref|XP_009613663.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  65.5    6e-10   
ref|XP_010472948.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2      65.5    6e-10   
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                  65.5    6e-10   
ref|XP_010110967.1|  Gibberellin 2-beta-dioxygenase                   65.1    7e-10   
emb|CBI16506.3|  unnamed protein product                              63.9    7e-10   
ref|XP_006301563.1|  hypothetical protein CARUB_v10021997mg           65.1    8e-10   
emb|CDX92296.1|  BnaA05g21110D                                        65.1    8e-10   
ref|XP_006340351.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  65.1    8e-10   
ref|XP_009396646.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  65.1    8e-10   
ref|XP_010500769.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  65.1    8e-10   
ref|XP_009145834.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  65.1    8e-10   
ref|XP_010540574.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...  65.1    8e-10   
ref|XP_002882832.1|  oxidoreductase                                   65.1    8e-10   
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                        64.3    8e-10   
ref|XP_008352041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    9e-10   
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  65.1    9e-10   
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                        64.3    9e-10   
emb|CDX75720.1|  BnaC03g38030D                                        65.1    9e-10   
ref|XP_004251440.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  65.1    9e-10   
emb|CDX99287.1|  BnaC05g34020D                                        64.7    9e-10   
ref|XP_001775917.1|  predicted protein                                65.1    9e-10   
ref|XP_006352128.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  62.8    1e-09   
ref|XP_007025078.1|  Gibberellin 2-beta-dioxygenase isoform 1         64.7    1e-09   
gb|ACG46320.1|  gibberellin 3-beta-dioxygenase 2-2                    64.7    1e-09   
ref|XP_009764115.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  64.7    1e-09   
ref|XP_008225485.1|  PREDICTED: gibberellin 2-beta-dioxygenase-like   64.7    1e-09   
gb|KHN30847.1|  1-aminocyclopropane-1-carboxylate oxidase like 1      64.3    1e-09   
gb|AEA51242.1|  gibberellin 2-beta-dioxygenase                        64.3    1e-09   
gb|KDP40923.1|  hypothetical protein JCGZ_24922                       64.7    1e-09   
ref|XP_007213039.1|  hypothetical protein PRUPE_ppa020243mg           64.7    1e-09   
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg           64.7    1e-09   
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  64.7    1e-09   
gb|KDO43657.1|  hypothetical protein CISIN_1g017838mg                 64.7    1e-09   
gb|ACU20093.1|  unknown                                               62.0    1e-09   
ref|XP_002885061.1|  oxidoreductase                                   64.3    1e-09   
ref|XP_010429980.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      64.3    1e-09   
sp|Q9XG83.1|G2OX_PHACN  RecName: Full=Gibberellin 2-beta-dioxygen...  64.3    1e-09   
ref|XP_006340353.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  64.3    1e-09   
ref|XP_008384037.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...  63.9    1e-09   
gb|AEK70419.1|  GA2ox3                                                64.3    1e-09   
ref|XP_007014695.1|  Leucoanthocyanidin dioxygenase, putative         64.3    1e-09   
ref|XP_003520370.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  64.3    1e-09   
gb|EMT19131.1|  1-aminocyclopropane-1-carboxylate oxidase-4-like ...  63.9    1e-09   
ref|XP_010465206.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1      64.3    1e-09   
ref|XP_009357421.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...  63.9    1e-09   
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                        63.9    1e-09   
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                        63.2    1e-09   
gb|KHG17959.1|  Gibberellin 2-beta-dioxygenase                        64.3    1e-09   
ref|XP_007044805.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  64.3    1e-09   
ref|XP_010552260.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...  64.3    2e-09   
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                 64.3    2e-09   
ref|NP_001233855.1|  3b-hydroxylase                                   64.3    2e-09   
ref|XP_009348617.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  62.4    2e-09   
ref|XP_002285698.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1      64.3    2e-09   
ref|XP_002887835.1|  predicted protein                                63.9    2e-09   
ref|NP_001240180.1|  1-aminocyclopropane-1-carboxylate oxidase ho...  63.9    2e-09   
ref|XP_006280733.1|  hypothetical protein CARUB_v10026702mg           63.9    2e-09   
gb|KFK38706.1|  hypothetical protein AALP_AA3G149300                  63.9    2e-09   
ref|XP_007014697.1|  Leucoanthocyanidin dioxygenase, putative         62.8    2e-09   
ref|XP_006494130.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...  63.9    2e-09   
ref|XP_004971232.1|  PREDICTED: DIBOA-glucoside dioxygenase BX6-like  63.9    2e-09   
ref|XP_007147907.1|  hypothetical protein PHAVU_006G165000g           63.5    2e-09   
ref|XP_006407193.1|  hypothetical protein EUTSA_v10021003mg           63.5    2e-09   
ref|XP_006420455.1|  hypothetical protein CICLE_v10006569mg           63.5    2e-09   
ref|XP_006494133.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...  63.5    2e-09   
ref|XP_006280652.1|  hypothetical protein CARUB_v10026612mg           63.9    2e-09   
ref|XP_009607354.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  61.6    3e-09   
gb|KGN45324.1|  hypothetical protein Csa_7G435490                     61.2    3e-09   
gb|AFK39660.1|  unknown                                               61.6    3e-09   
gb|KHN33148.1|  Gibberellin 2-beta-dioxygenase                        63.2    3e-09   
ref|XP_006829636.1|  hypothetical protein AMTR_s00122p00090120        63.5    3e-09   
ref|NP_001242439.1|  uncharacterized protein LOC100806026             63.2    3e-09   
ref|XP_007214717.1|  hypothetical protein PRUPE_ppa008211mg           63.2    3e-09   
gb|KDP37976.1|  hypothetical protein JCGZ_04619                       63.2    3e-09   
ref|XP_006844783.1|  hypothetical protein AMTR_s00016p00259900        63.2    3e-09   
ref|XP_009135312.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  63.2    3e-09   
gb|ACT87982.1|  gibberellin 2-oxidase                                 63.2    4e-09   
emb|CDX82531.1|  BnaA03g32900D                                        63.2    4e-09   
ref|XP_006299806.1|  hypothetical protein CARUB_v10016002mg           63.2    4e-09   
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                        62.4    4e-09   
ref|XP_006445646.1|  hypothetical protein CICLE_v10017914mg           62.8    4e-09   
gb|ADK71024.1|  gibberellin 3-beta-hydroxylase                        62.4    4e-09   
emb|CBI16504.3|  unnamed protein product                              61.2    4e-09   
dbj|BAJ98444.1|  predicted protein                                    63.2    4e-09   
ref|XP_007212925.1|  hypothetical protein PRUPE_ppa022391mg           63.2    4e-09   
ref|XP_008358356.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  63.2    4e-09   
ref|XP_006488902.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  63.2    4e-09   
ref|XP_004251239.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  62.8    4e-09   
ref|XP_010327291.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...  62.8    4e-09   
ref|XP_006340355.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  62.8    5e-09   
emb|CDY52444.1|  BnaA07g39210D                                        62.8    5e-09   
ref|XP_009118653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.8    5e-09   
emb|CDX88447.1|  BnaC06g38910D                                        62.8    5e-09   
emb|CDY32542.1|  BnaA09g50540D                                        62.8    5e-09   
dbj|BAB62153.1|  GA 3beta-hydroxylase                                 62.0    5e-09   
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                        62.8    5e-09   
ref|XP_009106551.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...  62.8    5e-09   
gb|EMS57739.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...  61.2    5e-09   
ref|XP_008227301.1|  PREDICTED: codeine O-demethylase-like            62.8    5e-09   
gb|KEH38429.1|  plant gibberellin 2-oxidase                           62.4    5e-09   
ref|XP_004296613.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.8    5e-09   
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                        62.8    5e-09   
ref|NP_187970.1|  feruloyl CoA ortho-hydroxylase 1                    62.8    5e-09   
ref|XP_009366301.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.8    6e-09   
dbj|BAJ90183.1|  predicted protein                                    62.8    6e-09   
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                   62.8    6e-09   
gb|AFD54197.1|  gibberellin 2-beta-dioxygenase 2                      62.4    6e-09   
gb|KEH31625.1|  2-oxoglutarate-dependent dioxygenase                  61.6    6e-09   
ref|XP_010111880.1|  hypothetical protein L484_001092                 60.8    6e-09   
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  62.4    6e-09   
emb|CAA54557.1|  dioxygenase                                          62.4    6e-09   
dbj|BAB17075.1|  GA 3beta-hydroxylase                                 62.4    6e-09   
dbj|BAB62072.1|  GA 3beta-hydroxylase                                 62.4    6e-09   
gb|ACF74295.1|  gibberellin 2-oxidase                                 60.5    6e-09   
gb|KDP34560.1|  hypothetical protein JCGZ_11110                       62.4    7e-09   
gb|AHW42463.1|  GA3ox1                                                62.4    7e-09   
ref|XP_006340352.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  62.4    7e-09   
ref|XP_010692467.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.4    7e-09   
gb|ADV77969.1|  putative oxoglutarate dependent dioxygenase           62.4    7e-09   
ref|XP_010655663.1|  PREDICTED: gibberellin 2-beta-dioxygenase is...  61.6    7e-09   
ref|XP_008222547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.4    7e-09   
ref|XP_007016073.1|  20G-Fe(II) oxidoreductase, putative              62.0    7e-09   
dbj|BAD99507.1|  gibberellin 2-oxidase                                62.0    7e-09   
ref|XP_011090260.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  62.4    8e-09   
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  62.4    8e-09   
gb|ADV77968.1|  putative dioxoglutarate dependent dioxygenase         62.4    8e-09   
ref|XP_009111110.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  62.0    8e-09   
emb|CDY60812.1|  BnaA01g37310D                                        62.0    8e-09   
ref|XP_006361842.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  60.1    9e-09   
gb|KHN00303.1|  1-aminocyclopropane-1-carboxylate oxidase like 1      61.6    9e-09   
ref|XP_008384049.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...  61.6    9e-09   
ref|XP_002269217.1|  PREDICTED: gibberellin 2-beta-dioxygenase is...  62.0    9e-09   
ref|XP_006355251.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...  62.0    1e-08   
gb|EPS64517.1|  gibberellin 2-oxidase                                 61.2    1e-08   
ref|XP_010655662.1|  PREDICTED: gibberellin 2-beta-dioxygenase is...  62.0    1e-08   



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            +D I P+DF+ A QLPD+HTW+D+  P+ SS   E++P+IDL DPQAV+++K A ETWG 
Sbjct  5    IDNIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  64

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NHG+P   LA+ EHQ RRFFEL  EQKLRA
Sbjct  65   FQVTNHGVPWSLLAQIEHQARRFFELAPEQKLRA  98



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGF  107
            I PLDF++   LPD+HTW   P  S+ P       ++PVIDL DP AV  ++ A E WG 
Sbjct  21   IVPLDFNSVPTLPDSHTWT--PCTSADPSFTGDDHSVPVIDLFDPNAVSLIRQACERWGA  78

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NHG+P + L E E Q RRFF LPAE+KLR 
Sbjct  79   FQVTNHGVPYDHLKEVESQSRRFFALPAERKLRV  112



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            ++ ITPLDF N  +LPD+H W    + P +    QE++P+IDLNDP A   ++ A E WG
Sbjct  3    LNQITPLDFKNVAKLPDSHRWTLSSENPSQDPLTQESVPIIDLNDPHAPSLIREANENWG  62

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             FQL NHG+P+  + E + Q +R F LPA+QKL A
Sbjct  63   MFQLTNHGVPITLMQEIQSQTQRLFALPADQKLLA  97



>gb|KDO80407.1| hypothetical protein CISIN_1g036755mg, partial [Citrus sinensis]
Length=159

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI--DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            I PLDF  A +LPD+H W   D P+        +PVIDL  PQA   ++ A E WG FQ+
Sbjct  18   IIPLDFKTALKLPDSHAWTLPDHPMADPLTHAAVPVIDLGSPQAATLIRQACEKWGAFQV  77

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP++ L + E Q RR F LPA QKL A
Sbjct  78   TNHGIPIKLLNQVEFQTRRLFALPANQKLLA  108



>ref|XP_006451039.1| hypothetical protein CICLE_v10010488mg [Citrus clementina]
 gb|ESR64279.1| hypothetical protein CICLE_v10010488mg [Citrus clementina]
Length=164

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI--DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            I PLDF  A +LPD+H W   D P+        +PVIDL  PQA   ++ A E WG FQ+
Sbjct  18   IIPLDFKTALKLPDSHAWTLPDHPMADPLTHAAVPVIDLGSPQAATLIRQACEKWGAFQV  77

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP++ L + E Q RR F LPA QKL A
Sbjct  78   TNHGIPIKLLNQVEFQTRRLFALPANQKLLA  108



>ref|XP_007013765.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
 gb|EOY31384.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
Length=342

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            I PLDF +   +PD+H W      SS  Q +IP+IDL DP AV+    A ETWG FQ+IN
Sbjct  18   IVPLDFHSVRTVPDSHVWPKSDDFSSDDQLSIPIIDLKDPLAVKLAGHACETWGAFQVIN  77

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP   + E E + RR F LPA+QK++A
Sbjct  78   HGIPSNLVEEVESEARRLFSLPAQQKMKA  106



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI--DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            I PLDF  A +LPD+H W   D P+        +PVIDL  PQA   ++ A E WG FQ+
Sbjct  18   IIPLDFKTALKLPDSHAWTLPDHPMADPLTHAAVPVIDLGGPQAATLIRQACEKWGAFQV  77

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP++ L + E Q RR F LPA QKL A
Sbjct  78   TNHGIPIKLLNQVEFQTRRLFALPANQKLLA  108



>ref|XP_004291424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWID-EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            + PLDF +A  LPD++ W + + + S   Q++IPVIDL DP A + +  A ETWG FQLI
Sbjct  12   VIPLDFTSAKTLPDSYVWPESDDLYSGTDQQSIPVIDLMDPNATQLIIQACETWGVFQLI  71

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            NHGIP + + + E Q  R F LPAEQKL+
Sbjct  72   NHGIPQKLVEDVESQTHRLFALPAEQKLK  100



>ref|XP_002324270.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEF02835.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=341

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            I PLDFD+   +PD+H W       S  Q +IP +DL DP AV+ +  A ETWG FQ+IN
Sbjct  18   IIPLDFDSVRTVPDSHVWPTSHAFESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQVIN  77

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP++ + E E + RR F LP   KL+A
Sbjct  78   HGIPLDIIDEVESEARRLFSLPTGHKLKA  106



>ref|XP_011026517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=341

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            I PLDFD+   +PD+H W       S  Q +IP +DL DP AV+ +  A ETWG FQ+IN
Sbjct  18   IIPLDFDSVRTVPDSHVWPTSHAFESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQVIN  77

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP++ + E E + RR F LP   KL+A
Sbjct  78   HGIPLDVIDEVESEARRLFSLPTGHKLKA  106



