BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13971_g2_i1 len=722 path=[1407:0-339 1747:340-721]

Length=722
                                                                      Score     E

ref|XP_011098473.1|  PREDICTED: carbonic anhydrase, chloroplastic...    285   1e-91   
ref|XP_010687996.1|  PREDICTED: carbonic anhydrase, chloroplastic...    279   3e-89   
ref|XP_010251258.1|  PREDICTED: carbonic anhydrase 2-like isoform X4    274   4e-88   
ref|XP_010251257.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    274   4e-88   
ref|XP_010251255.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    275   7e-88   
gb|EYU44748.1|  hypothetical protein MIMGU_mgv1a009344mg                275   9e-88   
ref|XP_006470328.1|  PREDICTED: carbonic anhydrase, chloroplastic...    272   2e-87   
ref|XP_006470326.1|  PREDICTED: carbonic anhydrase, chloroplastic...    273   6e-87   
ref|NP_850490.1|  carbonic anhydrase 1                                  270   7e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338560.1|  PREDICTED: carbonic anhydrase, chloroplastic...    273   8e-87   
ref|XP_010660912.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    270   1e-86   
ref|XP_009147437.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    272   2e-86   
ref|XP_006408514.1|  hypothetical protein EUTSA_v10020995mg             271   3e-86   
ref|XP_002277957.1|  PREDICTED: carbonic anhydrase 2 isoform X1         271   4e-86   Vitis vinifera
ref|XP_002882178.1|  hypothetical protein ARALYDRAFT_477371             271   5e-86   
ref|NP_186799.2|  carbonic anhydrase 1                                  271   6e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125017.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    270   1e-85   
ref|XP_006446503.1|  hypothetical protein CICLE_v10015874mg             268   5e-85   
ref|XP_010315870.1|  PREDICTED: carbonic anhydrase isoform X1           268   5e-85   
ref|XP_003618283.1|  Carbonic anhydrase                                 260   4e-84   
ref|XP_007151035.1|  hypothetical protein PHAVU_004G013500g             266   4e-84   
ref|XP_004489276.1|  PREDICTED: carbonic anhydrase, chloroplastic...    263   5e-84   
ref|XP_003618280.1|  Carbonic anhydrase                                 265   8e-84   
prf||1707317A  carbonic anhydrase                                       262   1e-83
ref|XP_011098474.1|  PREDICTED: carbonic anhydrase, chloroplastic...    265   1e-83   
ref|XP_004489274.1|  PREDICTED: carbonic anhydrase, chloroplastic...    265   1e-83   
sp|P16016.2|CAHC_SPIOL  RecName: Full=Carbonic anhydrase, chlorop...    263   3e-83   Spinacia oleracea
ref|XP_002298524.2|  carbonic anhydrase isoform 1 family protein        263   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_009801271.1|  PREDICTED: carbonic anhydrase, chloroplastic...    259   2e-82   
ref|XP_009614639.1|  PREDICTED: carbonic anhydrase, chloroplastic...    259   2e-82   
gb|AAA34026.1|  carbonic anhydrase precursor                            259   2e-82   Spinacia oleracea
gb|KHG25180.1|  Carbonic anhydrase, chloroplastic                       261   2e-82   
ref|XP_009801258.1|  PREDICTED: carbonic anhydrase, chloroplastic...    261   3e-82   
ref|XP_009614637.1|  PREDICTED: carbonic anhydrase, chloroplastic...    261   3e-82   
gb|KDP45339.1|  hypothetical protein JCGZ_09588                         261   4e-82   
ref|XP_011047313.1|  PREDICTED: carbonic anhydrase 2                    260   7e-82   
ref|XP_007031476.1|  Carbonic anhydrase 1 isoform 1                     258   9e-82   
ref|XP_006603811.1|  PREDICTED: carbonic anhydrase, chloroplastic...    257   1e-81   
gb|AEV42276.1|  chloroplast beta carbonic anhydrase 1                   259   1e-81   
ref|XP_010251256.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    259   1e-81   
ref|XP_010551901.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    259   1e-81   
ref|XP_006579757.1|  PREDICTED: carbonic anhydrase, chloroplastic...    256   3e-81   
ref|XP_003553834.1|  PREDICTED: carbonic anhydrase, chloroplastic...    258   5e-81   
ref|XP_010435624.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    258   5e-81   
ref|XP_010496563.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    258   5e-81   
ref|XP_006579756.1|  PREDICTED: carbonic anhydrase, chloroplastic...    257   1e-80   
gb|EYU44749.1|  hypothetical protein MIMGU_mgv1a009344mg                255   4e-80   
ref|XP_006338561.1|  PREDICTED: carbonic anhydrase, chloroplastic...    254   9e-80   
ref|XP_006408512.1|  hypothetical protein EUTSA_v10020995mg             251   2e-79   
ref|XP_010029174.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    251   3e-79   
dbj|BAD93915.1|  carbonic anhydrase, chloroplast precursor              250   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470327.1|  PREDICTED: carbonic anhydrase, chloroplastic...    252   7e-79   
ref|XP_006298106.1|  hypothetical protein CARUB_v10014147mg             252   8e-79   
gb|ADI52861.1|  chloroplast beta-carbonic anhydrase                     252   9e-79   
ref|XP_010029173.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    252   1e-78   
ref|XP_006408513.1|  hypothetical protein EUTSA_v10020995mg             251   1e-78   
ref|NP_850491.1|  carbonic anhydrase 1                                  251   3e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AJA06253.1|  beta-type carbonic anhydrase 1-like protein             251   3e-78   
emb|CAN61667.1|  hypothetical protein VITISV_037833                     250   3e-78   Vitis vinifera
ref|XP_010108776.1|  Carbonic anhydrase                                 250   5e-78   
ref|NP_001234048.1|  carbonic anhydrase                                 249   8e-78   
ref|XP_010524306.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    246   1e-77   
ref|XP_006446499.1|  hypothetical protein CICLE_v10015874mg             246   2e-77   
dbj|BAD94771.1|  carbonic anhydrase, chloroplast precursor              242   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446501.1|  hypothetical protein CICLE_v10015874mg             245   2e-77   
ref|XP_006408515.1|  hypothetical protein EUTSA_v10020995mg             249   2e-77   
ref|XP_007215653.1|  hypothetical protein PRUPE_ppa008289mg             248   3e-77   
ref|XP_008230600.1|  PREDICTED: carbonic anhydrase, chloroplastic...    246   3e-77   
ref|XP_008230599.1|  PREDICTED: carbonic anhydrase 2, chloroplast...    248   3e-77   
ref|XP_006446502.1|  hypothetical protein CICLE_v10015874mg             247   4e-77   
ref|XP_006446505.1|  hypothetical protein CICLE_v10015874mg             246   4e-77   
gb|AAS65454.1|  chloroplast carbonic anhydrase precursor                248   4e-77   Noccaea caerulescens
gb|KDO66161.1|  hypothetical protein CISIN_1g019915mg                   246   4e-77   
gb|ABI14813.1|  chloroplast carbonic anhydrase                          246   8e-77   Pachysandra terminalis
sp|P46512.1|CAH1_FLALI  RecName: Full=Carbonic anhydrase 1; AltNa...    246   1e-76   Flaveria linearis
gb|AAA34057.1|  carbonic anhydrase                                      244   2e-76   Nicotiana tabacum [American tobacco]
ref|XP_003618284.1|  Carbonic anhydrase                                 243   2e-76   
sp|P46511.1|CAHX_FLABR  RecName: Full=Carbonic anhydrase; AltName...    246   2e-76   Flaveria brownii
sp|P46281.1|CAHX_FLAPR  RecName: Full=Carbonic anhydrase; AltName...    246   2e-76   Flaveria pringlei
ref|XP_007151036.1|  hypothetical protein PHAVU_004G013500g             245   3e-76   
ref|XP_006369921.1|  hypothetical protein POPTR_0001s34950g             240   3e-76   
ref|XP_003618281.1|  Carbonic anhydrase                                 245   3e-76   
ref|XP_004304624.1|  PREDICTED: carbonic anhydrase, chloroplastic...    243   6e-76   
gb|ABK96336.1|  unknown                                                 242   7e-76   Populus trichocarpa x Populus deltoides
ref|XP_006369920.1|  hypothetical protein POPTR_0001s34950g             241   9e-76   
gb|AAY17070.1|  chloroplast carbonic anhydrase                          239   9e-76   Nicotiana benthamiana
sp|P46510.2|CAHX_FLABI  RecName: Full=Carbonic anhydrase; AltName...    244   9e-76   Flaveria bidentis
prf||2018192A  carbonic anhydrase                                       244   9e-76
ref|XP_006369918.1|  hypothetical protein POPTR_0001s34950g             241   9e-76   
ref|XP_004489275.1|  PREDICTED: carbonic anhydrase, chloroplastic...    244   1e-75   
ref|XP_009614638.1|  PREDICTED: carbonic anhydrase, chloroplastic...    244   1e-75   
gb|ABK96524.1|  unknown                                                 243   1e-75   Populus trichocarpa x Populus deltoides
gb|AFX73762.1|  carbonic anhydrase                                      243   2e-75   
gb|AFX73760.1|  carbonic anhydrase                                      243   2e-75   
gb|AFX73759.1|  carbonic anhydrase                                      243   2e-75   
ref|XP_006369916.1|  hypothetical protein POPTR_0001s34950g             243   2e-75   
gb|AAY17071.1|  chloroplast carbonic anhydrase                          237   3e-75   Nicotiana benthamiana
pdb|1EKJ|A  Chain A, The X-Ray Crystallographic Structure Of Beta...    238   5e-75   
gb|AAA33652.1|  carbonic anhydrase                                      242   5e-75   Pisum sativum [garden pea]
ref|XP_009801266.1|  PREDICTED: carbonic anhydrase, chloroplastic...    242   6e-75   
gb|AJA06259.1|  beta-type carbonic anhydrase 1-like protein             242   6e-75   
gb|AFX73761.1|  carbonic anhydrase                                      242   7e-75   
sp|P17067.1|CAHC_PEA  RecName: Full=Carbonic anhydrase, chloropla...    242   7e-75   Pisum sativum [garden pea]
gb|KHG08930.1|  Carbonic anhydrase, chloroplastic                       239   1e-74   
dbj|BAA25639.1|  NPCA1                                                  241   1e-74   Nicotiana paniculata
gb|KDO66170.1|  hypothetical protein CISIN_1g019915mg                   241   2e-74   
gb|AGS78351.1|  chloroplast beta-carbonic anhydrase                     240   2e-74   
gb|AAD27876.2|AF139464_1  carbonic anhydrase                            240   3e-74   Vigna radiata var. radiata [golden gram]
gb|KDO66166.1|  hypothetical protein CISIN_1g019915mg                   240   3e-74   
ref|XP_006399989.1|  hypothetical protein EUTSA_v10014232mg             238   3e-74   
ref|XP_006288492.1|  hypothetical protein CARUB_v10001757mg             238   3e-74   
gb|AAB65822.1|  carbonic anhydrase                                      239   6e-74   Populus tremula x Populus tremuloides
gb|KHG25181.1|  Carbonic anhydrase, chloroplastic                       239   8e-74   
gb|AAL51055.2|AF454759_1  beta-carbonic anhydrase                       239   9e-74   Nicotiana tabacum [American tobacco]
gb|AAM22683.1|AF482951_1  carbonic anhydrase                            239   1e-73   Gossypium hirsutum [American cotton]
gb|AAD29049.1|AF132854_1  carbonic anhydrase isoform 1                  238   1e-73   Gossypium hirsutum [American cotton]
gb|AAD29050.1|AF132855_1  carbonic anhydrase isoform 2                  238   1e-73   Gossypium hirsutum [American cotton]
gb|AAC49785.1|  carbonic anhydrase                                      238   2e-73   Populus tremula x Populus tremuloides
ref|XP_006399988.1|  hypothetical protein EUTSA_v10014232mg             237   2e-73   
ref|XP_006603810.1|  PREDICTED: carbonic anhydrase, chloroplastic...    238   2e-73   
gb|KHN23534.1|  Carbonic anhydrase, chloroplastic                       238   2e-73   
ref|XP_002871629.1|  hypothetical protein ARALYDRAFT_488319             235   3e-73   
emb|CCW28006.1|  carbonic anhydrase                                     238   3e-73   
ref|NP_974782.1|  carbonic anhydrase 2                                  235   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003524544.1|  PREDICTED: carbonic anhydrase, chloroplastic...    237   5e-73   
dbj|BAH20249.1|  AT5G14740                                              235   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492287.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    234   5e-73   
emb|CDX91024.1|  BnaC02g05730D                                          234   7e-73   
ref|XP_006369917.1|  hypothetical protein POPTR_0001s34950g             236   8e-73   
ref|XP_009126004.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    234   9e-73   
ref|XP_007031477.1|  Carbonic anhydrase 1 isoform 2                     236   9e-73   
emb|CDX85584.1|  BnaA02g02290D                                          234   1e-72   
ref|XP_008443519.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    236   1e-72   
ref|XP_010420125.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    233   1e-72   
ref|NP_568303.2|  carbonic anhydrase 2                                  236   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453603.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    233   2e-72   
gb|AJA06256.1|  beta-type carbonic anhydrase 1-like protein             235   3e-72   
gb|KDO66172.1|  hypothetical protein CISIN_1g019915mg                   233   7e-72   
emb|CDY37516.1|  BnaA05g33810D                                          234   1e-71   
gb|KDO66164.1|  hypothetical protein CISIN_1g019915mg                   233   1e-71   
gb|ADZ97028.1|  carbonic anhydrase 3                                    233   2e-71   
gb|KDO82423.1|  hypothetical protein CISIN_1g0235891mg                  226   2e-71   
gb|AAO17574.1|  carbonic anhydrase 3                                    229   5e-71   Flaveria bidentis
gb|ABC41658.1|  carbonic anhydrase 3                                    232   6e-71   Flaveria pringlei
ref|XP_010243030.1|  PREDICTED: carbonic anhydrase 2-like               229   7e-71   
ref|XP_010044623.1|  PREDICTED: carbonic anhydrase 2                    229   7e-71   
ref|XP_003631258.1|  PREDICTED: carbonic anhydrase 2 isoform X2         229   7e-71   
ref|XP_009774414.1|  PREDICTED: carbonic anhydrase, chloroplastic...    228   1e-70   
emb|CDP00162.1|  unnamed protein product                                228   2e-70   
ref|XP_003631257.1|  PREDICTED: carbonic anhydrase 2 isoform X1         229   2e-70   
gb|AAA50156.1|  carbonic anhydrase                                      228   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KCW56026.1|  hypothetical protein EUGRSUZ_I01790                     232   2e-70   
ref|XP_010496305.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    231   2e-70   
ref|XP_002524642.1|  carbonic anhydrase, putative                       230   2e-70   Ricinus communis
ref|XP_006438387.1|  hypothetical protein CICLE_v10032517mg             226   2e-70   
gb|KDO82415.1|  hypothetical protein CISIN_1g0235891mg                  228   2e-70   
ref|XP_006483853.1|  PREDICTED: carbonic anhydrase, chloroplastic...    228   2e-70   
gb|KDO82416.1|  hypothetical protein CISIN_1g0235891mg                  228   3e-70   