>ref|XP_004498636.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=361

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (60%), Gaps = 10/99 (10%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW----------IDEPIKSSPPQETIPVIDLNDPQAVEQMKTAL  122
            I PLDF +   LPD+H W          +   I     +  IP+IDLNDP A+EQ+  A 
Sbjct  19   IIPLDFSSFRTLPDSHAWPQSNDDCNDHLTSNINGCFDESCIPIIDLNDPNAMEQIGLAC  78

Query  121  ETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            E WG FQL NHGIP+  + E E + +RFF LP+++K++A
Sbjct  79   EKWGAFQLRNHGIPLNLIEEVEEEAKRFFSLPSKEKVKA  117



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 9/93 (10%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQ----ETIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDF++   LPD+HTW      SSP      E +P+IDL+DP A   ++ A E WG F
Sbjct  14   IIPLDFNSVDTLPDSHTW-----DSSPDHHLFTEFVPIIDLHDPNAATLIRLASEQWGVF  68

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NHG+P+  + EAE Q R  FELP +QKLRA
Sbjct  69   QVTNHGVPMNLVQEAEVQARGLFELPRDQKLRA  101



>gb|AFK49394.1| unknown [Lotus japonicus]
Length=362

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 7/96 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI-------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETW  113
            I PLDF +A  LP++H W        D+ + +S    +IP+IDL DP A+E +  A E W
Sbjct  24   IIPLDFSSAPNLPESHAWSLSKDDHDDDYLSNSNGSPSIPIIDLMDPNAMELIGHACENW  83

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQL NHGIP+  + E E++ +R F LPA+ KL+A
Sbjct  84   GAFQLKNHGIPLSIIQEVENEAKRLFALPADHKLKA  119



>gb|KDP32294.1| hypothetical protein JCGZ_13219 [Jatropha curcas]
Length=350

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE--TIPVIDLNDPQAVEQMKTALETWGFFQL  98
            I PLDFD+   +PD+H W +     S      +IP IDLNDP   + +  A ETWG FQL
Sbjct  18   IIPLDFDSVRAVPDSHVWPESGELESNDHHWLSIPTIDLNDPDRAKLIGHACETWGVFQL  77

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NH IP+  L E E +I+R F LPA QKL+A
Sbjct  78   TNHNIPLNLLNEVEFEIKRLFSLPARQKLKA  108



>ref|XP_002515599.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47048.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=345

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEP-IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            I PLDFD+   LP++H W +    + +  Q +IP IDLNDP A   +  A ETWG FQ+I
Sbjct  18   IIPLDFDSIRTLPESHVWPESGEFEFNDGQLSIPTIDLNDPDAGNLIGHACETWGVFQVI  77

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +H IP+  L E E + RR F LPA QKL+A
Sbjct  78   HHNIPLNLLHEVESETRRLFSLPARQKLKA  107



>gb|ABI64150.1| gibberellin 3-oxidase [Pisum sativum]
Length=349

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I PLDF +   LPD+H W    D+    +     IP+IDLNDP A+EQ+  A E WG FQ
Sbjct  19   IIPLDFSSFRTLPDSHAWPQSKDDNDHLTSNGSCIPIIDLNDPNAMEQIGLACEKWGAFQ  78

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            L NHG+P+  + E E + ++ F LP+++K++A
Sbjct  79   LKNHGVPLNLIEEVEEEAKKLFSLPSKEKIKA  110



>ref|XP_006427125.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|ESR40365.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|KDO58202.1| hypothetical protein CISIN_1g036286mg [Citrus sinensis]
Length=352

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LDF +  +LPD++ W    + PI  S   E++PVIDLNDP A+  +  A +TWG FQ+IN
Sbjct  21   LDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVIN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP   L   E   R  F LP +QKL+A
Sbjct  81   HGIPTNLLDNTESTSRSLFSLPTQQKLKA  109



>gb|KCW53766.1| hypothetical protein EUGRSUZ_J03019 [Eucalyptus grandis]
Length=349

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LDF +A +LPD++ W +    P    P +E++P+IDLNDP A++ +  A ++WG +Q+ N
Sbjct  21   LDFSSAEELPDSYAWTELGEYPSSHCPSKESLPIIDLNDPNALKLIGHACKSWGVYQVTN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRAK  2
            HGIP E L + E   +  F LP +QKL+A 
Sbjct  81   HGIPEELLHDVERAAKNLFSLPVQQKLKAS  110



>ref|XP_003588693.1| Gibberellin 3-beta-dioxygenase [Medicago truncatula]
 gb|AES58944.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=359

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 13/102 (13%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSP-------------PQETIPVIDLNDPQAVEQMK  131
            I PLDF +   LPD+H W       S                  IP+IDLNDP A+EQ+ 
Sbjct  19   IIPLDFSSFRTLPDSHAWPQSNDDGSDNFTSNGCYDNDDEDGSCIPIIDLNDPNAMEQIG  78

Query  130  TALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             A E WG FQL NHGIP+ F+ E E + +R F LP+++KL+A
Sbjct  79   LACEKWGAFQLKNHGIPLNFIEEVEEEAKRLFSLPSKEKLKA  120



>ref|XP_007137070.1| hypothetical protein PHAVU_009G097200g [Phaseolus vulgaris]
 gb|ESW09064.1| hypothetical protein PHAVU_009G097200g [Phaseolus vulgaris]
Length=344

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 4/93 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIK-SSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDF +   LPD+H W   IDE +  + P   +IPVIDL DP A + +  A E WG F
Sbjct  18   IIPLDFSSHPSLPDSHAWSQPIDENLSFNDPASSSIPVIDLMDPNATKLIGLACENWGAF  77

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             L NHGIP+      E +++R F LP EQKL+A
Sbjct  78   HLKNHGIPLGVTQGVEEEVQRLFSLPTEQKLKA  110



>ref|XP_006338004.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW--IDEPIKSSPPQE-TIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF +  ++P++H W  I+  + S   +   +P+IDL  P  VE M  A +TWG FQ
Sbjct  20   ILPIDFQSIQEVPNSHLWPKINNVLTSHNDKNPNVPIIDLLAPNVVELMGHACKTWGIFQ  79

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHG+ +E   E E+Q RRFF LPAEQK++ 
Sbjct  80   VVNHGVSLELFDEVEYQARRFFALPAEQKVKV  111



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            + PLDF +   LP++HTW        P  E++PVIDL+DP A   ++ A E WG FQ+ N
Sbjct  11   LIPLDFKSLVTLPNSHTWAPSSSDHHPFPESVPVIDLSDPNATPLVRLACEKWGVFQVTN  70

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P+  + + + Q  R F LP +QKLR 
Sbjct  71   HGVPMNLIKQTQLQTHRLFALPRDQKLRV  99



>ref|NP_001274405.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28483.1| GA 3-oxidase [Cucumis sativus]
Length=353

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKS--------SPPQETIPVIDLNDPQAVEQMKTALET  116
            I PLDFD+   +PD+H W +  +++        +    +IP+IDL DP A+  +  A ET
Sbjct  19   IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  78

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQLINH +PV  +  AE + RR F+LP  +KL+A
Sbjct  79   WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKA  115



>ref|XP_002284981.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI36204.3| unnamed protein product [Vitis vinifera]
Length=359

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++  +LPD+H W    + P   S   E++PVIDL+DP A+  +  A ++WG FQ+IN
Sbjct  21   LDLNSIQELPDSHAWASLGEHPCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVIN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L   E   R  F LPAEQKL+A
Sbjct  81   HGIPISLLEAIEDASRNLFALPAEQKLKA  109



>gb|KGN62899.1| hypothetical protein Csa_2G379300 [Cucumis sativus]
Length=372

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKS--------SPPQETIPVIDLNDPQAVEQMKTALET  116
            I PLDFD+   +PD+H W +  +++        +    +IP+IDL DP A+  +  A ET
Sbjct  38   IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  97

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQLINH +PV  +  AE + RR F+LP  +KL+A
Sbjct  98   WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKA  134



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            + PLDF +   LP++HTW        P  +++PVIDL+DP A   ++ A E WG FQ+ N
Sbjct  10   LIPLDFKSLVSLPNSHTWAPSSSDHHPFPDSVPVIDLSDPNATPLVRRACEKWGVFQVTN  69

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P+  + + + Q  R F LP +QKLR 
Sbjct  70   HGVPMNLIKQTQLQTHRLFALPRDQKLRV  98



>gb|AGQ42612.1| GA3ox3 [Vitis vinifera]
Length=359

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++  +LPD+H W    + P   S   E++PVIDL+DP A+  +  A ++WG FQ+IN
Sbjct  21   LDLNSIQELPDSHAWASLGEHPCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVIN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L   E   R  F LPAEQKL+A
Sbjct  81   HGIPISILEAIEDASRNLFALPAEQKLKA  109



>ref|XP_007013295.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
 gb|EOY30914.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
Length=355

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWI--DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            PLDF N  +LPD+H W    +PI     QE +P+IDL  P   + ++ A E WG FQ+ N
Sbjct  25   PLDFTNVPKLPDSHAWTLPHQPIDPFT-QEPLPIIDLAKPDVSKLVRHACEEWGAFQITN  83

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L E E+Q RR F LPAE KL A
Sbjct  84   HGIPICLLNEIEYQTRRLFSLPAESKLLA  112



>ref|XP_003527798.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN16493.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=347

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 9/98 (9%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI------DEPIK---SSPPQETIPVIDLNDPQAVEQMKTALE  119
            I PLDF +A  LPD+H W       D+ +     +     IP+IDL DP A+EQ+  A E
Sbjct  19   IIPLDFSSAHSLPDSHAWSHSQPNDDDYVSFNDDASSSSFIPIIDLMDPNAMEQIGHACE  78

Query  118  TWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             WG FQL NHGIP   + + E + +R F LP EQKL+A
Sbjct  79   KWGAFQLKNHGIPFCVIEDVEEEAKRLFALPTEQKLKA  116



>ref|XP_004229097.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=348

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF +  ++P++H W    + P   +     +P+IDL DP  VE M  A +TWG FQ
Sbjct  20   ILPIDFQSIQEVPNSHLWPNINNVPTSHNDKNPNVPIIDLIDPNVVELMGHACKTWGIFQ  79

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHGI +++  E E Q RR F LP EQK++ 
Sbjct  80   VVNHGISLKYFDEVESQARRLFALPTEQKVKV  111



>ref|XP_006450547.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
 gb|ESR63787.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
Length=342

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 13/95 (14%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW------IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            I P+DF++   LP++H W       D  I       ++PVIDL DP+  + +  A E WG
Sbjct  21   IIPIDFNSVCSLPESHKWPKSDDLYDNKI-------SVPVIDLRDPRVAQLIGRACEKWG  73

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             FQLI HGIP+  L +AE + RR F LP+ QKL+A
Sbjct  74   VFQLIYHGIPLNLLKDAESEARRLFSLPSRQKLKA  108



>ref|XP_010254241.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=370

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            LD ++  ++PD+H W  +D+   + SS   E++PVIDL+DP AV+ +  A +TWG FQ+ 
Sbjct  21   LDLESVREVPDSHAWPQLDDYPSVHSSFDVESVPVIDLSDPNAVKLVGHACKTWGVFQVT  80

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NHGIP+  L + E   RR F LP +QKL+A
Sbjct  81   NHGIPMRLLEDVESHGRRLFALPPQQKLKA  110



>emb|CAN73736.1| hypothetical protein VITISV_025221 [Vitis vinifera]
Length=416

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++  +LPD+H W    + P   S   E++PVIDL+DP A+  +  A ++WG FQ+IN
Sbjct  78   LDLNSIQELPDSHAWASLGEHPCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVIN  137

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L   E   R  F LPAEQKL+A
Sbjct  138  HGIPISILEAIEDASRNLFALPAEQKLKA  166



>ref|XP_006476223.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
 gb|KDO79608.1| hypothetical protein CISIN_1g043251mg [Citrus sinensis]
Length=342

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW--IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            I P+DF++   LP++H W   D+   +   + ++PVIDL DP+  + +  A E WG FQL
Sbjct  21   IIPIDFNSVCSLPESHKWPKFDDLYDN---KISVPVIDLRDPRVAQLIGRACEKWGVFQL  77

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            I HGIP+  L +AE + RR F LP+ QKL+A
Sbjct  78   IYHGIPLNVLKDAESEARRLFSLPSRQKLKA  108



>ref|XP_004253252.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF +  ++P++H W    + PI     + TIP+IDL  P  VE +  A +TWG FQ
Sbjct  21   ILPIDFHSIQEVPNSHLWPNINNSPISHDEKKPTIPIIDLLAPNVVELIGHACKTWGIFQ  80

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHGI +E   E E Q RR F LPA++K++ 
Sbjct  81   VVNHGISLELFDEVESQARRLFALPAKEKVKV  112



>ref|XP_006366661.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF +  ++P++H W D    PI        +P+IDL  P  VE +  A +TWG FQ
Sbjct  21   ILPIDFHSIQEVPNSHLWPDINNSPISHDEKNPNVPMIDLLAPNVVELIGHACKTWGIFQ  80

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHG+ +E   E E Q RR F LPAEQK++ 
Sbjct  81   VVNHGVSLELFDEVESQARRLFALPAEQKVKV  112



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDEPIKSSPPQETI--PVIDLNDPQAVEQMKTALETWGFFQLIN  92
            PLD+ +   LPD+H W+DE  +S     T   PVIDL DP A   +  A ETWG FQLI 
Sbjct  19   PLDYGSVHTLPDSHVWLDESDESPSGVHTTGPPVIDLADPDAARLIIQACETWGVFQLIG  78

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP + + + + +  + F+LP +QK++A
Sbjct  79   HGIPTKLMEDVQSEAEKLFDLPVDQKMKA  107



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 18/107 (17%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW-----IDEPI-------KSSP-PQET-----IPVIDLNDPQA  146
            I PLDF++   LPD+H W     ++ P+       KS+P P  T     +PVIDL +  A
Sbjct  21   IIPLDFESVHALPDSHIWTHTKEVEVPVSKSICNMKSNPTPYNTPSLVCVPVIDLFNSNA  80

Query  145  VEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
               ++ A E WG FQ+ NHGIP++ + EAE Q RR F LP +QKLRA
Sbjct  81   ASLVRRACEKWGVFQVTNHGIPMQLMKEAEFQTRRLFALPRDQKLRA  127



>ref|XP_006355748.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF    ++P++H W    + PI        +P+IDL  P  VE +  A  T G FQ
Sbjct  20   ILPIDFHLIQEVPNSHLWPNINNSPINHDEKNPNVPIIDLLAPNVVELIGHACRTLGIFQ  79

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHG+P+EF  EAE Q RR F LPAEQK++ 
Sbjct  80   VVNHGVPLEFFDEAESQARRLFALPAEQKVKV  111



>ref|XP_006382066.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|ERP59863.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=342

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE---TIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I PLDFD+   LPD+H W  +P   +   E   +IP +DL DP A + +  A E WG FQ
Sbjct  18   IIPLDFDSVRTLPDSHVW--QPTSHASESEDRLSIPTVDLKDPDAGKLIGHACEAWGAFQ  75

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NH IP++   E E + RR F LP  QKL+A
Sbjct  76   VTNHDIPLDLFHEVESEARRLFSLPTGQKLKA  107



>ref|XP_009117822.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Brassica rapa]
 emb|CDY68965.1| BnaA09g57140D [Brassica napus]
Length=358

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+ ++PP      E+IP+IDLN P A  Q+  A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTSKDDPLFTAPPSPPDAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F+LP ++KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFQLPVQRKLKA  114



>emb|CDX81720.1| BnaC08g38810D [Brassica napus]
Length=358

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+ ++PP      E+IP+IDLN P A  Q+  A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTSKDDPLFTAPPSPPGAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L + E      F+LP + KL A
Sbjct  83   IANHGVPLELLQDIEFLTGSLFQLPVQHKLEA  114



>dbj|BAG32267.1| gibberellin 3-oxidase [Allium fistulosum]
Length=365

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW-IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGI  83
            D  +A ++PD+HTW   +P   + P E+IPVIDL+ P  +  +  A E+WG FQ+I+HG+
Sbjct  23   DLGSAHEVPDSHTWPTIQPNPPNGPNESIPVIDLSSPDVISLIGHACESWGVFQVISHGV  82

Query  82   PVEFLAEAEHQIRRFFELPAEQKLRA  5
             +  L   E Q RR F LP +QKL+A
Sbjct  83   DLNLLHNLESQARRLFSLPTQQKLKA  108



>ref|XP_011082243.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=164

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI--DE-----PIKSSPPQETIPVIDLNDPQAVEQMKTALETW  113
            I PLDFD   +LPD+H W   DE      I+ +    TIPVIDL  P  VE M  A   W
Sbjct  19   IIPLDFDTIHELPDSHAWTQTDEFSCAYQIRVNELSTTIPVIDLRAPNVVELMGNACRRW  78

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQ+ NH +P   + +     RR F LPAE KL+A
Sbjct  79   GMFQVTNHDVPSSLVDDVVEHTRRLFALPAEWKLKA  114



>ref|XP_003544624.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=347

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I PLDF +   +PD+H W    D    +      IP+IDL DP A+E +  A E WG FQ
Sbjct  19   IIPLDFSSLRTIPDSHAWPQSEDGDDDNHGAGSCIPIIDLMDPSAMELIGLACENWGAFQ  78

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            L NHGIP+      E + +R F LPA+QKL+A
Sbjct  79   LTNHGIPLSVAEGVEEEAKRLFALPADQKLKA  110



>ref|XP_007221040.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
 gb|EMJ22239.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
Length=356

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 0/99 (0%)
 Frame = -1

Query  301  STMTGEVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTAL  122
            ++ T +V+ G  P DF +  ++P+ + W +     S   +++P+IDLNDP A + +  A 
Sbjct  12   NSKTFDVILGKVPDDFKSLHEIPEEYAWTNLNEHPSLDSDSVPIIDLNDPNASQLISHAC  71

Query  121  ETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             TWG FQLINHG+P   + + E   +  F LPAEQKL+A
Sbjct  72   TTWGVFQLINHGVPNNVVEDMESVAQSLFSLPAEQKLKA  110



>ref|XP_010112080.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC32577.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=404

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE----TIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDF +A  LP++H W      SS        ++PV+DL DP A E M  A ++WG F
Sbjct  18   IIPLDFWSARSLPESHVWTQPESFSSGEFSGEWFSLPVVDLTDPDAPELMGRACQSWGAF  77

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            QL  HGIPV+   E E + RR F LP EQKL+A
Sbjct  78   QLTGHGIPVKLKEEVEAEARRLFGLPTEQKLKA  110



>ref|XP_010249910.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=376

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQET----------IPVIDLNDPQAVEQMKTAL  122
            I PLDF +  +LPD+H W    +    P             IPVIDL D   V+ +  A 
Sbjct  21   IIPLDFSSVRELPDSHAWTSSLLLDDKPHGRRGSVIGVGGPIPVIDLADANVVKLVGRAC  80

Query  121  ETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ETWG FQ+ NHG P+  L   E +  R F LPAEQKL+A
Sbjct  81   ETWGVFQITNHGQPISLLEAVESESLRLFSLPAEQKLKA  119



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDEPIKSSPPQETI--PVIDLNDPQAVEQMKTALETWGFFQLIN  92
            PLD+ +   LPD+H W+DE  +S     +   PVIDL DP +   +  A ETWG FQLI 
Sbjct  19   PLDYGSVHTLPDSHVWLDESDESPSGVHSTGPPVIDLADPDSARLIIQACETWGVFQLIG  78

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP + + + + +  + F+LP +QK++A
Sbjct  79   HGIPTKLMEDVQSEAEKLFDLPVDQKMKA  107



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = -1

Query  286  EVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
             VV    P DF++  +LPD++ W       S   +++PV+DLNDP A++ +  A +TWG 
Sbjct  20   NVVLDQVPDDFNSLHELPDSYAWTTLNEHPSLDSDSVPVVDLNDPNALQLLGHACKTWGV  79

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQL NHGIP   + + E   R  F LPA+QKL+ 
Sbjct  80   FQLTNHGIPQTLVHDMESAARSLFSLPAQQKLKV  113



>dbj|BAJ65442.1| gibberellin 3-oxidase [Torenia fournieri]
 dbj|BAJ76663.1| gibberellin 3-oxidase [Torenia fournieri]
Length=382

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPI--KSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            LD  +  +LP+TH W    +  + +   E +P+IDLND  A+E +  A  TWG FQ+INH
Sbjct  28   LDLSSVKELPETHAWTSSKLDDEETCDAENVPIIDLNDENAIELIGRACRTWGVFQVINH  87

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             IP   L E E + ++ F LP +QKLRA
Sbjct  88   NIPKSLLDEIEFEGKKLFSLPMQQKLRA  115



>ref|XP_004290878.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWID-EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            + PLDF +   LPD+  W + +   S   Q  IPVI+L DP A + +  A ETWG FQLI
Sbjct  13   VIPLDFGSVKTLPDSFVWPESDDFYSGTDQPCIPVINLMDPNASQLIIQACETWGVFQLI  72

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
             HGIP + + + E Q  R F LPA+QKL+
Sbjct  73   GHGIPQKLVEDMESQTHRLFALPADQKLK  101



>ref|XP_003522638.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN08099.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=341

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI----DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDF +A  LPD+H W     ++   SS    +IP+IDL DP A++ +  A E WG F
Sbjct  18   IIPLDFSSALSLPDSHAWPHCQPNDDASSSSSSSSIPIIDLMDPNAMDLIGHACEKWGAF  77

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            QL NHGIP   + + E + +R F LP EQKL+A
Sbjct  78   QLKNHGIPFGVIEDVEEEAKRLFALPTEQKLKA  110



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  286  EVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
             VV    P DF++  +LPD++ W       S   +++PV+DLNDP +++ +  A +TWG 
Sbjct  20   NVVLDKVPDDFNSLHELPDSYAWTTLNEHPSLESDSVPVVDLNDPNSLQLLGHACKTWGV  79

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            FQL NHGIP   +   E   R  F LPA+QKL+
Sbjct  80   FQLTNHGIPQSLVHAMESAARSLFSLPAQQKLK  112



>ref|XP_008231797.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=356

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = -1

Query  292  TGEVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETW  113
            T +V+ G  P DF +  ++P+ + W +     S   +++P+IDLNDP A + +  A  TW
Sbjct  15   TFDVILGKVPDDFKSLHEIPEEYAWTNLNEHPSLDSDSVPIIDLNDPNASQLISHACRTW  74

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQLINHG+P   + + E   +  F LPAEQKL+ 
Sbjct  75   GVFQLINHGVPNNVVEDMESVAQSLFSLPAEQKLKV  110



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+  + P      E IP+IDLN P A  Q+ +A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F+LP ++KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFQLPVQRKLKA  114



>ref|XP_009148952.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Brassica rapa]
Length=359

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPI---KSSPP--QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+     SPP   E IP+IDLN P A  Q+ +A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F+LP ++KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFQLPVQRKLKA  114



>ref|XP_007137069.1| hypothetical protein PHAVU_009G097100g [Phaseolus vulgaris]
 gb|ESW09063.1| hypothetical protein PHAVU_009G097100g [Phaseolus vulgaris]
Length=343

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF ++  +PD+H+W    D  I S     ++PVIDL DP+A + +  A +  G FQ
Sbjct  18   IIPIDFSSSPAIPDSHSWSEPNDNHISSDDSASSVPVIDLLDPKAKDLISLACQNSGAFQ  77

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            L NHGIP+  +  AE +++  F LP EQK++A
Sbjct  78   LTNHGIPLGVIQAAEEEVQHLFSLPTEQKMKA  109



>ref|XP_011019738.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=342

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKS----SPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDFD+   LPD+H W   P  S    S  + +IP +DL DP A E +  A + WG F
Sbjct  18   IVPLDFDSVRTLPDSHVW---PPTSHAFESEDRLSIPSVDLKDPDAGELIGHACKAWGAF  74

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NH IP++   E E + RR F LP  QKL+A
Sbjct  75   QVTNHDIPLDLFHEVESEARRLFSLPTGQKLKA  107



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPI---KSSPP--QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+     SPP   E IP+IDLN P A  Q+ +A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F+LP ++KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFQLPVQRKLKA  114



>ref|XP_010254240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=352

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            +D ITP+DF++  ++P++  W    D P  +S   E +P IDL DP+A + M+ A E  G
Sbjct  16   LDHITPIDFESIKEVPESFIWPLLSDYPSCNSADIEPVPSIDLCDPKATKLMRRACERSG  75

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
             FQ+ NHGIP   L + E Q+ R F LP  QKL+
Sbjct  76   VFQITNHGIPTRLLHKLESQVWRLFSLPTGQKLK  109



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPI---KSSPP--QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+P+     SPP   E IP+IDLN P A  Q+ +A  TWG FQ
Sbjct  23   DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F+LP  +KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFQLPVHRKLKA  114



>ref|NP_001269085.1| uncharacterized protein LOC100265167 [Vitis vinifera]
 emb|CBI36201.3| unnamed protein product [Vitis vinifera]
 gb|AGQ42611.1| GA3ox1 [Vitis vinifera]
Length=365

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDE-PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++  +LPD + W  +DE P   S   E++PVIDL DP A E +  A ++WG FQ+ N
Sbjct  21   LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP   L + E   R  F LPA+QKL+A
Sbjct  81   HGIPGSLLDDIESAGRSLFSLPAQQKLKA  109



>dbj|BAB12439.1| gibberellin 3b-hydroxylase No3 [Lactuca sativa]
Length=345

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWID-----EPIKSSPPQET-IPVIDLNDPQAVEQMKTALETWG  110
            I PLDF++   +P++H W       + I+++ P+++ IPVIDL DP A++ +  A +TWG
Sbjct  18   IIPLDFESIDGVPESHLWSQSDESHQKIQTNNPRDSLIPVIDLYDPCAIDLIGQACKTWG  77

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             FQ+INHG+P+E + + E + RR F L   +K + 
Sbjct  78   MFQVINHGVPLELVKKVEFEARRLFSLTTHEKRKV  112



>emb|CAN80137.1| hypothetical protein VITISV_028510 [Vitis vinifera]
Length=365

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDE-PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++  +LPD + W  +DE P   S   E++PVIDL DP A E +  A ++WG FQ+ N
Sbjct  21   LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP   L + E   R  F LPA+QKL+A
Sbjct  81   HGIPGSLLDDIESAGRSLFSLPAQQKLKA  109



>ref|XP_007161254.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
 gb|ESW33248.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
Length=351

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---------IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALE  119
            I PLDF +   LPD+H W          D           IP+IDL DP A+E +  A E
Sbjct  19   IIPLDFSSLRTLPDSHAWPQTEDGHHHDDHDDDDHGGGSCIPIIDLMDPNAMELIGLACE  78

Query  118  TWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             WG FQL NHGIP+  + E E + ++ F LPA++KL+A
Sbjct  79   NWGAFQLKNHGIPLNVVEEVEKEAKKLFALPADRKLKA  116



>ref|XP_008445137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=369

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 11/100 (11%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEP-----------IKSSPPQETIPVIDLNDPQAVEQMKTA  125
            I PLDFD+   +PD+H W+                 +    +IP+IDL D  A+  +  A
Sbjct  34   IVPLDFDSLRTIPDSHDWLHSSPETPSSSSSSSCYHTNVDVSIPLIDLTDHDAIALIGNA  93

Query  124  LETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             ETWG FQLINH +P+  + +AE + RR F+LP  +KL+A
Sbjct  94   CETWGVFQLINHDVPMSLIEKAEGETRRLFDLPMTRKLKA  133



>gb|AGN95009.1| gibberellin 3-beta-dioxygenase, partial [Prunus salicina]
Length=331

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPP-----QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++ W   D+   SSP      Q+++PVIDL+DP A++    A  TWG FQ
Sbjct  1    DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  60

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGIP + L + E   R  F LP +QKL+A
Sbjct  61   VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKA  92



>dbj|BAD91162.1| gibberellin 3-beta hydroxylase [Prunus subhirtella]
Length=372

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPP-----QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++ W   D+   SSP      Q+++PVIDL+DP A++    A  TWG FQ
Sbjct  22   DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGIP + L + E   R  F LP +QKL+A
Sbjct  82   VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKA  113



>ref|XP_008228615.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Prunus mume]
Length=372

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPP-----QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++ W   D+   SSP      Q+++PVIDL+DP A++    A  TWG FQ
Sbjct  22   DFSSLQELPDSYAWSQNDDQYASSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGIP + L + E   R  F LP  QKL+A
Sbjct  82   VTNHGIPSKLLDDIESAGRSLFSLPVHQKLKA  113



>ref|XP_007215556.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
 gb|EMJ16755.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
Length=372

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPP-----QETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++ W   D+   SSP      Q+++PVIDL+DP A++    A  TWG FQ
Sbjct  22   DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGIP + L + E   R  F LP +QKL+A
Sbjct  82   VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKA  113



>gb|AEK70424.1| GA3ox2 [Gossypium hirsutum]
Length=368

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW--IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHG  86
            DF +  +LPD++ W   D+P   +   E++P++DLND  A++ +  A +TWG FQ+ NHG
Sbjct  21   DFTSLHELPDSYAWNQRDDPSPETFATESVPLVDLNDSNALQVIGHACKTWGIFQVTNHG  80

Query  85   IPVEFLAEAEHQIRRFFELPAEQKLRA  5
            I    L   EH  R  F LP  QKL+A
Sbjct  81   ISTSLLDMVEHTCRSLFSLPVHQKLKA  107



>ref|XP_006361220.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF +  ++P++H W    + PI        +P+IDL  P  VE +  A +TWG FQ
Sbjct  21   ILPIDFHSIQEVPNSHLWHNINNSPISHDEKNPNVPIIDLLAPNVVELIGHACKTWGIFQ  80