gb|AEK25173.1|  chloroplast carbonic anhydrase                          229   3e-70   
gb|KDO82422.1|  hypothetical protein CISIN_1g0235891mg                  226   3e-70   
gb|KDO82418.1|  hypothetical protein CISIN_1g0235891mg                  228   3e-70   
ref|XP_006438385.1|  hypothetical protein CICLE_v10032517mg             227   3e-70   
gb|ABC41659.1|  carbonic anhydrase 3                                    229   5e-70   Flaveria linearis
ref|NP_001031884.1|  carbonic anhydrase 2                               229   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100460.1|  Carbonic anhydrase                                 226   6e-70   
ref|NP_001233847.1|  carbonic anhydrase                                 226   1e-69   
ref|XP_007044648.1|  Carbonic anhydrase 2, CA2 isoform 2                226   1e-69   
gb|ADZ97026.1|  carbonic anhydrase 3                                    228   1e-69   
ref|XP_007044647.1|  Carbonic anhydrase 2, CA2 isoform 1                227   1e-69   
gb|ADZ97025.1|  carbonic anhydrase 3                                    228   1e-69   
ref|XP_007215654.1|  hypothetical protein PRUPE_ppa008289mg             228   2e-69   
ref|XP_009609431.1|  PREDICTED: carbonic anhydrase, chloroplastic...    223   2e-69   
emb|CDP02111.1|  unnamed protein product                                227   3e-69   
ref|XP_004297630.1|  PREDICTED: carbonic anhydrase, chloroplastic...    225   3e-69   
gb|KDO66171.1|  hypothetical protein CISIN_1g019915mg                   227   3e-69   
ref|XP_004297629.1|  PREDICTED: carbonic anhydrase, chloroplastic...    226   3e-69   
gb|ADZ97029.1|  carbonic anhydrase 3                                    224   4e-69   
gb|KCW86712.1|  hypothetical protein EUGRSUZ_B03320                     229   4e-69   
gb|KHG09974.1|  Carbonic anhydrase, chloroplastic                       225   5e-69   
ref|XP_009630802.1|  PREDICTED: carbonic anhydrase, chloroplastic...    224   5e-69   
ref|NP_001031883.1|  carbonic anhydrase 2                               226   8e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682555.1|  PREDICTED: carbonic anhydrase 2 isoform X2         224   1e-68   
ref|XP_007157458.1|  hypothetical protein PHAVU_002G071200g             223   1e-68   
ref|XP_007157457.1|  hypothetical protein PHAVU_002G071200g             223   2e-68   
ref|XP_008357741.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    225   2e-68   
gb|ABE66400.1|  carbonic anhydrase                                      219   2e-68   Striga asiatica [witchweed]
ref|XP_010682554.1|  PREDICTED: carbonic anhydrase 2 isoform X1         223   3e-68   
ref|XP_004304623.1|  PREDICTED: carbonic anhydrase, chloroplastic...    224   3e-68   
ref|XP_006378214.1|  hypothetical protein POPTR_0010s05030g             219   4e-68   
ref|XP_009334081.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    224   5e-68   
gb|KFK22712.1|  hypothetical protein AALP_AAs74477U000200               218   7e-68   
ref|XP_006585949.1|  PREDICTED: carbonic anhydrase, chloroplastic...    221   7e-68   
gb|KHN27017.1|  Carbonic anhydrase, chloroplastic                       221   7e-68   
gb|AEV42277.1|  beta carbonic anhydrase 2                               222   8e-68   
ref|XP_006574621.1|  PREDICTED: carbonic anhydrase, chloroplastic...    221   1e-67   
ref|XP_002314617.1|  hypothetical protein POPTR_0010s05080g             221   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_003519759.1|  PREDICTED: carbonic anhydrase, chloroplastic...    221   1e-67   
gb|ADZ97027.1|  carbonic anhydrase 3                                    223   1e-67   
gb|ABK94941.1|  unknown                                                 221   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002525377.1|  carbonic anhydrase, putative                       221   2e-67   Ricinus communis
gb|KHG21576.1|  Carbonic anhydrase, chloroplastic                       220   2e-67   
ref|XP_003517731.1|  PREDICTED: carbonic anhydrase, chloroplastic...    220   2e-67   
gb|ACU19610.1|  unknown                                                 220   2e-67   Glycine max [soybeans]
ref|XP_003517730.1|  PREDICTED: carbonic anhydrase, chloroplastic...    221   3e-67   
ref|XP_011009545.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    220   3e-67   
ref|XP_007223694.1|  hypothetical protein PRUPE_ppa010344mg             219   4e-67   
gb|KEH20013.1|  carbonic anhydrase family protein                       217   4e-67   
ref|XP_006844988.1|  hypothetical protein AMTR_s00058p00191040          219   4e-67   
ref|XP_006380015.1|  hypothetical protein POPTR_0008s19410g             216   5e-67   
gb|AES96187.2|  carbonic anhydrase family protein                       219   5e-67   
ref|XP_003613228.1|  Carbonic anhydrase                                 219   7e-67   
ref|XP_011009542.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    219   7e-67   
ref|XP_008801824.1|  PREDICTED: carbonic anhydrase, chloroplastic...    217   8e-67   
ref|XP_011009544.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    219   8e-67   
ref|XP_008801822.1|  PREDICTED: carbonic anhydrase 2 isoform X1         219   9e-67   
ref|XP_010551572.1|  PREDICTED: beta carbonic anhydrase 4-like          219   9e-67   
ref|XP_008340028.1|  PREDICTED: carbonic anhydrase 2-like               218   9e-67   
ref|XP_004135245.1|  PREDICTED: carbonic anhydrase, chloroplastic...    219   9e-67   
ref|XP_004155357.1|  PREDICTED: carbonic anhydrase, chloroplastic...    219   9e-67   
ref|XP_008801823.1|  PREDICTED: carbonic anhydrase, chloroplastic...    217   9e-67   
ref|XP_006357150.1|  PREDICTED: carbonic anhydrase, chloroplastic...    219   1e-66   
ref|XP_007153732.1|  hypothetical protein PHAVU_003G060400g             218   1e-66   
gb|EPS70533.1|  carbonic anhydrase                                      217   1e-66   
ref|XP_003613229.1|  Carbonic anhydrase                                 219   1e-66   
ref|XP_004135244.1|  PREDICTED: carbonic anhydrase, chloroplastic...    219   1e-66   
ref|XP_006357151.1|  PREDICTED: carbonic anhydrase, chloroplastic...    218   1e-66   
ref|XP_004155356.1|  PREDICTED: carbonic anhydrase, chloroplastic...    219   1e-66   
gb|ACU23858.1|  unknown                                                 214   1e-66   Glycine max [soybeans]
gb|KEH20012.1|  carbonic anhydrase family protein                       218   2e-66   
ref|XP_009783083.1|  PREDICTED: carbonic anhydrase, chloroplastic...    218   2e-66   
ref|XP_011034133.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    217   3e-66   
ref|XP_010530542.1|  PREDICTED: beta carbonic anhydrase 4-like          214   3e-66   
ref|XP_008389649.1|  PREDICTED: carbonic anhydrase 2 isoform X2         217   4e-66   
ref|XP_008389648.1|  PREDICTED: carbonic anhydrase 2 isoform X1         217   5e-66   
ref|XP_008221815.1|  PREDICTED: carbonic anhydrase 2-like               216   6e-66   
ref|XP_009626669.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    216   8e-66   
ref|XP_010533173.1|  PREDICTED: beta carbonic anhydrase 4-like is...    216   9e-66   
ref|XP_009626667.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    216   1e-65   
gb|AFK48090.1|  unknown                                                 215   1e-65   
ref|XP_008446208.1|  PREDICTED: carbonic anhydrase 2-like               215   2e-65   
dbj|BAA95793.1|  carbonic anhydrase                                     210   3e-65   Nicotiana tabacum [American tobacco]
ref|XP_010925558.1|  PREDICTED: carbonic anhydrase 2                    215   3e-65   
ref|XP_011086567.1|  PREDICTED: carbonic anhydrase 2-like               214   3e-65   
ref|XP_006365235.1|  PREDICTED: carbonic anhydrase, chloroplastic...    215   3e-65   
ref|XP_010533166.1|  PREDICTED: beta carbonic anhydrase 4-like is...    215   3e-65   
gb|ACJ85468.1|  unknown                                                 215   4e-65   Medicago truncatula
gb|KDP26586.1|  hypothetical protein JCGZ_17744                         214   4e-65   
ref|XP_007153731.1|  hypothetical protein PHAVU_003G060400g             214   4e-65   
ref|XP_006365234.1|  PREDICTED: carbonic anhydrase, chloroplastic...    214   5e-65   
ref|XP_008443520.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    216   6e-65   
ref|XP_004158317.1|  PREDICTED: carbonic anhydrase, chloroplastic...    216   7e-65   
ref|XP_004141091.1|  PREDICTED: carbonic anhydrase, chloroplastic...    216   8e-65   
gb|KGN59668.1|  hypothetical protein Csa_3G836520                       216   8e-65   
gb|ABC41657.1|  carbonic anhydrase 2                                    214   1e-64   Flaveria pringlei
ref|XP_009375105.1|  PREDICTED: carbonic anhydrase 2-like               215   1e-64   
gb|AGS78352.1|  cytoplasmic beta carbonic anhydrase                     213   2e-64   
ref|XP_004238665.1|  PREDICTED: carbonic anhydrase 2 isoform X2         213   2e-64   
ref|XP_004238664.1|  PREDICTED: carbonic anhydrase 2 isoform X1         213   3e-64   
dbj|BAM15482.1|  carbonic anhydrase                                     212   3e-64   
ref|XP_008341457.1|  PREDICTED: carbonic anhydrase, chloroplastic...    212   3e-64   
gb|KHN00357.1|  Carbonic anhydrase, chloroplastic                       213   3e-64   
ref|XP_008341456.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    213   1e-63   
ref|XP_008362142.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    213   1e-63   
sp|P46513.1|CAH2_FLALI  RecName: Full=Carbonic anhydrase 2; AltNa...    208   1e-63   Flaveria linearis
ref|XP_010936732.1|  PREDICTED: carbonic anhydrase, chloroplastic...    206   7e-63   
ref|XP_008806900.1|  PREDICTED: carbonic anhydrase, chloroplastic...    205   1e-62   
ref|XP_004509894.1|  PREDICTED: LOW QUALITY PROTEIN: carbonic anh...    207   1e-62   
ref|XP_009406302.1|  PREDICTED: carbonic anhydrase 2-like               208   1e-62   
gb|AAO17573.1|  carbonic anhydrase 2                                    208   2e-62   Flaveria bidentis
ref|XP_009394248.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    206   2e-62   
gb|EYU31260.1|  hypothetical protein MIMGU_mgv1a012197mg                207   2e-62   
gb|AJA06261.1|  beta-type carbonic anhydrase 4-like protein             207   2e-62   
ref|XP_008806898.1|  PREDICTED: carbonic anhydrase, chloroplastic...    205   3e-62   
gb|EYU31259.1|  hypothetical protein MIMGU_mgv1a012197mg                207   3e-62   
ref|XP_009394249.1|  PREDICTED: carbonic anhydrase, chloroplastic...    205   3e-62   
ref|XP_008806897.1|  PREDICTED: carbonic anhydrase, chloroplastic...    205   4e-62   
gb|AJA06255.1|  beta-type carbonic anhydrase 4-like protein             206   6e-62   
ref|XP_008782459.1|  PREDICTED: carbonic anhydrase 2 isoform X2         202   1e-61   
ref|XP_009363559.1|  PREDICTED: carbonic anhydrase 2                    205   1e-61   
ref|XP_009768900.1|  PREDICTED: carbonic anhydrase 2-like               204   2e-61   
ref|XP_008782456.1|  PREDICTED: carbonic anhydrase, chloroplastic...    203   2e-61   
ref|XP_008357742.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    207   2e-61   
ref|NP_849872.1|  beta carbonic anhydrase 4                             205   2e-61   
ref|XP_010415718.1|  PREDICTED: beta carbonic anhydrase 4-like is...    204   3e-61   
ref|XP_010427815.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    204   3e-61   
ref|XP_009127791.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    204   3e-61   
ref|XP_009626670.1|  PREDICTED: carbonic anhydrase 2-like               203   4e-61   
ref|XP_009334082.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    206   5e-61   
ref|XP_009396482.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    204   5e-61   
ref|XP_009396483.1|  PREDICTED: carbonic anhydrase, chloroplastic...    201   7e-61   
ref|NP_177198.1|  beta carbonic anhydrase 4                             204   8e-61   
emb|CDY57304.1|  BnaCnng31770D                                          204   1e-60   
ref|XP_009127790.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    204   1e-60   
ref|XP_010415715.1|  PREDICTED: beta carbonic anhydrase 4-like is...    203   1e-60   
ref|XP_010427814.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    203   1e-60   
ref|XP_009416559.1|  PREDICTED: carbonic anhydrase 2                    202   2e-60   
gb|AJA06258.1|  beta-type carbonic anhydrase 4-like protein             202   2e-60   
ref|XP_006357152.1|  PREDICTED: carbonic anhydrase, chloroplastic...    201   2e-60   
emb|CDY69444.1|  BnaCnng63520D                                          202   2e-60   
ref|XP_009105702.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    202   2e-60   
ref|XP_006301888.1|  hypothetical protein CARUB_v10022362mg             202   3e-60   
ref|XP_009411254.1|  PREDICTED: carbonic anhydrase 1-like isoform X1    200   3e-60   
ref|XP_009411255.1|  PREDICTED: carbonic anhydrase 1-like isoform X2    199   4e-60   
ref|XP_009105701.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    201   8e-60   
ref|XP_002888778.1|  hypothetical protein ARALYDRAFT_476161             201   8e-60   
ref|XP_006390894.1|  hypothetical protein EUTSA_v10018978mg             200   1e-59   
ref|NP_173785.1|  beta carbonic anhydrase 3                             200   1e-59   
gb|EPS62235.1|  carbonic anhydrase                                      199   2e-59   
ref|XP_009796887.1|  PREDICTED: carbonic anhydrase 2-like               198   4e-59   
ref|XP_002890592.1|  predicted protein                                  199   5e-59   
ref|XP_006390892.1|  hypothetical protein EUTSA_v10018978mg             199   7e-59   
ref|XP_011071084.1|  PREDICTED: carbonic anhydrase 2-like               199   7e-59   
ref|XP_010460149.1|  PREDICTED: beta carbonic anhydrase 3               198   9e-59   
ref|XP_010552640.1|  PREDICTED: beta carbonic anhydrase 4               197   1e-58   
gb|ABK26336.1|  unknown                                                 198   1e-58   
gb|ABK23747.1|  unknown                                                 198   1e-58   
gb|ACN39779.1|  unknown                                                 198   1e-58   
ref|XP_010663172.1|  PREDICTED: carbonic anhydrase 2-like               196   5e-58   
ref|XP_004298398.1|  PREDICTED: carbonic anhydrase, chloroplastic...    196   5e-58   
gb|AJA06254.1|  beta-type carbonic anhydrase 3-like protein             196   6e-58   
ref|XP_006416059.1|  hypothetical protein EUTSA_v10008530mg             194   3e-57   
gb|KHN26874.1|  Carbonic anhydrase, chloroplastic                       193   6e-57   
ref|XP_009103160.1|  PREDICTED: beta carbonic anhydrase 3               193   6e-57   
gb|ABK22341.1|  unknown                                                 193   1e-56   
ref|XP_009402540.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    190   2e-56   
ref|XP_010477677.1|  PREDICTED: beta carbonic anhydrase 3               191   6e-56   