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            ++NHG+ +E   E E Q RR F L  EQK++ 
Sbjct  81   VVNHGVSLELFDEVEFQARRLFALQVEQKVKV  112



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTW--IDE-PIKSSPPQE--TIPVIDLNDPQAVEQMKTALET  116
            ++ I PLDF +   LP++H W   D  P  ++ P E  +IP+IDL DP A + +  A E 
Sbjct  16   LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQL +HG+P     + E Q RR F LPA +K++A
Sbjct  76   WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKA  112



>emb|CDX76441.1| BnaA08g09590D [Brassica napus]
Length=350

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            D I PLDF N   LPD+H W    ++  P    IPVI ++ P+ V  ++ A E WG F +
Sbjct  16   DRIIPLDFTNTKTLPDSHVWSKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVFHI  74

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +HG+P+  L   E Q++R F LP  +K+ A
Sbjct  75   TDHGVPLSLLHNVECQMKRLFSLPMHRKILA  105



>ref|XP_002282411.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI20992.3| unnamed protein product [Vitis vinifera]
Length=355

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTW--IDE-PIKSSPPQE--TIPVIDLNDPQAVEQMKTALET  116
            ++ I PLDF +   LP++H W   D  P  ++ P E  +IP+IDL DP A + +  A E 
Sbjct  16   LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQL +HG+P     + E Q RR F LPA +K++A
Sbjct  76   WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKA  112



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIK---SSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            + I PLDF +   LPD+H W   P     +S     IPVIDLN P A+  +K A E WG 
Sbjct  15   NNIFPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNSPNALILIKEASENWGM  74

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NH IP+      E Q R  F LP+ QKL A
Sbjct  75   FQVTNHDIPIHLFHHIEGQTRCLFGLPSSQKLLA  108



>ref|XP_009108486.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Brassica rapa]
Length=350

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            D I PLDF N   LPD+H W    ++  P    IPVI ++ P+ V  ++ A E WG F +
Sbjct  16   DRIIPLDFTNTKTLPDSHVWSKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVFHI  74

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +HG+P+  L   E Q++R F LP  +K+ A
Sbjct  75   TDHGVPLSLLHNVECQMKRLFSLPMHRKILA  105



>emb|CDY31424.1| BnaC03g64000D [Brassica napus]
Length=350

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            D I PLDF N   LPD+H W    ++  P    IPVI ++ P+ V  ++ A E WG F +
Sbjct  16   DRIIPLDFTNTKTLPDSHVWSKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVFHI  74

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +HG+P+  L   E Q++R F LP  +K+ A
Sbjct  75   TDHGVPLSLLHNVECQMKRLFSLPMHRKILA  105



>emb|CDP19027.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 11/100 (11%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW-------IDEPIKSSPPQET----IPVIDLNDPQAVEQMKTA  125
            + PLDF++   +P++H W       + + I  S   E     IPVIDL  P  VE +  A
Sbjct  18   VIPLDFESTKVVPESHIWPETENFPLSDHILPSDDNEKSKSWIPVIDLMAPNVVELIGHA  77

Query  124  LETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             ETWG FQL NHGIP   + + E Q RR F LP +QKL+ 
Sbjct  78   CETWGVFQLTNHGIPSSLIHDVEFQARRLFSLPTKQKLKV  117



>gb|AAF80661.1|AF074710_1 putative gibberellin 3 beta hydroxylase [Citrullus lanatus subsp. 
vulgaris]
Length=349

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE-----TIPVIDLNDPQAVEQMKTALETWGF  107
            + PLDF++   +P++H W +  I+ SP  +     ++P+ID  D  A E +  A E WG 
Sbjct  12   LVPLDFNSIQTVPESHLWPNS-IELSPAIKLDERISLPIIDFLDDGASELLGRACEQWGM  70

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQLINHG+P   + EAE + RR F LPA QK++ 
Sbjct  71   FQLINHGVPKTLIDEAEEETRRLFSLPARQKMKT  104



>ref|XP_004240225.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF    ++P++H W    + PI        +P+IDL  P  V+ +  A +TWG FQ
Sbjct  20   ILPIDFHLIQEVPNSHLWPNINNFPINHDEKNPNVPIIDLLAPNVVQLIGHACKTWGIFQ  79

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +INHGI ++F  E E Q RR F LP E+K++ 
Sbjct  80   VINHGISLDFFDEVESQARRLFALPVEEKVKV  111



>ref|XP_007024019.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
 gb|EOY26641.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
Length=371

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            DF +  +LPD + W    D P   +   E++P+IDL+DP A++ +  A +TWG FQ+INH
Sbjct  23   DFTSLQELPDLYAWNQRDDYPCGDAFAAESVPIIDLDDPNALQGIGHACKTWGVFQVINH  82

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            GIP   L   E   R  F LP  QKL+A
Sbjct  83   GIPPSLLDMVECTGRTLFSLPVHQKLKA  110



>gb|AEW67998.1| gibberellin 3 oxidase 1 [Castanea mollissima]
Length=368

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW--IDE-PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            DF++  +LPD++ W  +DE P   S   E++P+IDL DP A+  +  A +TWG FQ+ NH
Sbjct  22   DFNSLQELPDSYKWTQLDEYPSCESFSSESVPLIDLTDPNALTLVGHACKTWGVFQVTNH  81

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            GIP + L + E   R  F LP +QKL+A
Sbjct  82   GIPTKLLDDIESVSRCLFSLPQQQKLKA  109



>ref|XP_008785607.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=362

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
             DF++  ++PD+H W    D P       +++PV+DL+ P AV  +  A + WG FQ+  
Sbjct  22   FDFESIREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLDSPDAVLLVGRACQEWGVFQVTG  81

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP + L   E QIRR F LP  QKL+A
Sbjct  82   HGIPTDLLDRLESQIRRLFSLPTHQKLKA  110



>dbj|BAG48321.1| gibberellin 3-oxidase2 [Chrysanthemum x morifolium]
Length=358

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            +D  +  +LPD++ W  +D+    S   E +PVI+L+DP  ++ +  A +TWG F + NH
Sbjct  12   MDLSSMKELPDSYAWASVDDGCLLSCSSEPVPVINLDDPNVMKHVGHACKTWGVFYVTNH  71

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            GIP+  + + E  +R+ F LP +QKL+A
Sbjct  72   GIPMAVVDDMEASVRKLFYLPIQQKLKA  99



>ref|XP_010520599.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Tarenaya hassleriana]
Length=391

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            D I PLDF +   LPD+H W        P   +IPV+D+N       ++ A E WG FQ+
Sbjct  55   DHIIPLDFTSVKTLPDSHVWSAPSPLPEPEALSIPVLDMNHAVRPSLLRQACEEWGVFQV  114

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            INHG+  + L   E+Q RR F LP ++K+ A
Sbjct  115  INHGVSEKLLLNVEYQTRRLFSLPMQRKILA  145



>gb|ABN80396.1| gibberellin beta-hydroxylase [Lactuca sativa]
Length=157

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDE---PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD  +  +LP++H W+ +   P   S   E +PVI+L DP A++ +  A +TWG FQ+ N
Sbjct  20   LDLKSMKELPESHAWLSQDGSPSYGSSSSEQVPVINLKDPNAMKLVGHACKTWGVFQVTN  79

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P   L E E   R+ F LP +QKL+A
Sbjct  80   HGVPTNLLEEMEAAGRKLFALPIQQKLKA  108



>ref|XP_007227245.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
 gb|EMJ28444.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
Length=344

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDEP-----IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            PLD+ +   LP++H W+D+      +  S    + PVIDL DP A   +  A ETWG FQ
Sbjct  19   PLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVIDLMDPDAPRLIIQACETWGVFQ  78

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            LI HGIP + + + E +  + F LP +QKL+A
Sbjct  79   LIGHGIPTKLMEDVESEAEKLFGLPVDQKLKA  110



>gb|ACF71491.1| gibberellin 3-beta hydroxylase [Chrysanthemum x morifolium]
Length=358

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW--IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHG  86
            D  +  +LPD++ W  +D+    S   E +PVI+L DP  ++ +  A +TWG F + NHG
Sbjct  13   DLSSMKELPDSYAWSSVDDDCLLSCSSEPVPVINLEDPNVMKHVGHACKTWGVFHVTNHG  72

Query  85   IPVEFLAEAEHQIRRFFELPAEQKLRA  5
            IP+  L + E  +R+ F LP +QKL+A
Sbjct  73   IPMAVLDDMEASVRKLFYLPIQQKLKA  99



>gb|EYU21920.1| hypothetical protein MIMGU_mgv1a009050mg [Erythranthe guttata]
Length=354

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGF  107
            I PLDF     LP++HTW +     +          +P I+L  P A   +  A   WG 
Sbjct  20   IVPLDFAAVDDLPESHTWTNTHTTRAGGGGLHLPAAVPTINLRSPSAAALVGDACREWGM  79

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NHG+P   + + E   RR FELPAEQKL+A
Sbjct  80   FQVTNHGVPAGLVEDVEAHARRLFELPAEQKLKA  113



>gb|AHC32022.1| gibberellin 3-oxidase 1 [Camellia sinensis]
Length=361

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID-EPIKSSPPQETI-------PVIDLNDPQAVEQMKTALETWGF  107
            LDF++  +LP++H W   E   SS   ETI       PVIDLNDP A+E +  A  TWG 
Sbjct  21   LDFNSLEELPESHAWTSLEKYSSSDSVETITGTKESVPVIDLNDPNAMELVGHACRTWGV  80

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NHGI    L   E   +  F LP +QKL+A
Sbjct  81   FQVTNHGINTSVLNRVESAGKSLFSLPIQQKLKA  114



>gb|AAB64347.1| gibberellin 2beta,3beta-hydroxylase [Cucurbita maxima]
Length=346

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTW--IDEPIKSSPPQET--IPVIDLNDPQAVEQMKTALETW  113
            V  +TPLD +    +P++H W  +DE  +     +T  IPV+D ND   +E +  A E W
Sbjct  7    VGLLTPLDLNTVEAVPESHVWPHLDESSQKFKSDKTVSIPVVDFNDDNVLELIGKACEEW  66

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            G FQLINHGIP    AE E   R  F LP  QK++
Sbjct  67   GMFQLINHGIPKTLTAETEEVARCLFALPKSQKMK  101



>gb|AEK70423.1| GA3ox1 [Gossypium hirsutum]
Length=364

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = -1

Query  295  MTGEVVDGITPL--DFDNAGQLPDTHTW-----IDEPIKSSPPQETIPVIDLNDPQAVEQ  137
            M   + D I  L  DF +  +LP+++ W     ID P   S   E++P+IDLNDP A++ 
Sbjct  1    MPSRLSDAIIRLHPDFTSLQELPESYAWNQRDDIDYPSFDSS-AESVPIIDLNDPNALQN  59

Query  136  MKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +  A  TWG FQ+INHG+    L   E   R  F LP  QKL+A
Sbjct  60   IGHACRTWGVFQVINHGVSTTLLDMVESTSRTLFSLPVNQKLKA  103



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI----------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            DF++  +LP+++TW           +  +K S    ++PVIDLNDP A + +  A +TWG
Sbjct  21   DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +Q++NHGIP+  L E +   +  F LP+ QKL+A
Sbjct  81   VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKA  115



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI----------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            DF++  +LP+++TW           +  +K S    ++PVIDLNDP A + +  A +TWG
Sbjct  21   DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +Q++NHGIP+  L E +   +  F LP+ QKL+A
Sbjct  81   VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKA  115



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIK---SSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            + I PLDF +   LPD+H W   P     +S     IPVIDLN P  +  +K A E WG 
Sbjct  15   NNIVPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNGPNVLILIKEASENWGM  74

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+ NH IP+      E Q R  F LP+ QKL A
Sbjct  75   FQVTNHDIPIHLFHHIEGQTRCLFGLPSTQKLLA  108



>emb|CDP04846.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 11/100 (11%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW--------IDEPIKSSPPQET---IPVIDLNDPQAVEQMKTA  125
            + PLDF++   +P++H W         D  + S   +++   IPVIDL  P  VE +  A
Sbjct  18   VIPLDFESTKVVPESHIWPETENFPLSDHVLPSDDDEKSKSWIPVIDLMAPNVVELIGHA  77

Query  124  LETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             ETWG F L NHGIP   + + E Q R+ F LP +QKL+A
Sbjct  78   CETWGIFHLTNHGIPSSLIHDVESQARKLFSLPTKQKLKA  117



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQ--MKTALETWGFFQL  98
            LDF +  +LPD +TW +    P   S   E++PVIDL+ P AV    +  A +TWG FQ+
Sbjct  21   LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            INHGIP   L  A    R  F LP EQKL+ 
Sbjct  81   INHGIPTALLHNAMCTSRSLFTLPNEQKLKV  111



>gb|ADM47337.1| gibberellin 3-oxidase 1 [Marah macrocarpus]
Length=354

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 8/96 (8%)
 Frame = -1

Query  271  ITPLDFDNAGQ-LPDTHTWIDEPIKSSPPQE-----TIPVIDL-NDPQAVEQMKTALETW  113
            + PLDF ++ + +P++H W+D  I+ SP  +     ++PVIDL +D  A E +  A + W
Sbjct  15   LVPLDFSSSHETVPESHIWVDS-IELSPAMDLDEKLSLPVIDLLDDTTASELIGKACQQW  73

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQLINHG+P   +AE E + RR F LP  QK++ 
Sbjct  74   GMFQLINHGVPKSIIAETEDEARRLFALPTTQKMKT  109



>ref|XP_003597810.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 ref|XP_003597814.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 gb|AES68061.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=371

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW--IDEP--IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            DF++  +LP+++TW  +D+   IK       +PVIDLNDP A + +  A +TWG +Q++N
Sbjct  21   DFNSLQELPESYTWNHLDDHTLIKEGTTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L E +   +  F LP+ QKL+A
Sbjct  81   HGIPISLLDEIQWLGQTLFTLPSHQKLKA  109



>gb|KDO58203.1| hypothetical protein CISIN_1g043985mg [Citrus sinensis]
Length=350

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQ--MKTALETWGFFQL  98
            LDF +  +LPD +TW +    P   S   E++PVIDL+ P AV    +  A +TWG FQ+
Sbjct  21   LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            INHGIP   L  A    R  F LP EQKL+ 
Sbjct  81   INHGIPTALLHNAMCTSRSLFTLPNEQKLKV  111



>ref|XP_009355033.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=362

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDE-----PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            P DF +  +LP+ + W  +       +S    E++PVIDL DP  VE +  A +TWG FQ
Sbjct  22   PDDFSSLQELPEAYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGNACKTWGIFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
              NHG+P + + + E  +R  F LP +QKL+A
Sbjct  82   ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKA  113



>gb|ABG46320.1| gibberellin 3-oxidase 1 [Rumex palustris]
Length=368

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSP--PQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            LDF +  +LPD + W        P    + +P++DL  P A E + +A ++WG FQ+INH
Sbjct  23   LDFQSVEELPDAYEWGPLESHGGPVGADQGVPIVDLKGPNARELIGSACKSWGAFQVINH  82

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+P  FL E E   RR F LP  QKL+A
Sbjct  83   GVPQRFLEEVESAGRRLFSLPLHQKLKA  110



>gb|AAR12160.1| gibberellin 3-oxidase [Populus tremula x Populus tremuloides]
Length=373

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID-------EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            LDF +  ++PD+H W          P   S   E++PVIDL DP  ++ +  A +TWG  
Sbjct  22   LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  81

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NHGIP+  L   E   R  F LP +QKL+A
Sbjct  82   QVTNHGIPISLLESVEGVSRSLFSLPVQQKLKA  114



>ref|XP_002303276.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE78255.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=373

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID-------EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            LDF +  ++PD+H W          P   S   E++PVIDL DP  ++ +  A +TWG  
Sbjct  22   LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  81

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NHGIP+  L   E   R  F LP +QKL+A
Sbjct  82   QVTNHGIPISLLESVEGVSRSLFSLPVQQKLKA  114



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI----------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            DF++  +LP+++TW           +  +K S    ++P+IDLNDP A + +  A +TWG
Sbjct  21   DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPIIDLNDPNASKLIGHACKTWG  80

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +Q++NHGIP+  L E +   +  F LP+ QKL+A
Sbjct  81   VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKA  115



>ref|XP_011072274.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=378

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 10/96 (10%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDE----PIKS------SPPQETIPVIDLNDPQAVEQMKTALETW  113
            LD ++  +LPDTH W  +    P+ S      +   E +P+IDLN+  A E +  A ++W
Sbjct  22   LDLNSVKELPDTHAWTSQLDGYPLSSPGGCGGTCHSEMVPIIDLNNENATELIGHACKSW  81

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQ+INH IP+  L E E    + F LP  QKLRA
Sbjct  82   GVFQVINHNIPMNLLDEVELAGNKLFSLPMHQKLRA  117



>ref|XP_010061961.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW69008.1| hypothetical protein EUGRSUZ_F02568 [Eucalyptus grandis]
Length=370

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 6/92 (7%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI----DEPIKSSPPQE--TIPVIDLNDPQAVEQMKTALETWGFFQ  101
            LDF +  +LPD++TW     D P  +SP  +  T+PVIDL+ P A+E +  A +TWG FQ
Sbjct  21   LDFSSVKELPDSYTWTTQPEDYPCPNSPSGQEVTVPVIDLHHPNALELIGHACKTWGAFQ  80

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGIP   L   +   +  F LP  QK +A
Sbjct  81   VTNHGIPKRLLDSIQSAGKNLFSLPVHQKHKA  112



>gb|KHG10231.1| Gibberellin 3-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=364

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW-----IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            DF +  +LP+++ W     ID P   S   E++P+IDLNDP A++ +  A  TWG FQ+I
Sbjct  15   DFTSLQELPESYAWNQRDDIDYPSFDSS-AESVPIIDLNDPNALQSIGHACRTWGVFQVI  73

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NHG+    L   E   R  F LP  QKL+A
Sbjct  74   NHGVSTTLLDMVESTSRTLFSLPVNQKLKA  103



>ref|XP_002299619.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE84424.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=372

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDE---PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            +DF +  ++PD+H W  ID+   P+      E++PVIDL+DP  ++ +  A +TWG  Q+
Sbjct  23   IDFTSLQEIPDSHKWTQIDDEQHPLVDPLNTESVPVIDLSDPNVLQNIGHACKTWGVLQV  82

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP   L   E   R  F LP +QKL+A
Sbjct  83   TNHGIPTSLLENIESASRSLFSLPIQQKLKA  113



>ref|XP_010110310.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC25830.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=372

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPI-KSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            DF +  +LPD++ W    D P  +S    ++IPV+DLNDP A++ +  A +TWG FQ+ N
Sbjct  25   DFSSLQELPDSYAWNQPDDHPSDRSIFASKSIPVVDLNDPNALKLIGHACKTWGVFQVTN  84

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGI  E L + E   R  F LP +QKL+A
Sbjct  85   HGISTELLDDIESAGRSLFSLPLQQKLKA  113



>ref|XP_008356836.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDE-----PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            P DF +  +LP+++ W  +       +S    E++PVIDL DP  VE +  A +TWG FQ
Sbjct  22   PDDFSSLQELPESYAWTSQLNEYPSFESLSCSESVPVIDLADPNVVELVGHACKTWGMFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
              NHG+P + + + E  +R  F LP +QKL+A
Sbjct  82   ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKA  113



>ref|XP_008347459.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDE-----PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            P DF +  +LP ++ W  +       +S    E++PVIDL DP  VE +  A +TWG FQ
Sbjct  22   PDDFSSLXELPKSYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGHACKTWGMFQ  81

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
              NHG+P + + + E  +R  F LP +QKL+A
Sbjct  82   AXNHGVPQKLVDDMESTVRSLFSLPPQQKLKA  113



>ref|XP_010249916.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=378

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSPPQETI-----------PVIDLNDPQAVEQMKTALET  116
            LD ++  ++PD+H W +  +   P   T+           PVIDL DP AV+ +  A +T
Sbjct  22   LDLESVREVPDSHAWPE--LDDYPSAVTVEDSNFDVESVPPVIDLTDPNAVKLVGHACKT  79

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQ+ NHG+P+  L + E Q RR F LP  QKL+A
Sbjct  80   WGVFQVTNHGLPMRLLDDVESQGRRLFSLPPHQKLKA  116



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIP  80
            D  N   LP+++ W  +P  SS  +E+IPVIDL D   V ++  A ETWG FQ+ NHGIP
Sbjct  6    DLRNLKTLPESYKW--KPTTSSNDRESIPVIDLADSDVVTRIGNACETWGAFQIANHGIP  63

Query  79   VEFLAEAEHQIRRFFELPAEQKL  11
             + L + E      F LP EQKL
Sbjct  64   SKLLDDVESLSSSLFGLPTEQKL  86



>emb|CDP17660.1| unnamed protein product [Coffea canephora]
Length=253

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -1

Query  184  ETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQK  14
            ++IPVIDL   NDP   EQ+  A E WGFFQ++NHGIP+E L   +   RRFF LPAE+K
Sbjct  57   DSIPVIDLSNWNDPNVAEQICNAAEKWGFFQIVNHGIPIEVLENVKEATRRFFALPAEEK  116



>emb|CBL59327.1| Gibberellin 3-oxidase [Cucurbita maxima]
Length=350

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW----IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            I PLDFD+   +PD+H W     D     +    +IP+ID++DP     +    +TWG F
Sbjct  19   IVPLDFDSLRTVPDSHDWPHSSYDTLKLHTNGDVSIPLIDMSDPNVAMLIGNVCKTWGVF  78

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            QL NHG+P   +  AE +  R F+LP  +KL+A
Sbjct  79   QLTNHGVPTSLVERAEAEAGRLFDLPMTRKLKA  111



>ref|XP_011045367.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=372

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDE---PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            +DF +  ++PD+H W  ID+   P+      E++PVIDL+DP  ++ +  A +TWG  Q+
Sbjct  23   IDFTSLQEIPDSHKWTQIDDEQRPLVDPLITESVPVIDLSDPNVLQNIGHACKTWGVVQV  82

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP   L   E   R  F LP +QKL+A
Sbjct  83   TNHGIPTSLLENIESASRSLFSLPIQQKLKA  113



>dbj|BAA37129.1| gibberelin 3beta-hydroxylase [Lactuca sativa]
Length=363

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDE---PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD  +  +LP++H W+ +   P   S   E +PVI+L DP A++ +  A +TWG FQ+ N
Sbjct  20   LDLKSMKELPESHAWLSQDGSPSYGSSSSEQVPVINLKDPNAMKLVGHACKTWGVFQVTN  79

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P   L E E   R+ F LP +QKL+A
Sbjct  80   HGVPTNLLEEMEAAGRKLFALPIQQKLKA  108



>ref|XP_010914990.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=360

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
             +F++  ++PD+H W D    P       +++PV+DL  P AV ++  A E WG FQ+  
Sbjct  20   FEFESVREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDAVPRVGRACEEWGVFQVTG  79

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P + L   E Q RR F LP  QKL+A
Sbjct  80   HGVPSDLLDRLESQTRRLFSLPTHQKLKA  108



>ref|XP_004291422.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=353

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 7/95 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDE------PIKSSP-PQETIPVIDLNDPQAVEQMKTALETW  113
            I PLDF +   +P++H W +       P  S+  P  ++P+IDL DP A   +  A E W
Sbjct  13   IVPLDFASVQTVPESHVWSESDDEYRCPSGSTADPCLSVPIIDLWDPNATHLIFEACEKW  72

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            G FQL  HGIP + + E E + +R F LP +QKL+
Sbjct  73   GVFQLTGHGIPAKLIEEVEDKTQRLFSLPVDQKLK  107



>gb|KFK43811.1| hypothetical protein AALP_AA1G176200 [Arabis alpina]
Length=358

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+ + ++ P      E IP+IDLN+P A  Q+  A  TWG FQ
Sbjct  23   DFTSLRELPDSYTWTPKDDLLFAAAPSPRATGENIPLIDLNNPDAASQIGHACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F LP ++KL+A
Sbjct  83   IANHGVPLELLEGIEFLTGSLFRLPVQRKLKA  114



>gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Erythranthe guttata]
Length=380

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 8/94 (9%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI----DEPIKSSP----PQETIPVIDLNDPQAVEQMKTALETWGF  107
            LD  +  +LP++H W     D P           ET+P++DLN   A E +  A +TWG 
Sbjct  22   LDLSSVKELPESHAWTSQNNDYPFSGGGAADGSSETVPIVDLNSGNATELIGHACKTWGV  81

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ++NHGIP   L E E      F LP  QKLRA
Sbjct  82   FQVVNHGIPNNLLEEIEAAGSSLFSLPMHQKLRA  115



>ref|XP_006416894.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
 gb|ESQ35247.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
Length=361

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD++TW   D+ + ++ P      E IP+IDLN P A  Q+  A  TWG FQ
Sbjct  23   DFTSLRELPDSYTWTLKDDLLFAAAPSPPATGENIPLIDLNHPDAANQIGCACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+E L   E      F LP ++KL+A
Sbjct  83   IANHGVPLELLQGIEFLTGSLFRLPVQRKLKA  114



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDE----PIKSSP--PQETIPVIDLNDPQAVEQMKTALETWGFF  104
            P DF++  +LPD++ W ++    P   SP      +PVIDLND   ++ +  A +TWG F
Sbjct  18   PADFNSLHELPDSYAWTNQLDEFPSLDSPFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NHG+P + + + E   R  F LP +QKL+A
Sbjct  78   QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKA  110



>ref|XP_008377587.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Malus domestica]
Length=371

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWID------EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            DF++  +LPD++ W +        + S    +++PVIDL++P A++    A +TWG FQ+
Sbjct  22   DFNSLHELPDSYAWTNNDDHYPSSLSSFGADDSVPVIDLSEPNAIKLTGHACKTWGVFQV  81

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP + L + E   +  F LP EQKL+A
Sbjct  82   TNHGIPQKLLDDIESAGKSLFSLPVEQKLKA  112



>gb|ADK70988.1| gibberellin 3-beta-hydroxylase [Medicago praecox]
Length=293

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I+   K S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLINSNNKESANSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  65

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  66   LGQTLFTLPSHQKLKA  81



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 59/101 (58%), Gaps = 7/101 (7%)
 Frame = -1

Query  298  TMTGEVVDGITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKT  128
            +++  ++D    L+F++  +LP++H W    D P  S P    +PVID+ DP+A E M  
Sbjct  3    SLSDVLLDQAHHLEFESVHELPESHAWPTLHDHPCVSEP----VPVIDMADPKAAEFMAR  58

Query  127  ALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            A  +WG FQ+  HG+    L   + ++RR F LP +QKL+A
Sbjct  59   ACVSWGAFQVTGHGVAPRLLESIDSEMRRLFALPTQQKLKA  99



>ref|XP_003550162.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=350

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW-----IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            I PLDF +   LPD+H W      D    +      IP+IDL DP A+E +  A E WG 
Sbjct  19   IIPLDFSSLRTLPDSHAWPQSEDGDGDDDNHGIGSPIPIIDLMDPNAMELIGLACENWGA  78

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQL NHGIP+  + E E + +R F LPA++KL+A
Sbjct  79   FQLKNHGIPLSVVEEVEEEAKRLFALPADRKLKA  112



>emb|CAH69705.1| gibberellin 3-oxidase [Phaseolus coccineus]
Length=340

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            I P+DF ++  +PD+H+W    D  I S  P    PVIDL DP+A + +  A +  G FQ
Sbjct  18   IIPIDFSSSPAIPDSHSWSEPNDNRISSDDPP---PVIDLLDPKAKDLISLACQNSGAFQ  74

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            L NHGIP+  +  AE ++   F LP EQK++A
Sbjct  75   LTNHGIPLGVIQAAEEEVEHLFSLPTEQKMKA  106



>ref|XP_004292966.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            +  + PLDF +A  +PD+  W    DE    S    TIPVIDL DP A + +  A +TWG
Sbjct  10   IKRLVPLDFGSAKSVPDSFVWPQASDE--VHSGDGLTIPVIDLTDPNAPQLITEACKTWG  67

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
              Q+  HGIP + L + E +  R F LP +QK++A
Sbjct  68   ILQVKGHGIPTKLLEDMESECERLFSLPTDQKMKA  102



>ref|XP_006285095.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
 gb|EOA17993.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
Length=353

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWID-EP-IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            D I PLDF +   LPD+H W   EP  K  P    IPVI+L+DP     ++ A E WG F
Sbjct  16   DRIIPLDFTSTKTLPDSHVWSKTEPETKPKPVNLPIPVINLSDPDQHVLLRQACEEWGVF  75

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             + +HG+P   L   E Q++R F LP  +K+ A
Sbjct  76   HITDHGVPGYLLHNVECQMKRLFSLPMHRKILA  108



>gb|KGN62900.1| hypothetical protein Csa_2G379310 [Cucumis sativus]
Length=156

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 4/92 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSP----PQETIPVIDLNDPQAVEQMKTALETWGFF  104
            + PLDF +   +P++H W +    S+      + ++P+IDL    A E +  A E WG F
Sbjct  12   LVPLDFTSVQTVPESHLWPNATELSAAIKLDKRVSLPLIDLVSDGASELLGRACEEWGMF  71

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            QLINHGI    + EAE + RR F LPA QK++
Sbjct  72   QLINHGISKTLIEEAEEETRRLFTLPATQKMK  103



>ref|XP_010449018.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=351

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            D I PLDF N   LP++H W     +  P    IPVI L++P     ++ A E WG F +
Sbjct  16   DRIIPLDFTNTKTLPNSHVWSKTEPEPKPMSLPIPVISLSNPDQHVLLRQACEEWGVFHI  75

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             +HG+P   L   E Q++R F LP  +K+ A
Sbjct  76   TDHGVPRSLLHNVECQMKRLFSLPMHRKILA  106