emb|CDX93638.1|  BnaA06g04100D                                          189   2e-55   
emb|CDY25799.1|  BnaA07g09830D                                          189   4e-55   
emb|CDY61543.1|  BnaA09g29930D                                          188   5e-55   
ref|XP_009148004.1|  PREDICTED: beta carbonic anhydrase 3-like          188   6e-55   
emb|CDY28477.1|  BnaC07g13050D                                          187   9e-55   
ref|XP_010251259.1|  PREDICTED: carbonic anhydrase 2-like               187   2e-54   
ref|XP_009115504.1|  PREDICTED: beta carbonic anhydrase 3               187   2e-54   
gb|EYU22490.1|  hypothetical protein MIMGU_mgv1a009030mg                186   3e-54   
gb|ABR16758.1|  unknown                                                 182   3e-54   
ref|XP_009148007.1|  PREDICTED: beta carbonic anhydrase 3-like          186   3e-54   
gb|EYU22489.1|  hypothetical protein MIMGU_mgv1a009030mg                186   5e-54   
gb|AJA06260.1|  beta-type carbonic anhydrase 3-like protein             186   7e-54   
ref|XP_002282681.2|  PREDICTED: carbonic anhydrase 2-like isoform X2    185   1e-53   
ref|XP_010663174.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    185   1e-53   
ref|XP_008223297.1|  PREDICTED: carbonic anhydrase 2-like               185   1e-53   
ref|XP_006476774.1|  PREDICTED: carbonic anhydrase, chloroplastic...    184   1e-53   
gb|KDP31102.1|  hypothetical protein JCGZ_11478                         184   2e-53   
gb|KDO69671.1|  hypothetical protein CISIN_1g045791mg                   185   2e-53   
gb|EYU22488.1|  hypothetical protein MIMGU_mgv1a009030mg                187   3e-53   
ref|XP_011028567.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    184   3e-53   
ref|XP_011028568.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    183   3e-53   
ref|XP_004294571.1|  PREDICTED: carbonic anhydrase, chloroplastic...    183   4e-53   
ref|NP_001152905.1|  carbonic anhydrase isoform 1                       181   4e-53   
ref|XP_002322164.1|  carbonic anhydrase family protein                  183   8e-53   
ref|XP_002322163.1|  carbonic anhydrase family protein                  182   9e-53   
gb|AJA06257.1|  beta-type carbonic anhydrase 3-like protein             182   9e-53   
ref|XP_007208630.1|  hypothetical protein PRUPE_ppa018794mg             183   1e-52   
emb|CDY64836.1|  BnaCnng45250D                                          180   1e-52   
emb|CDY64834.1|  BnaCnng45230D                                          182   2e-52   
gb|AGT17159.1|  carbonic anhydrase                                      180   2e-52   
ref|NP_001150123.1|  carbonic anhydrase                                 180   2e-52   
ref|XP_006439813.1|  hypothetical protein CICLE_v10024575mg             181   2e-52   
gb|AGT17160.1|  carbonic anhydrase                                      179   5e-52   
ref|XP_008655227.1|  PREDICTED: uncharacterized protein LOC100382...    178   1e-51   
ref|NP_001168699.1|  uncharacterized protein LOC100382491               179   2e-51   
gb|EMT19451.1|  Carbonic anhydrase, chloroplastic                       177   2e-51   
gb|ADD65763.1|  putative carbonic anhydrase                             178   5e-51   
dbj|BAG87598.1|  unnamed protein product                                176   6e-51   
sp|P40880.1|CAHC_HORVU  RecName: Full=Carbonic anhydrase, chlorop...    179   8e-51   
ref|XP_010232070.1|  PREDICTED: carbonic anhydrase, chloroplastic...    177   1e-50   
ref|XP_002511401.1|  carbonic anhydrase, putative                       177   1e-50   
ref|XP_010232071.1|  PREDICTED: carbonic anhydrase, chloroplastic...    176   2e-50   
ref|XP_010101209.1|  Carbonic anhydrase 2                               177   2e-50   
emb|CDM83497.1|  unnamed protein product                                176   2e-50   
tpg|DAA58388.1|  TPA: putative carbonic anhydrase                       173   2e-50   
dbj|BAA31953.1|  carbonic anhydrase                                     176   3e-50   
gb|AAD56038.1|AF182806_1  carbonic anhydrase 3                          176   3e-50   
ref|NP_001043676.1|  Os01g0639900                                       176   3e-50   
gb|ACU22936.1|  unknown                                                 176   4e-50   
gb|KHN19308.1|  Carbonic anhydrase, chloroplastic                       176   5e-50   
ref|NP_001236204.1|  carbonic anhydrase                                 175   7e-50   
gb|ACD10927.1|  carbonic anhydrase                                      171   8e-50   
gb|ACN78832.2|  chloroplast beta-carbonic anhydrase precursor           174   8e-50   
emb|CDY49059.1|  BnaC05g48870D                                          178   9e-50   
ref|NP_001151431.1|  LOC100285064                                       173   1e-49   
gb|ACN26857.1|  unknown                                                 173   1e-49   
gb|ACF78806.1|  unknown                                                 174   1e-49   
ref|XP_008371811.1|  PREDICTED: carbonic anhydrase 2-like               173   4e-49   
ref|XP_007138081.1|  hypothetical protein PHAVU_009G178900g             173   4e-49   
ref|XP_009343614.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    173   5e-49   
ref|XP_009368243.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    172   7e-49   
ref|NP_001147846.1|  carbonic anhydrase                                 171   1e-48   
ref|XP_009368246.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    171   2e-48   
ref|XP_008346558.1|  PREDICTED: carbonic anhydrase 2-like               169   3e-48   
gb|AGT17161.1|  carbonic anhydrase                                      169   4e-48   
gb|ACF78735.1|  unknown                                                 174   6e-48   
ref|XP_008672557.1|  PREDICTED: uncharacterized protein LOC100275...    175   8e-48   
ref|XP_008363408.1|  PREDICTED: carbonic anhydrase 2-like               169   1e-47   
gb|AAA69027.1|  carbonic anhydrase 2                                    169   1e-47   
ref|XP_008672558.1|  PREDICTED: uncharacterized protein LOC100275...    174   1e-47   
gb|KEH35043.1|  carbonic anhydrase family protein                       167   2e-47   
ref|XP_007201386.1|  hypothetical protein PRUPE_ppa010302mg             169   2e-47   
gb|AAA69028.1|  carbonic anhydrase 1                                    167   3e-47   
ref|XP_003601277.1|  Carbonic anhydrase                                 168   3e-47   
ref|XP_007036209.1|  Carbonic anhydrase 2, CA2                          167   7e-47   
gb|EMS45825.1|  Carbonic anhydrase, chloroplastic                       166   1e-46   
dbj|BAK00501.1|  predicted protein                                      165   2e-46   
ref|XP_008243629.1|  PREDICTED: carbonic anhydrase 2-like               166   3e-46   
gb|EMT09837.1|  Carbonic anhydrase, chloroplastic                       164   3e-46   
ref|XP_003601272.1|  Carbonic anhydrase                                 166   4e-46   
ref|XP_008371810.1|  PREDICTED: carbonic anhydrase 2-like               165   4e-46   
gb|ABR13313.1|  putative carbonic anhydrase                             165   5e-46   
ref|NP_001105359.1|  carbonic anhydrase                                 172   5e-46   
ref|XP_008243631.1|  PREDICTED: carbonic anhydrase 2-like               164   8e-46   
ref|XP_003601273.1|  Carbonic anhydrase                                 166   8e-46   
ref|XP_009762381.1|  PREDICTED: carbonic anhydrase 2-like               159   2e-45   
ref|XP_004501932.1|  PREDICTED: LOW QUALITY PROTEIN: carbonic anh...    164   2e-45   
emb|CDM83499.1|  unnamed protein product                                163   2e-45   
ref|NP_001146832.1|  carbonic anhydrase                                 169   2e-45   
emb|CAD66064.1|  carbonic anhydrase                                     163   3e-45   
gb|AFK33684.1|  unknown                                                 163   4e-45   
gb|EMT01713.1|  Carbonic anhydrase, chloroplastic                       158   5e-44   
emb|CAA63712.1|  Carbonic anhydrase                                     160   5e-44   
emb|CDY47630.1|  BnaC05g18860D                                          159   7e-44   
ref|XP_007036210.1|  Carbonic anhydrase 2, CA2 isoform 1                159   1e-43   
gb|KDO66174.1|  hypothetical protein CISIN_1g019915mg                   159   2e-43   
gb|KDO66173.1|  hypothetical protein CISIN_1g019915mg                   159   2e-43   
dbj|BAH56801.1|  AT3G01500                                              159   4e-43   
ref|XP_006369919.1|  hypothetical protein POPTR_0001s34950g             157   7e-43   
dbj|BAK05734.1|  predicted protein                                      156   1e-42   
emb|CBL86547.1|  carbonic anhydrase                                     150   1e-42   
dbj|BAL46502.1|  carbonic anhydrase                                     156   1e-42   
gb|ABK26951.1|  unknown                                                 156   3e-42   
gb|ABQ41955.1|  carbonic anhydrase isoform 1                            149   7e-42   
ref|XP_002971798.1|  hypothetical protein SELMODRAFT_95906              152   1e-41   
gb|EMS66385.1|  Carbonic anhydrase, chloroplastic                       152   7e-41   
ref|NP_001078583.1|  carbonic anhydrase 2                               153   8e-41   
ref|XP_004290540.1|  PREDICTED: carbonic anhydrase 2, chloroplast...    150   2e-40   
ref|XP_003618282.1|  Carbonic anhydrase                                 150   3e-40   
ref|XP_002456033.1|  hypothetical protein SORBIDRAFT_03g029200          146   6e-40   
ref|XP_010232072.1|  PREDICTED: carbonic anhydrase, chloroplastic...    149   8e-40   
ref|XP_010492290.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    148   8e-40   
ref|XP_001760513.1|  predicted protein                                  147   2e-39   
ref|XP_006378212.1|  hypothetical protein POPTR_0010s05030g             141   2e-38   
gb|ABR17241.1|  unknown                                                 142   2e-37   
ref|XP_001766124.1|  predicted protein                                  140   3e-37   
gb|EMT25527.1|  Carbonic anhydrase, chloroplastic                       142   4e-37   
ref|XP_001758037.1|  predicted protein                                  142   4e-37   
ref|XP_008806899.1|  PREDICTED: carbonic anhydrase, chloroplastic...    139   6e-37   
ref|WP_017417249.1|  hypothetical protein                               136   7e-37   
ref|XP_002522651.1|  carbonic anhydrase, putative                       142   8e-37   
ref|XP_011087942.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    141   8e-37   
emb|CDX93637.1|  BnaA06g04110D                                          139   1e-36   
ref|XP_011087941.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    141   2e-36   
ref|XP_002967228.1|  hypothetical protein SELMODRAFT_86779              139   2e-36   
gb|ABQ41954.1|  carbonic anhydrase isoform 1                            133   6e-36   
ref|XP_002514033.1|  carbonic anhydrase, putative                       139   7e-36   
gb|KDP40984.1|  hypothetical protein JCGZ_24983                         139   1e-35   
emb|CDO97393.1|  unnamed protein product                                139   2e-35   
ref|XP_011043070.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   5e-35   
ref|XP_007042853.1|  Carbonic anhydrase isoform 3                       135   6e-35   
ref|XP_007042852.1|  Carbonic anhydrase isoform 2                       136   8e-35   
ref|XP_002964535.1|  hypothetical protein SELMODRAFT_25779              134   9e-35   
ref|XP_010530641.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   1e-34   
gb|KHG02121.1|  Carbonic anhydrase, chloroplastic                       136   1e-34   
ref|XP_007042851.1|  Carbonic anhydrase isoform 1                       136   1e-34   
ref|XP_010277474.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   1e-34   
gb|ACS68659.1|  carbonic anhydrase                                      130   1e-34   
ref|XP_010030011.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   2e-34   
ref|XP_011011416.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   2e-34   
ref|XP_011011415.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   2e-34   
ref|XP_011011414.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    136   2e-34   
ref|XP_010530643.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   2e-34   
ref|XP_006373020.1|  hypothetical protein POPTR_0017s07220g             134   2e-34   
ref|XP_010094808.1|  Carbonic anhydrase                                 135   3e-34   
ref|XP_002306538.2|  hypothetical protein POPTR_0005s17860g             136   3e-34   
gb|EYU18430.1|  hypothetical protein MIMGU_mgv1a010730mg                135   3e-34   
emb|CDX84518.1|  BnaC03g49820D                                          138   3e-34   
ref|XP_002964539.1|  hypothetical protein SELMODRAFT_81873              133   3e-34   
ref|XP_011043069.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   3e-34   
ref|XP_010277475.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   3e-34   
ref|XP_010030009.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   3e-34   
gb|KCW56946.1|  hypothetical protein EUGRSUZ_I02623                     135   3e-34   
ref|XP_006373022.1|  hypothetical protein POPTR_0017s07220g             133   5e-34   
ref|XP_010254502.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   8e-34   
ref|XP_010254501.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    135   9e-34   
ref|XP_010030010.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    134   1e-33   
emb|CAN64241.1|  hypothetical protein VITISV_005703                     131   1e-33   
ref|XP_004246441.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   1e-33   
ref|XP_010415714.1|  PREDICTED: beta carbonic anhydrase 4-like          127   1e-33   
ref|XP_002323724.2|  hypothetical protein POPTR_0017s07220g             134   1e-33   
ref|XP_010648128.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   1e-33   
ref|XP_009417610.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    133   2e-33   
gb|KHG04579.1|  Carbonic anhydrase, chloroplastic                       133   2e-33   
ref|XP_010648126.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   3e-33   
ref|XP_010648127.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   3e-33   
ref|XP_002263870.2|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   3e-33   
gb|AFK40455.1|  unknown                                                 129   3e-33   
dbj|BAD94475.1|  hypothetical protein                                   127   3e-33   
ref|XP_004246439.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   4e-33   
ref|XP_010325847.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   4e-33   
ref|XP_004246440.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   4e-33   
gb|ACU18641.1|  unknown                                                 130   4e-33   
ref|XP_004246438.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    132   4e-33   



>ref|XP_011098473.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Sesamum indicum]
Length=339

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK+KYSGVGAAIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP  GP+STDFI
Sbjct  182  IANMVPAYDKTKYSGVGAAIEYAVLHLKVKEIVVIGHSACGGIKGLMSFPFEGPSSTDFI  241

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++H D PFGDQCA CEKEAVNVSLGNLL+YPFVREGL   TLALK
Sbjct  242  EDWVKICLPAKAKVLADHADKPFGDQCAQCEKEAVNVSLGNLLSYPFVREGLVNKTLALK  301

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGLS SLSVKDVATIL WKL
Sbjct  302  GGYYDFVKGSFELWGLEFGLSPSLSVKDVATILHWKL  338



>ref|XP_010687996.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP +DK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPD GPT+TDFI
Sbjct  180  IASMVPQFDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDEGPTTTDFI  239

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVI+E   A F DQC  CEKEAVNVSLGNLLTYPFVR+GL K TL+LK
Sbjct  240  EDWVKICLPAKRKVIAESNGAAFPDQCTTCEKEAVNVSLGNLLTYPFVRDGLVKKTLSLK  299

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDF+ G+FELW LDFGLS S SVKDVA+IL WKLY
Sbjct  300  GGYYDFVNGSFELWGLDFGLSPSQSVKDVASILHWKLY  337



>ref|XP_010251258.1| PREDICTED: carbonic anhydrase 2-like isoform X4 [Nelumbo nucifera]
Length=269

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYD+++YSGVGAAIEYAVLHLKV+NIVV+GHS CGGIKGLMS PD+G TSTDFI
Sbjct  113  IANMVPAYDQTRYSGVGAAIEYAVLHLKVQNIVVVGHSCCGGIKGLMSIPDDGSTSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV +E+   PF DQC+ CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  173  EDWVKICLPAKHKVNAEYSSLPFPDQCSQCEKEAVNVSLGNLLTYPFVREGLVKKTLALK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ G FELW LDFGL+ SLSV++VA+IL WKL
Sbjct  233  GGYYDFVNGTFELWGLDFGLTPSLSVREVASILHWKL  269



>ref|XP_010251257.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Nelumbo nucifera]
Length=277

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYD+++YSGVGAAIEYAVLHLKV+NIVV+GHS CGGIKGLMS PD+G TSTDFI
Sbjct  121  IANMVPAYDQTRYSGVGAAIEYAVLHLKVQNIVVVGHSCCGGIKGLMSIPDDGSTSTDFI  180

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV +E+   PF DQC+ CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  181  EDWVKICLPAKHKVNAEYSSLPFPDQCSQCEKEAVNVSLGNLLTYPFVREGLVKKTLALK  240