>dbj|BAD30035.1| gibberellin 3beta-hydroxylase1 [Daucus carota]
Length=344

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI----DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            LD ++  +LP++HTW     D     S   E++P+IDLNDP  +  ++ A ETWG  Q+ 
Sbjct  12   LDLNSIKELPESHTWTSLQDDCTDCLSNESESLPIIDLNDPDVLALVRHACETWGVLQVK  71

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRAK  2
            NHG+ +  L + E    + F LP EQKL+  
Sbjct  72   NHGVSLRLLEDMEAATTKLFSLPIEQKLKVS  102



>ref|XP_008804067.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=359

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
             +F++  ++PD+H W    D P       +++PV+DL  P AV  +  A E WG FQ+  
Sbjct  20   FEFESVREVPDSHAWPGLHDHPSVEPSGPDSVPVVDLASPDAVLLVGRACEEWGAFQVTG  79

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGI  + L   E+QIRR F LP  QKL+A
Sbjct  80   HGISSDLLDRLEYQIRRLFSLPTHQKLKA  108



>ref|XP_008219863.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=344

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 5/94 (5%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEP-----IKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            + PLD+ +   LP++H W+D+      +  S    + PVI+L DP A   +  A ETWG 
Sbjct  17   LIPLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVINLMDPDAPRLIIQACETWGV  76

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQL  HGIP + + + E +  + F LP +QKL+A
Sbjct  77   FQLTGHGIPTKLMEDVESEAEKLFGLPVDQKLKA  110



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = -1

Query  265  PLDFDNAGQLPDTHTWIDE-----PIKSSPPQE-TIPVIDLNDPQAVEQMKTALETWGFF  104
            P DF++  +LPD++ W ++      + SS   +  +PVIDLND   ++ +  A +TWG F
Sbjct  18   PADFNSLHELPDSYAWTNQLDECPSLDSSFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q+ NHG+P + + + E   R  F LP +QKL+A
Sbjct  78   QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKA  110



>ref|XP_004291423.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            I PLDF++   +PD+  W    +        IP+IDL D  A + +  A ETWG FQL N
Sbjct  12   IIPLDFNSVNSVPDSFVWSQSDVIQPDNGLFIPIIDLMDSNAPKLIVEACETWGVFQLKN  71

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+  + + + E + R+ F+LP +QKL+A
Sbjct  72   HGVRTKIMEDIESEARKLFDLPIDQKLKA  100



>ref|XP_006465424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
Length=350

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQ--MKTALETWGFFQL  98
            LDF +  +LPD +TW +    P   S   E++PVIDL+   AV    +  A +TWG FQ+
Sbjct  21   LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGLTAVNVNLIGHACKTWGVFQV  80

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            INHGIP   L       R FF LP EQKL+ 
Sbjct  81   INHGIPTALLHNVMCTSRSFFTLPTEQKLKV  111



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSP-----PQETIPVIDLNDPQAVEQMKTALETWGF  107
            LDF++  +LP+++TW    D  I +S         ++PVIDLNDP A + +  A +TWG 
Sbjct  20   LDFNSLQELPESYTWTHLDDHTIINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +Q++NHGIP+  L + +   +  F LP  QKL+A
Sbjct  80   YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKA  113



>ref|XP_009596383.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=363

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD     +LP++H W   +D   +S+   E+IPVIDLND + A+E++  A +TWG FQ+I
Sbjct  13   LDLYTIKELPESHAWRSSLDHDYQSNDSLESIPVIDLNDNKFAMEKIGHACKTWGAFQII  72

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L   E   +R F LP +QKL+A
Sbjct  73   NHNISQSLLDNMEGAGKRLFSLPMQQKLKA  102



>gb|AFS18537.1| gibberellin 3-oxidase [Pyrus communis]
Length=371

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWID------EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            DF++  +LPD++ W +        + S    +++PVIDL++P A++    A +TWG FQ+
Sbjct  22   DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP + L + E   +  F LP EQKL+A
Sbjct  82   TNHGIPQKLLDDIESAGKSLFSLPVEQKLKA  112



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDE-PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHG  86
            LD ++  +LP+++ W  E    SS   E +PVI+L D  A++ +  A +TWG FQ+ NH 
Sbjct  14   LDLNSIKELPESYAWSSEDNCPSSSNSEPVPVINLKDSNAMKHVGYACKTWGVFQVTNHD  73

Query  85   IPVEFLAEAEHQIRRFFELPAEQKLRA  5
            IP+  L   E   R+ F LP +QKL+A
Sbjct  74   IPITLLNNMEASGRKLFSLPFQQKLKA  100



>ref|XP_009339604.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWID------EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            DF++  +LPD++ W +        + S    +++PVIDL++P A++    A +TWG FQ+
Sbjct  22   DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP + L + E   +  F LP EQKL+A
Sbjct  82   TNHGIPQKLLDDIESAGKSLFSLPVEQKLKA  112



>ref|XP_007208198.1| hypothetical protein PRUPE_ppa020537mg [Prunus persica]
 gb|EMJ09397.1| hypothetical protein PRUPE_ppa020537mg [Prunus persica]
Length=359

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = -1

Query  205  IKSSPPQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFF  35
            IK+S  +ET+P+ID+   +DP+  E + +A E WGFFQL+NHG+PVE L   +    RFF
Sbjct  52   IKNS--EETVPIIDMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPVEVLENVKEATHRFF  109

Query  34   ELPAEQKLR  8
            ELPAE+K +
Sbjct  110  ELPAEEKSK  118



>ref|XP_008218314.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Prunus mume]
Length=359

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = -1

Query  205  IKSSPPQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFF  35
            IK+S  +E++P+ID+   +DP+  E + +A E WGFFQL+NHG+P+E L   E    RFF
Sbjct  52   IKNS--EESVPIIDMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPIEVLENVEEATHRFF  109

Query  34   ELPAEQKLR  8
            ELPAE+K +
Sbjct  110  ELPAEEKSK  118



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW-IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLI  95
            I PLDF     +P++H W   + ++    + +IP++DL DP A + +  A E WG FQ+ 
Sbjct  18   IIPLDFHAVDSVPESHEWPHSDVLRPVIDEISIPLVDLKDPNAQKLIGHASEDWGIFQVT  77

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NHG+P+  L + E + RR F LP ++KL+ 
Sbjct  78   NHGVPLGVLMDVEFEARRLFSLPVKEKLKV  107



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    +IPVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSIPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>emb|CDP18939.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 48/92 (52%), Gaps = 6/92 (7%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSPPQ------ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            LD     +LPD+H W   P K   P+      ET+PV+DL D  A + +  A  TWG FQ
Sbjct  21   LDLSRVKKLPDSHAWTTAPPKDDYPRGELLNVETVPVVDLADKNAQDLLGHACRTWGVFQ  80

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHGI    L E E   +  F LP  QKL+A
Sbjct  81   VKNHGISKNLLDEIESAGKGLFSLPMHQKLKA  112



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---DEPIKSSP-----PQETIPVIDLNDPQAVEQMKTALETWGF  107
            LDF++  +LP+++TW    D  + +S         ++PVIDLNDP A + +  A +TWG 
Sbjct  20   LDFNSLQELPESYTWTHLDDHTVINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +Q++NHGIP+  L + +   +  F LP  QKL+A
Sbjct  80   YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKA  113



>ref|XP_008344679.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=157

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 6/105 (6%)
 Frame = -1

Query  304  VSTMTGEVVDGITPLDFDNAGQLPDTHTWIDEPIKSS---PPQE--TIPVIDLNDPQAVE  140
            +S   G  +  I P+DF++   LP++H W D   +SS   P  +  ++PVIDL DP+A  
Sbjct  4    ISDPYGAHLHHIIPIDFNSIQTLPESHVWHDHSDESSSGVPSADPLSVPVIDLMDPEAPS  63

Query  139  QMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             M  A E WG FQ+I HG+  + + + E +  + F LP +QKL+A
Sbjct  64   LMIQACEEWGIFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKA  107



>gb|AAM12872.1|AF494089_1 gibberellin 3-oxidase 1 [Nicotiana sylvestris]
Length=360

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD     +LP++H W   +D   + +   E+IPVIDLND + A+E +  A +TWG FQ+I
Sbjct  14   LDLYTIKELPESHAWRSSLDHDYQCNDSLESIPVIDLNDEKFAIENIGHACKTWGAFQII  73

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L   E   +R F LP +QKL+A
Sbjct  74   NHNISQRLLDNMEEAGKRLFSLPMQQKLKA  103



>gb|ABO70984.1| gibberellin 3-oxidase 2 [Nicotiana tabacum]
Length=360

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD     +LP++H W   +D   + +   E+IPVIDLND + A+E +  A +TWG FQ+I
Sbjct  14   LDLYTIKELPESHAWRSSLDHDYQCNDSLESIPVIDLNDEKFAIENIGHACKTWGAFQII  73

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L   E   +R F LP +QKL+A
Sbjct  74   NHNISQRLLDNMEEAGKRLFSLPMQQKLKA  103



>ref|XP_009788819.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
Length=360

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD     +LP++H W   +D   + +   E+IPVIDLND + A+E +  A +TWG FQ+I
Sbjct  14   LDLYTIKELPESHAWRSSLDHDYQCNDSLESIPVIDLNDEKFAIENIGHACKTWGAFQII  73

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L   E   +R F LP +QKL+A
Sbjct  74   NHNISQRLLDNMEEAGKRLFSLPMQQKLKA  103



>gb|ADK70962.1| gibberellin 3-beta-hydroxylase [Medicago daghestanica]
Length=290

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  2    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  61

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  62   QWLGQTLFTLPSHQKLKA  79



>gb|ADK70997.1| gibberellin 3-beta-hydroxylase [Medicago saxatilis]
Length=293

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|XP_008461056.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=374

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 6/92 (7%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
             DFD+  +LPD++ WI      +  + ++   ++IP+IDL+ P A   +  A  TWG FQ
Sbjct  24   FDFDSLQELPDSYDWIQPDSFPNSSLSNNHLSDSIPLIDLSLPNAPHLIGNAFRTWGAFQ  83

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +INHG+P+  L   E      F LPA  KL+A
Sbjct  84   VINHGVPISLLHSIESSANSLFSLPAPHKLKA  115



>gb|ADK70993.1| gibberellin 3-beta-hydroxylase [Medicago sativa]
Length=298

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|NP_193900.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
 sp|Q9SVS8.1|G3OX3_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 3; AltName: Full=GA 
3-oxidase 3; Short=AtGA3ox3; Short=AtGA3ox4; AltName: Full=Gibberellin 
3 beta-hydroxylase 3 [Arabidopsis thaliana]
 emb|CAB36813.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB81276.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 gb|ABE66082.1| gibberellin 3 beta-hydroxylase family protein [Arabidopsis thaliana]
 gb|AEE84490.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
Length=349

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWID-EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            D I PLDF N   LPD+H W   EP  +S P   IPVI L++P+    ++ A E WG F 
Sbjct  16   DRIIPLDFTNTKTLPDSHVWSKPEPETTSGP---IPVISLSNPEEHGLLRQACEEWGVFH  72

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + +HG+    L   + Q++R F LP  +K+ A
Sbjct  73   ITDHGVSHSLLHNVDCQMKRLFSLPMHRKILA  104



>gb|ADK70994.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=295

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  5    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  64

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  65   QWLGQTLFTLPSHQKLKA  82



>gb|ADK70966.1| gibberellin 3-beta-hydroxylase [Medicago hybrida]
 gb|ADK70996.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=295

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  5    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  64

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  65   QWLGQTLFTLPSHQKLKA  82



>ref|XP_008461419.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=378

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 12/104 (12%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTWI------------DEPIKSSPPQETIPVIDLNDPQAVEQ  137
            +  IT  + D+  ++PDTH W+               I   P  +++P+IDL+ P A + 
Sbjct  16   IHAITNKNLDSFEEIPDTHDWVQPNSFPSFRDDHSNNISDLPDTDSVPLIDLSLPNAPKL  75

Query  136  MKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +  AL TWG FQ+INHG+P+  L   E  +   F+LP  QKL+A
Sbjct  76   IGNALRTWGVFQVINHGVPISVLNSMETLLHDLFDLPTPQKLKA  119



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>gb|ABK28643.1| unknown [Arabidopsis thaliana]
Length=350

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWID-EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            D I PLDF N   LPD+H W   EP  +S P   IPVI L++P+    ++ A E WG F 
Sbjct  16   DRIIPLDFTNTKTLPDSHVWSKPEPETTSGP---IPVISLSNPEEHGLLRQACEEWGVFH  72

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + +HG+    L   + Q++R F LP  +K+ A
Sbjct  73   ITDHGVSHSLLHNVDCQMKRLFSLPMHRKILA  104



>gb|ADK70989.1| gibberellin 3-beta-hydroxylase [Medicago prostrata]
Length=298

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>gb|ADK70982.1| gibberellin 3-beta-hydroxylase [Medicago orbicularis]
Length=298

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|XP_010434144.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Camelina sativa]
Length=351

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWID---EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            D I PLDF N   LP++H W     EP   S P   IPVI L++P     ++ A E WG 
Sbjct  16   DRIIPLDFTNTKTLPNSHVWSKTEPEPKTMSLP---IPVISLSNPDQHLLLRQACEEWGV  72

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            F + +HG+P   L   E Q++R F LP  +K+ A
Sbjct  73   FHITDHGVPRSLLHNVECQMKRLFSLPMHRKILA  106



>gb|ADK70983.1| gibberellin 3-beta-hydroxylase [Medicago papillosa]
Length=298

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>gb|ADK71015.1| gibberellin 3-beta-hydroxylase [Trigonella elliptica]
Length=282

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDEP--IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIPV  L + 
Sbjct  2    DDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPVSLLDDI  61

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  62   QWVGQTLFSLPSHQKLKA  79



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLXEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|NP_001275523.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 ref|XP_004160775.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCG14217.1| GA 3-oxidase [Cucumis sativus]
Length=350

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSP----PQETIPVIDLNDPQAVEQMKTALETWGFF  104
            + PLDF +   +P++H W +    S+      + ++P+IDL    A E +  A E WG F
Sbjct  12   LVPLDFTSVQTVPESHLWPNATELSAAIKLDKRVSLPLIDLVSDGASELLGRACEEWGMF  71

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            QLINHGI    + EAE + RR F LPA QK++ 
Sbjct  72   QLINHGISKTLIEEAEEETRRLFTLPATQKMKT  104



>emb|CDP17661.1| unnamed protein product [Coffea canephora]
Length=358

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -1

Query  184  ETIPVIDLN---DPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQK  14
            ++IPVIDL+   DP+  EQ+  A E WGFFQ++NHGIP+E L + +   RRFF+ PAEQK
Sbjct  57   DSIPVIDLSNWTDPKVAEQICHAAEKWGFFQIVNHGIPIEVLEDVKEATRRFFDSPAEQK  116