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ G FELW LDFGL+ SLSV++VA+IL WKL
Sbjct  241  GGYYDFVNGTFELWGLDFGLTPSLSVREVASILHWKL  277



>ref|XP_010251255.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nelumbo nucifera]
Length=337

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYD+++YSGVGAAIEYAVLHLKV+NIVV+GHS CGGIKGLMS PD+G TSTDFI
Sbjct  181  IANMVPAYDQTRYSGVGAAIEYAVLHLKVQNIVVVGHSCCGGIKGLMSIPDDGSTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV +E+   PF DQC+ CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  241  EDWVKICLPAKHKVNAEYSSLPFPDQCSQCEKEAVNVSLGNLLTYPFVREGLVKKTLALK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ G FELW LDFGL+ SLSV++VA+IL WKL
Sbjct  301  GGYYDFVNGTFELWGLDFGLTPSLSVREVASILHWKL  337



>gb|EYU44748.1| hypothetical protein MIMGU_mgv1a009344mg [Erythranthe guttata]
Length=345

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK+KYSGVGAAIEY VLHLKV+ IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  188  IANMVPAYDKTKYSGVGAAIEYGVLHLKVQEIVVIGHSACGGIKGLMSFPFDGTTSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK K+ ++H + PFGD+C  CEKEAVNVSLGNLL+YPFVREGL   TLALK
Sbjct  248  EDWVKICLPAKAKINAQHAETPFGDKCVLCEKEAVNVSLGNLLSYPFVREGLVNKTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKG+FELW L+FGLS SLSVKDVATIL WKL
Sbjct  308  GGYYDFIKGSFELWGLEFGLSPSLSVKDVATILHWKL  344



>ref|XP_006470328.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Citrus sinensis]
Length=269

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  112  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  172  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDF+ G+FELW LDFGLS  LSVKDVATIL WKL+
Sbjct  232  GGYYDFVNGSFELWGLDFGLSPPLSVKDVATILHWKLH  269



>ref|XP_006470326.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=334

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDF+ G+FELW LDFGLS  LSVKDVATIL WKL+
Sbjct  297  GGYYDFVNGSFELWGLDFGLSPPLSVKDVATILHWKLH  334



>ref|NP_850490.1| carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AAM13886.1| putative carbonic anhydrase, chloroplast precursor [Arabidopsis 
thaliana]
 gb|AEE73676.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=270

 Score =   270 bits (691),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  174  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  234  GGYYDFVKGAFELWGLEFGLSETSSVKDVATILHWKL  270



>ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=333

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK +YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P++G  ST FI
Sbjct  176  IANMVPAYDKVRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPEDGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++HGD  FG QC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKICLPAKAKVLADHGDKEFGHQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG FELW L+FGLS  LSVKDVA+IL W+L
Sbjct  296  GGYYDFVKGGFELWGLEFGLSPPLSVKDVASILHWRL  332



>ref|XP_010660912.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic isoform X2 
[Vitis vinifera]
Length=269

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVPAYDK +YSGVG+A+EYAVLHLKVE+IVVIGHS+CGGIKGLMSFP +G +STDFI
Sbjct  113  VANMVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIKGLMSFPFDGTSSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++E GD PF +QCAYCEKEAVNVSLGNLL+YPFVREGL K TL LK
Sbjct  173  EDWVKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG FELW LDFGLS S SVKDVATIL WKL
Sbjct  233  GGYYDFVKGTFELWGLDFGLSPSFSVKDVATILHWKL  269



>ref|XP_009147437.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic [Brassica 
rapa]
Length=345

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  189  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  249  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  309  GGYYDFIKGAFELWGLEFGLSETSSVKDVATILHWKL  345



>ref|XP_006408514.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 dbj|BAJ33678.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49967.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=342

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  246  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  306  GGYYDFIKGAFELWGLEFGLSETSSVKDVATILHWKL  342



>ref|XP_002277957.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
 emb|CBI34917.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVPAYDK +YSGVG+A+EYAVLHLKVE+IVVIGHS+CGGIKGLMSFP +G +STDFI
Sbjct  179  VANMVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIKGLMSFPFDGTSSTDFI  238

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++E GD PF +QCAYCEKEAVNVSLGNLL+YPFVREGL K TL LK
Sbjct  239  EDWVKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLK  298

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG FELW LDFGLS S SVKDVATIL WKL
Sbjct  299  GGYYDFVKGTFELWGLDFGLSPSFSVKDVATILHWKL  335



>ref|XP_002882178.1| hypothetical protein ARALYDRAFT_477371 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58437.1| hypothetical protein ARALYDRAFT_477371 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  190  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  249

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  250  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  309

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  310  GGYYDFIKGAFELWGLEFGLSETSSVKDVATILHWKL  346



>ref|NP_186799.2| carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|P27140.2|BCA1_ARATH RecName: Full=Beta carbonic anhydrase 1, chloroplastic; Short=AtbCA1; 
Short=AtbetaCA1; AltName: Full=Beta carbonate dehydratase 
1; AltName: Full=Protein SALICYLIC ACID-BINDING PROTEIN 
3; Short=AtSABP3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16116.1|AF428284_1 AT3g01500/F4P13_5 [Arabidopsis thaliana]
 gb|AAL16228.1|AF428459_1 AT3g01500/F4P13_5 [Arabidopsis thaliana]
 gb|AEE73675.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=347

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  191  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  250

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  251  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  310

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  311  GGYYDFVKGAFELWGLEFGLSETSSVKDVATILHWKL  347



>ref|XP_009125017.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Brassica 
rapa]
 emb|CDY28672.1| BnaCnng05580D [Brassica napus]
Length=344

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  188  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV SE GD+ F DQC+ CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  248  EDWVKICLPAKSKVKSEVGDSAFEDQCSRCEREAVNVSLANLLTYPFVREGLVKGTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  308  GGYYDFIKGAFELWGLEFGLSETSSVKDVATILHWKL  344



>ref|XP_006446503.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59743.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66162.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66163.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=334

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDF+ G+FELW LDF LS  LSVKDVATIL WKL+
Sbjct  297  GGYYDFVNGSFELWGLDFSLSPPLSVKDVATILHWKLH  334



>ref|XP_010315870.1| PREDICTED: carbonic anhydrase isoform X1 [Solanum lycopersicum]
Length=333

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK +YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P++G  ST FI
Sbjct  176  IANMVPAYDKVRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPEDGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++HG   F  QC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKICLPAKAKVLADHGGKEFAHQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG FELW L+FGLS  LSVKDVA+IL WKL
Sbjct  296  GGYYDFVKGGFELWGLEFGLSPPLSVKDVASILHWKL  332



>ref|XP_003618283.1| Carbonic anhydrase [Medicago truncatula]
Length=185

 Score =   260 bits (665),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  29   VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGAYSTDFI  88

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVREGL   TLALK
Sbjct  89   EEWVKIGLPAKAKVKAKHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALK  148

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGLSS+ SVKDVAT+L WKL
Sbjct  149  GGYYDFVKGSFELWGLEFGLSSTFSVKDVATVLHWKL  185



>ref|XP_007151035.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23029.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
Length=341

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  185  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPYDGTYSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  245  EEWVKIGLPAKAKVKTQHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGL+SS SVKDVATIL WKL
Sbjct  305  GGYYDFVKGSFELWGLNFGLASSFSVKDVATILHWKL  341



>ref|XP_004489276.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Cicer arietinum]
Length=270

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  114  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV S+HGDAPFG+ C +CEKE+VNVSLGNLLTYPFVREGL   TLALK
Sbjct  174  EEWVKIGLPAKAKVKSQHGDAPFGELCTHCEKESVNVSLGNLLTYPFVREGLVNKTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGLS++ SVKDVATIL WKL
Sbjct  234  GGYYDFVKGSFELWGLEFGLSNTFSVKDVATILHWKL  270



>ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula]
Length=342

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  186  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGAYSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVREGL   TLALK
Sbjct  246  EEWVKIGLPAKAKVKAKHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGLSS+ SVKDVAT+L WKL
Sbjct  306  GGYYDFVKGSFELWGLEFGLSSTFSVKDVATVLHWKL  342



>prf||1707317A carbonic anhydrase
Length=254

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPD GPT+TDFI
Sbjct  109  IANMVPVFDKDKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDAGPTTTDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV++EHG+A F +QC +CEKEAVNVSLGNLLTYPFVR+GL K TLAL+
Sbjct  169  EDWVKICLPAKHKVLAEHGNATFAEQCTHCEKEAVNVSLGNLLTYPFVRDGLVKKTLALQ  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L+FGLS S SV
Sbjct  229  GGYYDFVNGSFELWGLEFGLSPSQSV  254



>ref|XP_011098474.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Sesamum indicum]
Length=327

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK+KYSGVGAAIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP  GP+STDFI
Sbjct  182  IANMVPAYDKTKYSGVGAAIEYAVLHLKVKEIVVIGHSACGGIKGLMSFPFEGPSSTDFI  241

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++H D PFGDQCA CEKEAVNVSLGNLL+YPFVREGL   TLALK
Sbjct  242  EDWVKICLPAKAKVLADHADKPFGDQCAQCEKEAVNVSLGNLLSYPFVREGLVNKTLALK  301

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLS SLSV
Sbjct  302  GGYYDFVKGSFELWGLEFGLSPSLSV  327



>ref|XP_004489274.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=344

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  188  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV S+HGDAPFG+ C +CEKE+VNVSLGNLLTYPFVREGL   TLALK
Sbjct  248  EEWVKIGLPAKAKVKSQHGDAPFGELCTHCEKESVNVSLGNLLTYPFVREGLVNKTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L+FGLS++ SVKDVATIL WKL
Sbjct  308  GGYYDFVKGSFELWGLEFGLSNTFSVKDVATILHWKL  344



>sp|P16016.2|CAHC_SPIOL RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Flags: Precursor [Spinacia oleracea]
 gb|AAA34027.1| carbonic anhydrase (EC 4.2.1.1) [Spinacia oleracea]
Length=319

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPD GPT+TDFI
Sbjct  174  IANMVPVFDKDKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDAGPTTTDFI  233

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV++EHG+A F +QC +CEKEAVNVSLGNLLTYPFVR+GL K TLAL+
Sbjct  234  EDWVKICLPAKHKVLAEHGNATFAEQCTHCEKEAVNVSLGNLLTYPFVRDGLVKKTLALQ  293

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L++GLS S SV
Sbjct  294  GGYYDFVNGSFELWGLEYGLSPSQSV  319



>ref|XP_002298524.2| carbonic anhydrase isoform 1 family protein [Populus trichocarpa]
 gb|EEE83329.2| carbonic anhydrase isoform 1 family protein [Populus trichocarpa]
Length=345

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  189  VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  249  EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L++ LS SLSVKDVATIL WKL
Sbjct  309  GGYYDFVKGSFELWGLEYSLSPSLSVKDVATILHWKL  345



>ref|XP_009801271.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=269

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  112  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVR+GL K TLALK
Sbjct  172  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVRDGLVKKTLALK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GG+YDF+ G FELW L+FGLS SLSVKDVA+IL WKL
Sbjct  232  GGHYDFVNGGFELWGLEFGLSPSLSVKDVASILHWKL  268



>ref|XP_009614639.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Nicotiana 
tomentosiformis]
Length=269

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  112  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  172  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GG+YDF+ G FELW L+FGLS SLSVKDV +IL WKL
Sbjct  232  GGHYDFVNGGFELWGLEFGLSPSLSVKDVGSILHWKL  268



>gb|AAA34026.1| carbonic anhydrase precursor [Spinacia oleracea]
Length=254

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS PD GPT+TDFI
Sbjct  109  IANMVPVFDKDKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSSPDAGPTTTDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV++EHG+A F +QC +CEKEAVNVSLGNLLTYPFVR+GL K TLAL+
Sbjct  169  EDWVKICLPAKHKVLAEHGNATFAEQCTHCEKEAVNVSLGNLLTYPFVRDGLVKKTLALQ  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L+FGLS S SV
Sbjct  229  GGYYDFVNGSFELWGLEFGLSPSQSV  254



>gb|KHG25180.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=338

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+ KY+G+G+AIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  181  VANMVPPYDQIKYAGIGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMSFPLDGNNSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL K TL +K
Sbjct  241  EDWVKIGIPAKAKVLAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVKKTLGIK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDF+KG+FELW+L F LSSSLSVKDVATIL WKLY
Sbjct  301  GGYYDFVKGSFELWSLQFQLSSSLSVKDVATILHWKLY  338



>ref|XP_009801258.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=333

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  176  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVR+GL K TLALK
Sbjct  236  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVRDGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GG+YDF+ G FELW L+FGLS SLSVKDVA+IL WKL
Sbjct  296  GGHYDFVNGGFELWGLEFGLSPSLSVKDVASILHWKL  332



>ref|XP_009614637.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=333

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  176  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GG+YDF+ G FELW L+FGLS SLSVKDV +IL WKL
Sbjct  296  GGHYDFVNGGFELWGLEFGLSPSLSVKDVGSILHWKL  332



>gb|KDP45339.1| hypothetical protein JCGZ_09588 [Jatropha curcas]
Length=336

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +D+ K++GVGAA+EYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  180  VANMVPPFDQLKHTGVGAAVEYAVLHLKVENIVVIGHSACGGIKGLMSFPFDGNKSTDFI  239

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV I LPAK KV++EHG+A F +QC +CEKEAVNVSLGNLLTYPFVR GL K TLALK
Sbjct  240  EDWVSIGLPAKAKVLAEHGNATFPEQCTHCEKEAVNVSLGNLLTYPFVRHGLVKKTLALK  299

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ G+FELW L+FGLS  LSVKDVATIL WKL
Sbjct  300  GGYYDFVSGSFELWGLEFGLSPPLSVKDVATILHWKL  336



>ref|XP_011047313.1| PREDICTED: carbonic anhydrase 2 [Populus euphratica]
Length=332

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+GVG A+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  176  VANMVPPYDQTKYAGVGPAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH ++PF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  236  EDWVKVCYPAKTKVLAEHANSPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L++ LS SLSVKDVATIL WKL
Sbjct  296  GGYYDFVKGSFELWGLEYSLSPSLSVKDVATILHWKL  332



>ref|XP_007031476.1| Carbonic anhydrase 1 isoform 1 [Theobroma cacao]
 gb|EOY02402.1| Carbonic anhydrase 1 isoform 1 [Theobroma cacao]
Length=299

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+++YSG+GAA+EYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  142  VANMVPPYDQTRYSGIGAAVEYAVLHLKVQEIVVIGHSACGGIKGLMSFPYDGTTSTDFI  201

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++E+   P G QC  CEKEAVNVSLGNLL+YPFVR GL   TLALK
Sbjct  202  EDWVKIGMPAKTKVLAENRGEPLGVQCTCCEKEAVNVSLGNLLSYPFVRTGLVNKTLALK  261

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKLY  476
            GGYYDFIKG FELW+L F LS+ LSVKDVATIL WKLY
Sbjct  262  GGYYDFIKGTFELWSLQFALSAPLSVKDVATILHWKLY  299



>ref|XP_006603811.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X4 
[Glycine max]
Length=269

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  113  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  173  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L FGL+SS SVKDVATIL WKL
Sbjct  233  GGYYDFVKGSFELWGLQFGLASSFSVKDVATILHWKL  269



>gb|AEV42276.1| chloroplast beta carbonic anhydrase 1 [Mesembryanthemum nodiflorum]
Length=325

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK K++GVG+AIEYAVLHLKV+NIVVIGHSACGGIKGLMSFPD+GPTSTDFI
Sbjct  180  IANMVPAYDKVKHTGVGSAIEYAVLHLKVQNIVVIGHSACGGIKGLMSFPDSGPTSTDFI  239

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAKHKV++E+ DA F +QC  CEKEAVNVSLGNLLTYPFVR+GL K TLALK
Sbjct  240  EDWVKIGLPAKHKVLAENADASFAEQCTTCEKEAVNVSLGNLLTYPFVRDGLVKKTLALK  299

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G FELW L+FGLS SLSV
Sbjct  300  GGYYDFVNGTFELWGLEFGLSPSLSV  325



>ref|XP_010251256.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nelumbo nucifera]
Length=326

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYD+++YSGVGAAIEYAVLHLKV+NIVV+GHS CGGIKGLMS PD+G TSTDFI
Sbjct  181  IANMVPAYDQTRYSGVGAAIEYAVLHLKVQNIVVVGHSCCGGIKGLMSIPDDGSTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAKHKV +E+   PF DQC+ CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  241  EDWVKICLPAKHKVNAEYSSLPFPDQCSQCEKEAVNVSLGNLLTYPFVREGLVKKTLALK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G FELW LDFGL+ SLSV
Sbjct  301  GGYYDFVNGTFELWGLDFGLTPSLSV  326



>ref|XP_010551901.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=341

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +D+ +++GVGAA+EYAVLHLKVENIVVIGHSACGGIKGLMSF   GP STDFI
Sbjct  185  VANIVPPFDQVRHTGVGAAVEYAVLHLKVENIVVIGHSACGGIKGLMSFTFEGPNSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++E GD+PF  QC YCEKEAVNVS+ NLLTYPFVREGL   TLALK
Sbjct  245  EDWVKIGLPAKSKVLAEQGDSPFEAQCTYCEKEAVNVSIANLLTYPFVREGLVNKTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L FGLS   SVKDVATIL WKL
Sbjct  305  GGYYDFVKGSFELWGLQFGLSPYTSVKDVATILHWKL  341



>ref|XP_006579757.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Glycine 
max]
Length=269

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  113  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKE+VNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  173  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKESVNVSLGNLLTYPFVRDGLVNKTLSLK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L FGL+SS SVKDVATIL WKL
Sbjct  233  GGYYDFVKGSFELWGLQFGLASSFSVKDVATILHWKL  269



>ref|XP_003553834.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX2 [Glycine 
max]
Length=341

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  185  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  245  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L FGL+SS SVKDVATIL WKL
Sbjct  305  GGYYDFVKGSFELWGLQFGLASSFSVKDVATILHWKL  341



>ref|XP_010435624.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic [Camelina 
sativa]
Length=345

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +D+ +++GVG+A+EYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  189  VANMVPPFDQVRHTGVGSAVEYAVLHLKVENIVVIGHSACGGIKGLMSFPFDGNNSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPA+ KV++EHGDA F  QCA CE+E+VNVSL NLLTYPFVREGL   TLALK
Sbjct  249  EDWVKIGLPARTKVLAEHGDASFEHQCAQCERESVNVSLANLLTYPFVREGLVNGTLALK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGY+DF+KGAFELW L+FG+S + SVKDVATIL WKL
Sbjct  309  GGYFDFVKGAFELWGLEFGISETSSVKDVATILHWKL  345



>ref|XP_010496563.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Camelina 
sativa]
Length=344

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +D+ +++GVG+A+EYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  188  VANMVPPFDQVRHTGVGSAVEYAVLHLKVENIVVIGHSACGGIKGLMSFPFDGNNSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPA+ KV++EHGDA F  QCA CE+E+VNVSL NLLTYPFVREGL   TLALK
Sbjct  248  EDWVKIGLPARTKVLAEHGDASFEHQCAQCERESVNVSLANLLTYPFVREGLVNGTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGY+DF+KGAFELW L+FG+S + SVKDVATIL WKL
Sbjct  308  GGYFDFVKGAFELWGLEFGISETSSVKDVATILHWKL  344



>ref|XP_006579756.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Glycine 
max]
Length=339

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  183  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKE+VNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  243  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKESVNVSLGNLLTYPFVRDGLVNKTLSLK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW L FGL+SS SVKDVATIL WKL
Sbjct  303  GGYYDFVKGSFELWGLQFGLASSFSVKDVATILHWKL  339



>gb|EYU44749.1| hypothetical protein MIMGU_mgv1a009344mg [Erythranthe guttata]
Length=333

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK+KYSGVGAAIEY VLHLKV+ IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  188  IANMVPAYDKTKYSGVGAAIEYGVLHLKVQEIVVIGHSACGGIKGLMSFPFDGTTSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK K+ ++H + PFGD+C  CEKEAVNVSLGNLL+YPFVREGL   TLALK
Sbjct  248  EDWVKICLPAKAKINAQHAETPFGDKCVLCEKEAVNVSLGNLLSYPFVREGLVNKTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKG+FELW L+FGLS SLSV
Sbjct  308  GGYYDFIKGSFELWGLEFGLSPSLSV  333



>ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Solanum tuberosum]
 dbj|BAM15483.1| carbonic anhydrase, partial [Solanum tuberosum]
Length=321

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK +YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P++G  ST FI
Sbjct  176  IANMVPAYDKVRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPEDGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++HGD  FG QC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKICLPAKAKVLADHGDKEFGHQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG FELW L+FGLS  LSV
Sbjct  296  GGYYDFVKGGFELWGLEFGLSPPLSV  321



>ref|XP_006408512.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49965.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=259

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  174  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS + SV
Sbjct  234  GGYYDFIKGAFELWGLEFGLSETSSV  259



>ref|XP_010029174.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Eucalyptus grandis]
Length=268

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV+ IVVIGHSACGGIKGLM+F  +GP STDFI
Sbjct  112  VANMVPPYDQTKYAGTGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMTFKYDGPNSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV S+   A   D C +CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  172  EDWVKICLPAKAKVNSQFNGAALPDLCGHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ GAFELW LDFGLS  LS+KDVATIL WKL
Sbjct  232  GGYYDFVNGAFELWGLDFGLSPPLSMKDVATILHWKL  268



>dbj|BAD93915.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
Length=259

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  174  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KGAFELW L+FGLS + SV
Sbjct  234  GGYYDFVKGAFELWGLEFGLSETSSV  259



>ref|XP_006470327.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Citrus sinensis]
Length=322

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDFGLS  LSV
Sbjct  297  GGYYDFVNGSFELWGLDFGLSPPLSV  322



>ref|XP_006298106.1| hypothetical protein CARUB_v10014147mg [Capsella rubella]
 gb|EOA31004.1| hypothetical protein CARUB_v10014147mg [Capsella rubella]
Length=334

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  189  IANMVPPFDKVKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  249  EDWVKICLPAKSKVISELGDSCFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KGAFELW L+FGLS + SV
Sbjct  309  GGYYDFVKGAFELWGLEFGLSETSSV  334



>gb|ADI52861.1| chloroplast beta-carbonic anhydrase [Brassica napus]
Length=331

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  246  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS + SV
Sbjct  306  GGYYDFIKGAFELWGLEFGLSETSSV  331



>ref|XP_010029173.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Eucalyptus grandis]
Length=338

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV+ IVVIGHSACGGIKGLM+F  +GP STDFI
Sbjct  182  VANMVPPYDQTKYAGTGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMTFKYDGPNSTDFI  241

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV S+   A   D C +CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  242  EDWVKICLPAKAKVNSQFNGAALPDLCGHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  301

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+ GAFELW LDFGLS  LS+KDVATIL WKL
Sbjct  302  GGYYDFVNGAFELWGLDFGLSPPLSMKDVATILHWKL  338



>ref|XP_006408513.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49966.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=331

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  246  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS + SV
Sbjct  306  GGYYDFIKGAFELWGLEFGLSETSSV  331



>ref|NP_850491.1| carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AAF01535.1|AC009325_5 carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 emb|CAA46508.1| carbonic anhydrase [Arabidopsis thaliana]
 gb|AAL07024.1| putative carbonic anhydrase, chloroplast precursor [Arabidopsis 
thaliana]
 gb|AAL32863.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 gb|AAM10220.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 dbj|BAE98589.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 gb|AEE73677.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=336