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE--------TIPVIDLNDPQAVEQMKTALET  116
            I P+DFD+  ++P +H+W  +    SP +         +IP IDL+ P A+E    A + 
Sbjct  18   IIPIDFDSVKEVPQSHSW-PQSDDESPRRMFNFDGDHFSIPAIDLDSPDAIEMAGHACKI  76

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             G FQ+ NHGIP   L E E Q  RFF LPA  K++A
Sbjct  77   MGIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKA  113



>gb|ADK71013.1| gibberellin 3-beta-hydroxylase [Trigonella corniculata]
Length=297

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDEP--IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  5    DDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  64

Query  58   EHQIRRFFELPAEQKLRA  5
                +  F LP+ QKL+A
Sbjct  65   HSVGQTLFSLPSNQKLKA  82



>ref|XP_010459098.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD+++W   D+ + ++ P      ETIP+IDL+ P A  Q+  A  TWG FQ
Sbjct  23   DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+  L + E      F LP ++KL+A
Sbjct  83   IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKA  114



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            +F++  +LP++H W    D P  S P    +PVIDL DP+A E M  A  +WG FQ+  H
Sbjct  17   EFESVRELPESHAWPTLHDHPCVSEP----VPVIDLADPKAAEFMARACVSWGAFQVTGH  72

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+    L   + ++RR F LP +QKL+A
Sbjct  73   GVAPRLLEAIDSEMRRLFALPIQQKLKA  100



>ref|XP_010476647.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Camelina sativa]
 gb|ADE80896.1| GA3ox1-like protein [Camelina sativa]
Length=358

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD+++W   D+ + ++ P      ETIP+IDL+ P A  Q+  A  TWG FQ
Sbjct  23   DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+  L + E      F LP ++KL+A
Sbjct  83   IANHGVPLSLLQDVEFLTESLFGLPVKRKLKA  114



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSPPQ--ETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
             +F    ++PD+H W   P+ +  P   + +PVIDL  P A   +  A E WG FQ+  H
Sbjct  16   FEFKTLTEVPDSHAW---PVVNDHPHGDDAVPVIDLACPDAARLIGQACEEWGAFQITGH  72

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+PV+ L   E Q RR F LP  QKL+A
Sbjct  73   GVPVDLLDRLEAQTRRLFSLPTGQKLKA  100



>gb|ADK70995.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=298

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++P+IDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESANSSSVPIIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE--------TIPVIDLNDPQAVEQMKTALET  116
            I P+DFD+  ++P +H+W  +    SP +         +IP IDL+ P A+E    A + 
Sbjct  18   IIPIDFDSVEEVPQSHSW-PQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHACKI  76

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             G FQ+ NHGIP   L E E Q  RFF LPA  K++A
Sbjct  77   MGIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKA  113



>ref|XP_009345720.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Pyrus x bretschneideri]
Length=363

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = -1

Query  205  IKSSPPQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFF  35
            + ++ P E IP+ID+   +DP+  E +  A E WGFFQL+NHG+P+E L   +    RFF
Sbjct  55   VATTNPGEYIPIIDMSNSDDPKVAEAICNAAEKWGFFQLVNHGVPIEVLENVKEATHRFF  114

Query  34   ELPAEQKLR  8
            ELPA++K +
Sbjct  115  ELPAKKKTK  123



>gb|ADK71003.1| gibberellin 3-beta-hydroxylase [Medicago turbinata]
Length=288

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     IPVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  5    DDHTLIKEGTTSS----IIPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  60

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  61   LGQTLFTLPSHQKLKA  76



>ref|XP_011039983.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=465

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 7/93 (8%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW--IDEPIKSSPP-----QETIPVIDLNDPQAVEQMKTALETWGFF  104
            LDF    ++PD+H W  +D+  +  P       E++PVIDL DP  ++ +  A +TWG  
Sbjct  114  LDFSTLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  173

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             + NHGIP+  L   E    + F LP +QKL+A
Sbjct  174  HVTNHGIPISLLENVESVSSKLFSLPIQQKLKA  206



>ref|XP_008232563.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Prunus mume]
Length=359

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 5/67 (7%)
 Frame = -1

Query  205  IKSSPPQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFF  35
            IK+S  +E++P+ID+   +DP+  E + +A E WGFFQL+NHG+P+E L   +    RFF
Sbjct  52   IKNS--EESVPIIDMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPIEVLENVKEATHRFF  109

Query  34   ELPAEQK  14
            ELPAE+K
Sbjct  110  ELPAEEK  116



>ref|XP_010497240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI--DEPIKSSPPQ-----ETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF +  +LPD+++W   D+ + ++ P      ETIP+IDL+ P A  Q+  A  TWG FQ
Sbjct  23   DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+  L + E      F LP ++KL+A
Sbjct  83   IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKA  114



>ref|XP_010439443.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=353

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = -1

Query  277  DGITPLDFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            D I PLDF N   LP++H W     EP   S P   IPVI L++P     ++ A E WG 
Sbjct  16   DRIIPLDFTNTKTLPNSHVWSITEPEPKTMSLP---IPVISLSNPDQHVLLRQACEEWGV  72

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            F + +HG+P   L   E Q++R F LP  +K+ A
Sbjct  73   FHITDHGVPRSLLHNVECQMKRLFSLPMHRKILA  106



>ref|XP_003546239.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHM98787.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=353

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI----DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            D ++  +LP+++TW     D+   S    E++PVIDLNDP A + +  A  TWG +Q++N
Sbjct  21   DLNSLQELPESYTWTHHGHDDHTNSPASNESVPVIDLNDPNASKLIHHACTTWGAYQVLN  80

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HGIP+  L + +      F LP+ QK +A
Sbjct  81   HGIPMSLLQDIQWVGETLFSLPSHQKHKA  109



>gb|KDP37169.1| hypothetical protein JCGZ_06225 [Jatropha curcas]
Length=375

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW--IDEPIKS----SPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            DF +  +LPD++ W  +DE   S    S  +E+IPVIDL D  A++ +  A +TWG FQ+
Sbjct  22   DFTSLQELPDSYKWTQLDEETHSYSGDSFMKESIPVIDLLDSNALKNIGYACKTWGVFQV  81

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            INHG+    L   E   R  F LP +QKL+A
Sbjct  82   INHGVSTCLLDNIEKVSRDLFSLPMQQKLKA  112



>ref|XP_008387508.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 6/105 (6%)
 Frame = -1

Query  304  VSTMTGEVVDGITPLDFDNAGQLPDTHTWIDEPIKSS---PPQE--TIPVIDLNDPQAVE  140
            +S   G  +  I P+DF++   LP++H W D   +SS   P  +  ++PVIDL DP+A  
Sbjct  4    ISDPYGAHLHHIIPIDFNSIQTLPESHVWHDHSDESSSGVPSADPLSVPVIDLMDPEAPS  63

Query  139  QMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             M  A E WG FQ+I HG+  + + + E +  + F LP +QKL+A
Sbjct  64   LMIQACEEWGIFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKA  107



>gb|ADK70971.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=292

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLIKEGTTSS----IVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  62   LGQTLFTLPSHQKLKA  77



>gb|ADK70991.1| gibberellin 3-beta-hydroxylase [Medicago rigidula]
Length=291

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLIKEGTTSS----GVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  62   LGQTLFTLPSHQKLKA  77



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  10   IKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  69

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  70   SHQKLKA  76



>gb|ADK70969.1| gibberellin 3-beta-hydroxylase [Medicago italica]
Length=288

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  5    DDHTLIKEGTTSS----IVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  60

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  61   LGQTLFTLPSHQKLKA  76



>gb|ADK70972.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=289

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLIKEGTTSS----IVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  62   LGQTLFTLPSHQKLKA  77



>gb|ADK70974.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=275

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  1    IKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  60

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  61   SHQKLKA  67



>ref|XP_008352044.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKS-----SPPQETIPVIDLNDPQAVEQMKTALETWGF  107
            I P+DF++  +LP++H W D+  +S     S     +PVIDL D +A   M  A ETWG 
Sbjct  15   IIPIDFNSVQKLPESHVWHDKSHESLFGVPSADPLPVPVIDLMDSEASSLMIQACETWGI  74

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+I HG+  +F  + E +  + F LP +QKL+A
Sbjct  75   FQVIGHGL-TKFXEDVESEAEKLFGLPVDQKLKA  107



>gb|ADM47339.1| gibberellin 3-oxidase 3 [Marah macrocarpus]
Length=355

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKSSPPQE-------TIPVIDLNDPQAVEQMKTAL  122
            I PLDF +   +PD+H W       I +S   E       +IP+IDL DP A   +  A 
Sbjct  18   IVPLDFTSLRTVPDSHDWPQSASHDIATSSSHELHTNGDVSIPLIDLTDPDAAMLISNAC  77

Query  121  ETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            +TWG FQL NH +P+  +   E    R F+LP  +KL+A
Sbjct  78   KTWGVFQLTNHVVPMSLIERVEGVSGRLFDLPMTRKLKA  116



>ref|XP_009343425.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWIDEP------IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQL  98
            DF++  +LPD++ W +        + S    +++PVIDL+D  A++    A +TWG FQ+
Sbjct  22   DFNSLHELPDSYAWTNNDDLYPSFLTSFGADDSVPVIDLSDTNALKLTGHACKTWGVFQV  81

Query  97   INHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             NHGIP + L + E   +  F LP +QKL+A
Sbjct  82   TNHGIPQKLLDDIESAGKSLFSLPVQQKLKA  112



>ref|XP_010049018.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81481.1| hypothetical protein EUGRSUZ_C02840 [Eucalyptus grandis]
Length=355

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWIDEPIKSSPPQE--------TIPVIDLNDPQAVEQMKTALET  116
            I P+DFD+  ++P +H+W  +    SP +         +IP IDL+ P A+E    A + 
Sbjct  18   IIPIDFDSVEEVPQSHSW-PQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHACKI  76

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             G FQ+ NHGIP   L E E Q  RFF LPA  K++A
Sbjct  77   MGIFQVTNHGIPSSLLREIESQAWRFFTLPARAKVKA  113



>gb|ADK70964.1| gibberellin 3-beta-hydroxylase [Medicago granadensis]
Length=292

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK+S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +      F LP
Sbjct  11   IKNSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGHTLFTLP  70

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  71   SHQKLKA  77



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDEP--IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  6    DDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>gb|AFK37640.1| unknown [Lotus japonicus]
Length=361

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  190  PQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAE  20
            PQE+IP+ID+   +DP+  + +  A + WGFFQ+INHG+P++ L   +    RF+ELPAE
Sbjct  58   PQESIPIIDMSNWDDPKVGDAICEAAQKWGFFQIINHGVPLQVLENVKDATYRFYELPAE  117

Query  19   QKLR  8
            QKL+
Sbjct  118  QKLK  121



>gb|AGH39958.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=293

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  12   IKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  71

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  72   SHQKLKA  78



>ref|XP_008359473.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Malus domestica]
Length=363

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = -1

Query  205  IKSSPPQETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFF  35
            + ++ P E IP+ID+   +DP+  E +  A E WGFFQL+NHG+P+E L        RFF
Sbjct  55   VATTNPGEYIPIIDMSNSDDPKVAEAICNAAEKWGFFQLVNHGVPIEELENVXEATHRFF  114

Query  34   ELPAEQKLR  8
            ELPAE+K +
Sbjct  115  ELPAEKKTK  123



>gb|ADK70968.1| gibberellin 3-beta-hydroxylase [Medicago intertexta]
Length=289

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  11   IKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  70

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  71   SHQKLKA  77



>gb|ADK70957.1| gibberellin 3-beta-hydroxylase [Medicago bonarotiana]
Length=246

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT + E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLVKESNTSS----GVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP++QKL+A
Sbjct  62   LGQTLFTLPSQQKLKA  77



>gb|AAC96016.1| truncated gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96014.1| gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC49795.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=172

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 8/93 (9%)
 Frame = -1

Query  259  DFDNAGQLP--------DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
            DF++  +LP        D HT ID          T+PVIDLNDP A + +  A +TWG +
Sbjct  21   DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            Q++NHGIP+  L + +   +  F LP+ QK +A
Sbjct  81   QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKA  113



>gb|ADK70973.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=292

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  11   IKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  70

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  71   SHQKLKA  77



>dbj|BAD30036.1| gibberellin 3beta-hydroxylase2 [Daucus carota]
Length=353

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDE--PIKSSP---PQETIPVIDLNDP-QAVEQMKTALETWGFFQ  101
            LD ++  +LPD+H W  E   + SSP    +  +PVIDL+D     + +  A +TWG FQ
Sbjct  23   LDLNSLEELPDSHAWSSELDKLSSSPDDHGESNLPVIDLSDSINGPKHLVHACKTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRAK  2
            LINHGI  + +   E   R+ F LP EQKL+A+
Sbjct  83   LINHGISNQLIDSMEAATRKLFSLPIEQKLKAE  115



>ref|XP_009128433.1| PREDICTED: gibberellin 3-beta-dioxygenase 2 [Brassica rapa]
Length=358

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            DF +   LPD++TW    D    +S   E++P IDL+DP    ++  A  TWG FQ+ NH
Sbjct  23   DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+P   L + E      F+LP  +KL+A
Sbjct  83   GVPSRLLDDIEFLTGSLFQLPVHRKLKA  110



>emb|CDM81908.1| unnamed protein product [Triticum aestivum]
Length=369

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 7/93 (8%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPI----KSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
             DF  A ++P+TH W    D P+     +    + +PV+D+ DP A E +  A + WG F
Sbjct  14   FDFRAARRVPETHAWPGLHDHPVVDGSGAGGDPDAVPVVDMRDPFAAEAVGLAAQDWGAF  73

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             L+ HG+P++ LA  E  I   F LPA +K+RA
Sbjct  74   LLVGHGVPLDLLARVEAAIAGMFALPASEKMRA  106



>emb|CDY37589.1| BnaA02g19810D [Brassica napus]
Length=358

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            DF +   LPD++TW    D    +S   E++P IDL+DP    ++  A  TWG FQ+ NH
Sbjct  23   DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+P   L + E      F+LP  +KL+A
Sbjct  83   GVPSRLLDDIEFLTGSLFQLPVNRKLKA  110



>gb|ADK70960.1| gibberellin 3-beta-hydroxylase [Medicago ciliaris]
Length=292

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E +   +  F LP
Sbjct  11   IKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQTLFTLP  70

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  71   SHQKLKA  77



>gb|ADK70990.1| gibberellin 3-beta-hydroxylase [Medicago radiata]
Length=298

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  229  THTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQ  50
            TH   +  +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + +  
Sbjct  9    THINSNNTMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIQWL  68

Query  49   IRRFFELPAEQKLRA  5
             +  F LP+ QKL+A
Sbjct  69   GQTLFTLPSHQKLKA  83



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT + E   +S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  1    DDHTLVKESTTNS----SVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  56

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  57   LGQTLFTLPSHQKLKA  72



>gb|ADK70967.1| gibberellin 3-beta-hydroxylase [Medicago hypogaea]
Length=298

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLINSNNTMKESTNSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ +KL+A
Sbjct  66   QWLGQTLFTLPSHEKLKA  83