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  191  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  250

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  251  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  310

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KGAFELW L+FGLS + SV
Sbjct  311  GGYYDFVKGAFELWGLEFGLSETSSV  336



>gb|AJA06253.1| beta-type carbonic anhydrase 1-like protein [Orychophragmus violaceus]
Length=331

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  246  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS  +SV
Sbjct  306  GGYYDFIKGAFELWGLEFGLSELVSV  331



>emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera]
Length=331

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVPAYDK +YSGVG+A+EYAVLHLKVE+IVVIGHS+CGGIKGLMSFP +G +STDFI
Sbjct  186  VANMVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIKGLMSFPFDGTSSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++E GD PF +QCAYCEKEAVNVSLGNLL+YPFVREGL K TL LK
Sbjct  246  EDWVKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG FELW LDFGLS S SV
Sbjct  306  GGYYDFVKGTFELWGLDFGLSPSFSV  331



>ref|XP_010108776.1| Carbonic anhydrase [Morus notabilis]
 gb|EXC20291.1| Carbonic anhydrase [Morus notabilis]
Length=332

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV  IVVIGHSACGGIKGL+SFP +G +STDFI
Sbjct  176  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSYIVVIGHSACGGIKGLLSFPFDGTSSTDFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK+K  +   +A     CAYCEKEAVN SLGNLLTYPFVREGL   TL LK
Sbjct  236  EDWVKIALPAKNKTKAALPNADLPQLCAYCEKEAVNTSLGNLLTYPFVREGLVNKTLGLK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG+FELW LDFGLSSS SVKDVATIL WKL
Sbjct  296  GGYYDFVKGSFELWGLDFGLSSSFSVKDVATILHWKL  332



>ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum]
 emb|CAH60891.1| carbonic anhydrase [Solanum lycopersicum]
Length=321

 Score =   249 bits (636),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK +YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P++G  ST FI
Sbjct  176  IANMVPAYDKVRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPEDGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++HG   F  QC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKICLPAKAKVLADHGGKEFAHQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG FELW L+FGLS  LSV
Sbjct  296  GGYYDFVKGGFELWGLEFGLSPPLSV  321



>ref|XP_010524306.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=255

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK K+SGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  110  IANMVPPYDKVKHSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPFDGSNSTDFI  169

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV+++HG++ F  QCA+CEKEAVNVSL NLLTYPFVREGL K TLALK
Sbjct  170  EDWVKICLPAKTKVLADHGNSAFESQCAHCEKEAVNVSLANLLTYPFVREGLVKKTLALK  229

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+KG+FELW L FG S++ SV
Sbjct  230  GGHYDFVKGSFELWGLQFGPSAATSV  255



>ref|XP_006446499.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 ref|XP_006446504.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59739.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59744.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66181.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66182.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66183.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=257

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  112  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  172  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  232  GGYYDFVNGSFELWGLDFSLSPPLSV  257



>dbj|BAD94771.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
Length=143

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  12   MVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFIEDW  191
            MVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFIEDW
Sbjct  1    MVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDW  60

Query  192  VKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALKGGY  371
            VKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALKGGY
Sbjct  61   VKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALKGGY  120

Query  372  YDFIKGAFELWALDFGLSSSLSV  440
            YDF+KGAFELW L+FGLS + SV
Sbjct  121  YDFVKGAFELWGLEFGLSETSSV  143



>ref|XP_006446501.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59741.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
Length=243

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  98   VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  157

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  158  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  217

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  218  GGYYDFVNGSFELWGLDFSLSPPLSV  243



>ref|XP_006408515.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49968.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=363

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  246  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS + S+
Sbjct  306  GGYYDFIKGAFELWGLEFGLSETSSM  331



>ref|XP_007215653.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
 gb|EMJ16852.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
Length=338

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK++YSG GAA+EYAVLHLKV+ IVVIGHSACGGIKGL+S P++G TSTDFI
Sbjct  181  VANLVPPFDKTRYSGTGAAVEYAVLHLKVQYIVVIGHSACGGIKGLLSIPEDGKTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            EDWV I  PA  KV ++HG DAPF + C++CEKEAVNVS+GNLL+YPFVR+GL K TLA+
Sbjct  241  EDWVSIASPAGKKVKADHGADAPFAELCSHCEKEAVNVSIGNLLSYPFVRDGLLKKTLAI  300

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            KGGYYDF+KG FELW +DF  S SLSVK+VAT+LQWKL
Sbjct  301  KGGYYDFVKGGFELWDVDFSFSPSLSVKEVATVLQWKL  338



>ref|XP_008230600.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Prunus mume]
Length=270

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK++YSG GAA+EYAVLHLKV+ IVVIGHSACGGIKGL+S P++G TSTDFI
Sbjct  113  VANLVPPFDKTRYSGTGAAVEYAVLHLKVQYIVVIGHSACGGIKGLLSIPEDGKTSTDFI  172

Query  183  EDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            EDWV I  PA  KV  EHG DAPF + C +CEKEAVNVS+GNLL+YPFVR+GL K TLA+
Sbjct  173  EDWVSIASPAGKKVKGEHGADAPFAELCGHCEKEAVNVSIGNLLSYPFVRDGLLKKTLAI  232

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            KGGYYDF+KG FELW +DF  S SLSVK+VAT+LQWKL
Sbjct  233  KGGYYDFVKGGFELWDVDFSFSPSLSVKEVATVLQWKL  270



>ref|XP_008230599.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform X1 
[Prunus mume]
Length=338

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK++YSG GAA+EYAVLHLKV+ IVVIGHSACGGIKGL+S P++G TSTDFI
Sbjct  181  VANLVPPFDKTRYSGTGAAVEYAVLHLKVQYIVVIGHSACGGIKGLLSIPEDGKTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            EDWV I  PA  KV  EHG DAPF + C +CEKEAVNVS+GNLL+YPFVR+GL K TLA+
Sbjct  241  EDWVSIASPAGKKVKGEHGADAPFAELCGHCEKEAVNVSIGNLLSYPFVRDGLLKKTLAI  300

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            KGGYYDF+KG FELW +DF  S SLSVK+VAT+LQWKL
Sbjct  301  KGGYYDFVKGGFELWDVDFSFSPSLSVKEVATVLQWKL  338



>ref|XP_006446502.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59742.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66167.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66168.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66169.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=322

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  297  GGYYDFVNGSFELWGLDFSLSPPLSV  322



>ref|XP_006446505.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59745.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
Length=284

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  139  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  198

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  199  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  258

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  259  GGYYDFVNGSFELWGLDFSLSPPLSV  284



>gb|AAS65454.1| chloroplast carbonic anhydrase precursor [Noccaea caerulescens]
Length=336

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  191  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  250

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KVISE GD+ F DQC+ CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  251  EDWVKIGLPAKSKVISELGDSAFEDQCSRCEREAVNVSLANLLTYPFVREGLVKGTLALK  310

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGAFELW L+FGLS + SV
Sbjct  311  GGYYDFIKGAFELWGLEFGLSETSSV  336



>gb|KDO66161.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=284

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  139  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  198

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  199  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  258

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  259  GGYYDFVNGSFELWGLDFSLSPPLSV  284



>gb|ABI14813.1| chloroplast carbonic anhydrase [Pachysandra terminalis]
Length=324

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYD+ +YSGVGAAIEYAVLHLKV NIVVIGHS CGGIKGLMS  D+G TSTDFI
Sbjct  179  IANMVPAYDQIRYSGVGAAIEYAVLHLKVGNIVVIGHSCCGGIKGLMSLADDGTTSTDFI  238

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV +E G  P  +QC YCEKE+VNVSLGNLLTYPFVREGL K TLALK
Sbjct  239  EDWVKICLPAKSKVKAEFGSLPLPEQCTYCEKESVNVSLGNLLTYPFVREGLVKKTLALK  298

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDFGL  SLSV
Sbjct  299  GGYYDFVNGSFELWGLDFGLXPSLSV  324



>sp|P46512.1|CAH1_FLALI RecName: Full=Carbonic anhydrase 1; AltName: Full=Carbonate dehydratase 
1 [Flaveria linearis]
 gb|AAA86993.1| carbonic anhydrase 1 [Flaveria linearis]
Length=330

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK+KYSGVGAA+EYAVLHLKV+ I VIGHS CGGIKGLM+FPD GP STDFI
Sbjct  185  VANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+CLPAK KV++EH      DQC  CEKEAVNVSLGNLLTYPFVR+GL  NTLALK
Sbjct  245  EDWVKVCLPAKSKVVAEHNGTHLDDQCVQCEKEAVNVSLGNLLTYPFVRDGLRNNTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELWALDFGLSS  SV
Sbjct  305  GGHYDFVNGTFELWALDFGLSSPTSV  330



>gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum]
Length=264

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANM+PAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  119  IANMIPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  178

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  FGDQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  179  EDWVKIGLPAKAKVQGEHVDKCFGDQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  238

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  239  GGHYDFVNGGFELWGLEFGLSPSLSV  264



>ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES74502.1| carbonic anhydrase family protein [Medicago truncatula]
Length=260

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  115  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGAYSTDFI  174

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVREGL   TLALK
Sbjct  175  EEWVKIGLPAKAKVKAKHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALK  234

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLSS+ SV
Sbjct  235  GGYYDFVKGSFELWGLEFGLSSTFSV  260



>sp|P46511.1|CAHX_FLABR RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria brownii]
 gb|AAA86942.1| carbonic anhydrase [Flaveria brownii]
Length=330

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK+KYSGVGAA+EYAVLHLKV+ I VIGHS CGGIKGLM+FPD GP STDFI
Sbjct  185  VANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+CLPAK KV++EH      DQC  CEKEAVNVSLGNLLTYPFVR+GL  NTLALK
Sbjct  245  EDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNNTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELWALDFGLSS  SV
Sbjct  305  GGHYDFVNGTFELWALDFGLSSPTSV  330



>sp|P46281.1|CAHX_FLAPR RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria pringlei]
 gb|AAA86992.1| carbonic anhydrase [Flaveria pringlei]
Length=329

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK+KYSGVGAA+EYAVLHLKV+ I VIGHS CGGIKGLM+FPD GP STDFI
Sbjct  184  VANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+CLPAK KV++EH      DQC  CEKEAVNVSLGNLLTYPFVR+GL  NTLALK
Sbjct  244  EDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNNTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELWALDFGLSS  SV
Sbjct  304  GGHYDFVNGTFELWALDFGLSSPTSV  329



>ref|XP_007151036.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151037.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151038.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151039.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ACZ74707.1| carbonic anhydrase [Phaseolus vulgaris]
 gb|ESW23030.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23031.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23032.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23033.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
Length=330

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  185  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPYDGTYSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  245  EEWVKIGLPAKAKVKTQHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGL+SS SV
Sbjct  305  GGYYDFVKGSFELWGLNFGLASSFSV  330



>ref|XP_006369921.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66490.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=174

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  29   VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  88

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  89   EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  148

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  149  GGYYDFVKGSFELWGLEYSLSPSLSV  174



>ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES74499.1| carbonic anhydrase family protein [Medicago truncatula]
Length=331

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  186  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGAYSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPFG+ C +CEKEAVNVSLGNLLTYPFVREGL   TLALK
Sbjct  246  EEWVKIGLPAKAKVKAKHGDAPFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLSS+ SV
Sbjct  306  GGYYDFVKGSFELWGLEFGLSSTFSV  331



>ref|XP_004304624.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK KY+G G+AIEYAVLHLKV  IVVIGHSACGGIKGL+SFPD+GPTSTDFI
Sbjct  112  VANMVPPYDKVKYAGTGSAIEYAVLHLKVSYIVVIGHSACGGIKGLLSFPDDGPTSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI   AK KV + H  A F + C +CEKEAVNVS+GNLL+YPFVR+GL   TL LK
Sbjct  172  EDWVKIGRAAKTKVKALHEGASFPELCTHCEKEAVNVSIGNLLSYPFVRDGLVNKTLGLK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDF+KG FELW +DFGLS   SVKDVAT+L WKL
Sbjct  232  GGYYDFVKGNFELWDVDFGLSPDFSVKDVATVLHWKL  268