>gb|AGH39957.1| gibberellin 3-beta-hydroxylase [Medicago edgeworthii]
Length=293

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT + E   SS    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + + 
Sbjct  7    DDHTLVKESTTSS----SVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIQW  62

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  63   LGQTLFTLPSHQKLKA  78



>gb|ADK70992.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=292

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWID--EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  5    DDHTLINPNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  64

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  65   QWLGQTLFTLPSHQKLKA  82



>emb|CDY38661.1| BnaC02g23180D [Brassica napus]
Length=358

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI---DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINH  89
            DF +   LPD++TW    D    +S   E++P IDL+DP    ++  A  TWG FQ+ NH
Sbjct  23   DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  88   GIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G+P   L + E      F LP  +KL+A
Sbjct  83   GVPSRLLDDIEFLTGSLFRLPVHRKLKA  110



>ref|NP_001267625.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28484.1| GA 3-oxidase [Cucumis sativus]
 gb|KGN45325.1| hypothetical protein Csa_7G435500 [Cucumis sativus]
Length=374

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWI---------DEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWG  110
            L+ D+  QLPDT+ WI         D  I  S   +++P+IDL+ P A   +  AL+TWG
Sbjct  25   LNLDSLQQLPDTYDWIQPDAFPSFRDPNISLS---DSVPLIDLSLPNAPHLIGNALKTWG  81

Query  109  FFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             FQ+INHG+P+  L   E      F+LP+  KL+A
Sbjct  82   VFQVINHGVPISLLNSMESFTNTLFDLPSPHKLKA  116



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWID--EPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  7    DDHTLINPNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  66

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  67   QWLGQTLFTLPSHQKLKA  84



>gb|ADK70999.1| gibberellin 3-beta-hydroxylase [Medicago shepardii]
Length=292

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT + E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  6    DDHTLVKESNTSS----GVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPINLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP++QKL+A
Sbjct  62   LGQTLFTLPSQQKLKA  77



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  6    DDHTLINSNNTMKESATTSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +      F LP+ QKL+A
Sbjct  66   QWLGETLFTLPSHQKLKA  83



>dbj|BAG48320.1| gibberellin 3-oxidase1 [Chrysanthemum x morifolium]
Length=356

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSPPQ---ETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LD ++   LP++H W+             + +PVI L DP A+  +  A +TWG FQ+ N
Sbjct  13   LDLNSMKVLPESHAWLSLESSPLYSSLSPDLVPVISLTDPNAMNLVGHACKTWGVFQVTN  72

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P+  L + E   R+ F LP +QKL+A
Sbjct  73   HGVPINLLEKMEAAGRKLFALPIQQKLKA  101



>ref|XP_003533057.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=375

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -1

Query  259  DFDNAGQLPDTHTWI-----DEPIKSSPP----QETIPVIDLNDPQAVEQMKTALETWGF  107
            DF++  +LPD++ W      D  + + P     +  +P+IDLNDP A   +  A +TWG 
Sbjct  21   DFNSLQELPDSYAWTQPDDDDHRLTNYPSNNKTKTVVPIIDLNDPNAPNLIGHACKTWGV  80

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ++NHGIP    ++ +      F LP  QKL+A
Sbjct  81   FQVVNHGIPTSLFSDIQRASLALFSLPLHQKLKA  114



>dbj|BAQ02990.1| gibberellin 3-oxidase [Rorippa aquatica]
Length=356

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = -1

Query  259  DFDNAGQLPDTHTW-------IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQ  101
            DF    +LPD++TW                  ETIP+IDLN P A  Q+  A  TWG FQ
Sbjct  23   DFTALRELPDSYTWTPKDDILFPAAPSPPAASETIPLIDLNQPDAANQIGRACRTWGAFQ  82

Query  100  LINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            + NHG+P+  L + E      F LP ++KL+A
Sbjct  83   IANHGVPLGLLEDIEFLTSSLFRLPVQRKLKA  114



>ref|XP_004158764.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
Length=377

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = -1

Query  280  VDGITPLDFDNAGQLPDTHTWI---------DEPIKS--SPPQETIPVIDLNDPQAVEQM  134
            V  +T  + D+  Q+PDTH W+         D+   S  S   +++P+IDL+ P A + +
Sbjct  16   VHALTNKNLDSFEQIPDTHDWVQPNSFPSFTDQSNISDLSSDTDSVPLIDLSLPNAPKLI  75

Query  133  KTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
              AL TWG FQ INHG+P+  L   E  +   F+LP  QKL+A
Sbjct  76   GNALRTWGVFQAINHGVPISVLNSMESLLNDLFDLPTPQKLKA  118



>emb|CDP19904.1| unnamed protein product [Coffea canephora]
Length=358

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = -1

Query  187  QETIPVIDL---NDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQ  17
            + +IPVIDL   NDP   EQ+  A E WGFFQ++NHGIP+E     +   R+FF LPAEQ
Sbjct  56   ENSIPVIDLSNWNDPMVAEQICNAAEKWGFFQIVNHGIPIEVSENVKEATRQFFGLPAEQ  115

Query  16   K  14
            K
Sbjct  116  K  116



>ref|XP_009372969.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 6/105 (6%)
 Frame = -1

Query  304  VSTMTGEVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQET-----IPVIDLNDPQAVE  140
            +S   G  +  I P+DF+    LP++H W D   +SS    +     +PVIDL DP+A  
Sbjct  4    ISDPYGAHLHHIIPIDFNTIQTLPESHVWHDHSDESSSRVPSADPLFVPVIDLMDPEAPS  63

Query  139  QMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             M  A E WG FQ+I HG+  + + + E +  + F LP +QKL+A
Sbjct  64   LMIQACEEWGIFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKA  107



>gb|ADK70986.1| gibberellin 3-beta-hydroxylase [Medicago polyceratia]
Length=291

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I   +K S    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E + 
Sbjct  5    DDHTPI---MKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP+ QKL+A
Sbjct  62   LGQTLFTLPSHQKLKA  77



>ref|XP_010925284.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=362

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -1

Query  256  FDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHG  86
            F++  ++PD+H W    D P       +++PV+DL  P A+  +  A + +G FQ+ +HG
Sbjct  24   FESIRKVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDALLLVGRACQDFGVFQITSHG  83

Query  85   IPVEFLAEAEHQIRRFFELPAEQKLRA  5
            IP + L   E QIRR F LP  QKL+A
Sbjct  84   IPTDLLDRLESQIRRLFSLPTHQKLKA  110



>ref|XP_009377503.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTWID---EPIKSSPPQET--IPVIDLNDPQAVEQMKTALETWGF  107
            I P+DF++  +LP++H W D   E +   P  +   +PVIDL D +A   M  A ETWG 
Sbjct  15   IIPIDFNSVQKLPESHVWHDISHESLFGVPSADPLPVPVIDLMDSEASSLMIQACETWGI  74

Query  106  FQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            FQ+I HG+  + + + E +  + F LP +QKL+A
Sbjct  75   FQVIGHGL-TKLMEDVEFEAEKLFGLPVDQKLKA  107



>gb|ADM47338.1| gibberellin 3-oxidase 2 [Marah macrocarpus]
Length=370

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSP---PQETIPVIDLNDPQAVEQMKTALETWGFFQLIN  92
            LDFD+  +LPDT+ W+      SP    QE +P+IDL+ P A   +  A  +WG FQ IN
Sbjct  22   LDFDSFNELPDTYEWVQPDSIPSPNDQSQEHLPLIDLSLPNAAALVGDAFRSWGAFQAIN  81

Query  91   HGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            HG+P+  L   E  +   F LP   K +A
Sbjct  82   HGVPISLLHSFESTVDTLFSLPPSDKHKA  110



>gb|ADK71001.1| gibberellin 3-beta-hydroxylase [Medicago suffruticosa]
Length=288

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            IK S    ++PVIDLNDP A + +  A +TWG +Q++NHG+P+  L + +   +  F LP
Sbjct  11   IKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGVPISLLDDIQWLGQTLFTLP  70

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  71   SHQKLKA  77



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDEP--IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT I+    +K +    ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + 
Sbjct  7    DDHTLINSNNIMKENTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDI  66

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  67   QWLGQTLFTLPSHQKLKA  84



>ref|XP_009128435.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Brassica rapa]
Length=351

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = -1

Query  238  LPDTHTW----IDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPV  77
            LPD+ TW     D   P  S+  +E+IPVIDL+DP     +  A +TWG FQ+ NHG+  
Sbjct  19   LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  76   EFLAEAEHQIRRFFELPAEQKLRA  5
              L + E   + FF++P+E+KL A
Sbjct  79   SLLDDVESLSKTFFDMPSERKLEA  102



>gb|ADK71021.1| gibberellin 3-beta-hydroxylase [Trigonella sp. TU 33879]
Length=274

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  205  IKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELP  26
            +K S  + ++PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + +   +  F LP
Sbjct  6    MKESTTRSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIQWVGQTLFSLP  65

Query  25   AEQKLRA  5
            + QKL+A
Sbjct  66   SHQKLKA  72



>emb|CDY37588.1| BnaA02g19820D [Brassica napus]
Length=351

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = -1

Query  238  LPDTHTW----IDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPV  77
            LPD+ TW     D   P  S+  +E+IPVIDL+DP     +  A +TWG FQ+ NHG+  
Sbjct  19   LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  76   EFLAEAEHQIRRFFELPAEQKLRA  5
              L + E   + FF++P+E+KL A
Sbjct  79   SLLDDVESLSKTFFDMPSERKLEA  102



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -1

Query  232  DTHTWIDE--PIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEA  59
            D HT  +    +K S     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L E 
Sbjct  6    DDHTLTNSNNTMKESNTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEI  65

Query  58   EHQIRRFFELPAEQKLRA  5
            +   +  F LP+ QKL+A
Sbjct  66   QWLGQTLFTLPSHQKLKA  83



>ref|XP_006341659.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=356

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD  +  +LP++H W   +D+    +   E+IPVIDLND + A++++  A +TWG FQ+I
Sbjct  11   LDLYSIKELPESHAWRSSLDDDGSRNINVESIPVIDLNDDKFAIDRIGHACKTWGAFQII  70

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L + E    R F LP +QKL+A
Sbjct  71   NHNISQRLLNDMETCGTRLFSLPMQQKLKA  100



>ref|XP_002525827.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF36521.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=362

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
 Frame = -1

Query  289  GEVVDGITPLDFDNAGQLPDTHTWIDEPIKSSPPQETIPVIDL----NDPQAVEQMKTAL  122
            G  V G++ L   +   LP  +    E + +  PQ++IPVID+    NDP+  E +  A 
Sbjct  24   GNGVKGLSDLGLKS---LPRQYIQPQEALINIIPQDSIPVIDMSNFDNDPKIAESICDAA  80

Query  121  ETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLR  8
            E +GFFQL+NHG+P+E L   +    RFF LPAE+K +
Sbjct  81   EQFGFFQLVNHGVPLEVLDGVKDATHRFFGLPAEEKRK  118



>gb|ACN89834.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=356

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPIKSSPPQETIPVIDLNDPQ-AVEQMKTALETWGFFQLI  95
            LD  +  +LP++H W   +D+    +   E+IPVIDLND + A++++  A +TWG FQ+I
Sbjct  11   LDLYSIKELPESHAWRSSLDDDGSRNINVESIPVIDLNDDKFAIDRIGHACKTWGAFQII  70

Query  94   NHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            NH I    L + E    R F LP +QKL+A
Sbjct  71   NHNISQRLLNDMETCGTRLFSLPMQQKLKA  100



>gb|ADK70998.1| gibberellin 3-beta-hydroxylase [Medicago secundiflora]
Length=291

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -1

Query  232  DTHTWIDEPIKSSPPQETIPVIDLNDPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEH  53
            D HT I E   SS     +PVIDLNDP A + +  A +TWG +Q++NHGIP+  L + + 
Sbjct  6    DDHTLIKESNTSS----GVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPIGLLDDIQW  61

Query  52   QIRRFFELPAEQKLRA  5
              +  F LP++QKL+A
Sbjct  62   LGQTLFTLPSQQKLKA  77



>sp|Q3I409.1|G3O23_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-3; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-3; AltName: Full=Gibberellin 
3-oxidase 2-3 [Triticum aestivum]
 gb|AAZ94379.1| gibberellin 3-oxidase 2-3 [Triticum aestivum]
Length=369

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTW---IDEPI----KSSPPQETIPVIDLNDPQAVEQMKTALETWGFF  104
             DF  A ++P+TH W    D P+     +    + +PV+D+ DP A E +  A + WG F
Sbjct  14   FDFRAARRVPETHAWPGLHDHPVVDGSGAGGEPDAVPVVDMRDPFAAEAVGLAAQDWGAF  73

Query  103  QLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
             L+ HG+P++ L   E  I   F LPA +K+RA
Sbjct  74   LLVGHGVPLDLLVRVEAAIAGMFALPASEKMRA  106



>ref|XP_004296193.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Fragaria vesca 
subsp. vesca]
Length=364

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = -1

Query  187  QETIPVIDLN---DPQAVEQMKTALETWGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQ  17
            +E+IP+ID++   DP+  E +  A E WGFFQ++NHG+P+E L   +    +FFELPAE+
Sbjct  58   EESIPIIDMSNWEDPKVTESICNAAEKWGFFQILNHGVPIEVLEHVKEATHKFFELPAEE  117

Query  16   KLR  8
            K +
Sbjct  118  KCK  120



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = -1

Query  271  ITPLDFDNAGQLPDTHTW---IDEPIKS----SPPQETIPVIDLNDPQAVEQMKTALETW  113
            I P+DFD+  ++P +H+W    DE  +          +IP IDL+ P A+E    A +  
Sbjct  18   IIPIDFDSVKEVPQSHSWPQSDDESTRRMFNLDGDHFSIPAIDLDSPDAIETAGHACKIM  77

Query  112  GFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            G FQ+ NHGI    L E E Q  RFF LPA  K++A
Sbjct  78   GIFQVTNHGILSSLLREVESQAWRFFTLPARAKVKA  113



>emb|CAC83089.1| gibberellin 3-oxidase [Cucurbita maxima]
Length=377

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 11/97 (11%)
 Frame = -1

Query  262  LDFDNAGQLPDTHTWIDEPIKSSPPQ-----------ETIPVIDLNDPQAVEQMKTALET  116
            LDFD+  +LPD++ WI      SP             +++P+IDL+ P A   +  A  +
Sbjct  22   LDFDSLHELPDSYAWIQPDSFPSPTHKHHNSILDSDSDSVPLIDLSLPNAAALIGNAFRS  81

Query  115  WGFFQLINHGIPVEFLAEAEHQIRRFFELPAEQKLRA  5
            WG FQ+INHG+P+  L   E      F LP   KL+A
Sbjct  82   WGAFQVINHGVPISLLQSIESSADTLFSLPPSHKLKA  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533012731632