>gb|ABK96336.1| unknown [Populus trichocarpa x Populus deltoides]
Length=258

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+GVGAAIEYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  113  VANMVPPYDQTKYAGVGAAIEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  173  EDWVKVCFPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  233  GGYYDFVKGSFELWGLEYSLSPSLSV  258



>ref|XP_006369920.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66489.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=246

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  101  VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  160

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  161  EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  220

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  221  GGYYDFVKGSFELWGLEYSLSPSLSV  246



>gb|AAY17070.1| chloroplast carbonic anhydrase [Nicotiana benthamiana]
Length=177

 Score =   239 bits (609),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  32   IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  91

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  +H D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  92   EDWVKIGLPAKAKVQGDHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  151

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  152  GGHYDFVNGGFELWGLEFGLSPSLSV  177



>sp|P46510.2|CAHX_FLABI RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria bidentis]
 gb|AAA86939.2| carbonic anhydrase [Flaveria bidentis]
Length=330

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK+KYSGVGAA+EYAVLHLKV+ I VIGHS CGGIKGLM+FPD GP STDFI
Sbjct  185  VANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+CLPAK KV++EH      DQC  CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  245  EDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNKTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELWALDFGLSS  SV
Sbjct  305  GGHYDFVNGTFELWALDFGLSSPTSV  330



>prf||2018192A carbonic anhydrase
Length=331

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK+KYSGVGAA+EYAVLHLKV+ I VIGHS CGGIKGLM+FPD GP STDFI
Sbjct  186  VANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+CLPAK KV++EH      DQC  CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  246  EDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNKTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELWALDFGLSS  SV
Sbjct  306  GGHYDFVNGTFELWALDFGLSSPTSV  331



>ref|XP_006369918.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66487.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=258

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  113  VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  173  EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  233  GGYYDFVKGSFELWGLEYSLSPSLSV  258



>ref|XP_004489275.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=333

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  188  VANMVPPYDQAKYAGTGSAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  247

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV S+HGDAPFG+ C +CEKE+VNVSLGNLLTYPFVREGL   TLALK
Sbjct  248  EEWVKIGLPAKAKVKSQHGDAPFGELCTHCEKESVNVSLGNLLTYPFVREGLVNKTLALK  307

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLS++ SV
Sbjct  308  GGYYDFVKGSFELWGLEFGLSNTFSV  333



>ref|XP_009614638.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
 sp|P27141.1|CAHC_TOBAC RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Flags: Precursor [Nicotiana tabacum]
 gb|AAA34065.1| chloroplast carbonic anhydrase [Nicotiana tabacum]
 prf||1909357A carbonic anhydrase
Length=321

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  176  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  236  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  296  GGHYDFVNGGFELWGLEFGLSPSLSV  321



>gb|ABK96524.1| unknown [Populus trichocarpa x Populus deltoides]
Length=321

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+GVGAAIEYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  176  VANMVPPYDQTKYAGVGAAIEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  236  EDWVKVCFPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  296  GGYYDFVKGSFELWGLEYSLSPSLSV  321



>gb|AFX73762.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFX73763.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  184  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVK+ LPAK KV ++HGDAPF + C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  244  EEWVKVGLPAKAKVKTQHGDAPFAELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L+FGL+SS SV
Sbjct  304  GGYYDFVKGSFELWSLNFGLASSFSV  329



>gb|AFX73760.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26986.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26987.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26988.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  184  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVK+ LPAK KV ++HGDAPF + C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  244  EEWVKVGLPAKAKVKTQHGDAPFAELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L+FGL+SS SV
Sbjct  304  GGYYDFVKGSFELWSLNFGLASSFSV  329



>gb|AFX73759.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  184  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVK+ LPAK KV ++HGDAPF + C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  244  EEWVKVGLPAKAKVKTQHGDAPFAELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L+FGL+SS SV
Sbjct  304  GGYYDFVKGSFELWSLNFGLASSFSV  329



>ref|XP_006369916.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66485.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=334

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  189  VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C PAK KV++EH +APF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  249  EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  309  GGYYDFVKGSFELWGLEYSLSPSLSV  334



>gb|AAY17071.1| chloroplast carbonic anhydrase [Nicotiana benthamiana]
Length=178

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENI+VIGHSACGGIKGLMS P +G  ST FI
Sbjct  33   IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIIVIGHSACGGIKGLMSLPADGSESTAFI  92

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  C KEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  93   EDWVKIGLPAKAKVQGEHVDKCFADQCTACGKEAVNVSLGNLLTYPFVREGLVKKTLALK  152

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  153  GGHYDFVNGGFELWGLEFGLSPSLSV  178



>pdb|1EKJ|A Chain A, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|B Chain B, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|C Chain C, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|D Chain D, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|E Chain E, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|F Chain F, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|G Chain G, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
 pdb|1EKJ|H Chain H, The X-Ray Crystallographic Structure Of Beta Carbonic 
Anhydrase From The C3 Dicot Pisum Sativum
Length=221

 Score =   238 bits (608),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+G GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  76   VANLVPPYDQAKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  135

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C +CEKEAVN SLGNLLTYPFVREGL   TLALK
Sbjct  136  EEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNASLGNLLTYPFVREGLVNKTLALK  195

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLSS+ SV
Sbjct  196  GGYYDFVKGSFELWGLEFGLSSTFSV  221



>gb|AAA33652.1| carbonic anhydrase [Pisum sativum]
 prf||1710354A carbonic anhydrase
Length=329

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+G GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  184  VANLVPPYDQAKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C +CEKEAVN SLGNLLTYPFVREGL   TLALK
Sbjct  244  EEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNASLGNLLTYPFVREGLVNKTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLSS+ SV
Sbjct  304  GGYYDFVKGSFELWGLEFGLSSTFSV  329



>ref|XP_009801266.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  176  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVR+GL K TLALK
Sbjct  236  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVRDGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  296  GGHYDFVNGGFELWGLEFGLSPSLSV  321



>gb|AJA06259.1| beta-type carbonic anhydrase 1-like protein [Brassica napus]
Length=334

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  189  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  249  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKGA+E   +D G+ +SLSV
Sbjct  309  GGYYDFIKGAYESLEVDIGVHTSLSV  334



>gb|AFX73761.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  184  VANIVPPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  243

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVK+ LPAK KV ++HGDAPF + C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  244  EGWVKVGLPAKAKVKTQHGDAPFAELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  303

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L+FGL+SS SV
Sbjct  304  GGYYDFVKGSFELWSLNFGLASSFSV  329



>sp|P17067.1|CAHC_PEA RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Contains: RecName: Full=Carbonic anhydrase, 
27 kDa isoform; Contains: RecName: Full=Carbonic anhydrase, 
25 kDa isoform; Flags: Precursor [Pisum sativum]
 emb|CAA36792.1| unnamed protein product [Pisum sativum]
Length=328

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+G GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  183  VANLVPPYDQAKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C +CEKEAVN SLGNLLTYPFVREGL   TLALK
Sbjct  243  EEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNASLGNLLTYPFVREGLVNKTLALK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L+FGLSS+ SV
Sbjct  303  GGYYDFVKGSFELWGLEFGLSSTFSV  328



>gb|KHG08930.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=253

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+G G+A+EYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  108  VANIVPPYDQTKYAGTGSAVEYAVLHLKVQEIVVIGHSACGGIKGLMSFPYDGTTSTDFI  167

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV +EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL + TLALK
Sbjct  168  EDWVKIGMPAKTKVQAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVRKTLALK  227

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L+F LSS LSV
Sbjct  228  GGYYDFVKGSFELWSLNFRLSSPLSV  253



>dbj|BAA25639.1| NPCA1 [Nicotiana paniculata]
Length=322

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS   +G  ST FI
Sbjct  177  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLSADGSESTAFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALK
Sbjct  237  EDWVKIGLPAKAKVEGEHADKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  297  GGHYDFVNGGFELWGLEFGLSPSLSV  322



>gb|KDO66170.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=321

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEK AVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEK-AVNVSLSNLLTYPFVREGLVNKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  296  GGYYDFVNGSFELWGLDFSLSPPLSV  321



>gb|AGS78351.1| chloroplast beta-carbonic anhydrase [Leucaena leucocephala]
Length=326

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNG--PTSTD  176
            +AN+VP YD+++Y+GVGAA+EYAVLHLKV  IVVIGHSACGGIKGLMS PDNG  PT TD
Sbjct  180  VANLVPPYDQTRYAGVGAAVEYAVLHLKVSEIVVIGHSACGGIKGLMSIPDNGAVPT-TD  238

Query  177  FIEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLA  356
            FIEDWVKI LPAK +V S HG APF + C +CEKEAVNVSLGNLLTYPFVREGL   TL+
Sbjct  239  FIEDWVKIGLPAKARVKSVHGSAPFAELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLS  298

Query  357  LKGGYYDFIKGAFELWALDFGLSSSLSV  440
            LKGGYYDF+KG+FELW L FGLSSSLSV
Sbjct  299  LKGGYYDFVKGSFELWGLQFGLSSSLSV  326



>gb|AAD27876.2|AF139464_1 carbonic anhydrase [Vigna radiata]
 gb|AFC34139.2| carbonic anhydrase [Vigna unguiculata]
Length=328

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+V  YD+SKYSG GAAIEYAVLHLKV NIVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  183  VANIVAPYDQSKYSGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C +CEKEAVNVSLGNLLTYPFVR+GL   TLALK
Sbjct  243  EEWVKIGLPAKAKVKTQHGDAPFAELCTHCEKEAVNVSLGNLLTYPFVRDGLVNKTLALK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG FELW+L+FGL+SS SV
Sbjct  303  GGYYDFVKGTFELWSLNFGLASSFSV  328



>gb|KDO66166.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=329

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLK-------VENIVVIGHSACGGIKGLMSFPDNG  161
            +AN+VP YD++KY+GVGAA+EYAVLHLK       V NIVVIGHSACGGIKGLMSF  +G
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKCRLILLQVSNIVVIGHSACGGIKGLMSFTFDG  236

Query  162  PTSTDFIEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLA  341
              STDFIEDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL 
Sbjct  237  NNSTDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLV  296

Query  342  KNTLALKGGYYDFIKGAFELWALDFGLSSSLSV  440
              TLALKGGYYDF+ G+FELW LDF LS  LSV
Sbjct  297  NKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV  329



>ref|XP_006399989.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 ref|XP_006399990.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 ref|XP_006399991.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 gb|ESQ41442.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 gb|ESQ41443.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 gb|ESQ41444.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
Length=259

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E+  + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAENESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSS  431
            GGYYDF+KGAFELW L FGLS +
Sbjct  234  GGYYDFVKGAFELWGLQFGLSPA  256



>ref|XP_006288492.1| hypothetical protein CARUB_v10001757mg [Capsella rubella]
 gb|EOA21390.1| hypothetical protein CARUB_v10001757mg [Capsella rubella]
Length=259

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSLGNLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAESEKSGFEDQCGRCEREAVNVSLGNLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ GAFELW L FG+S   S+
Sbjct  234  GGYYDFVSGAFELWELQFGISPVHSI  259



>gb|AAB65822.1| carbonic anhydrase [Populus tremula x Populus tremuloides]
Length=320

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAAIEYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  175  VANMVPPYDKTKYAGVGAAIEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  234

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C  AK K+++EH ++PF D C  CEKEAVNVSLG+LLTYPFVR+GL   TL LK
Sbjct  235  EDWVKVCYNAKTKILAEHANSPFPDMCTQCEKEAVNVSLGHLLTYPFVRDGLVNKTLGLK  294

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  295  GGYYDFVKGSFELWGLEYSLSPSLSV  320



>gb|KHG25181.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=326

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+ KY+G+G+AIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  181  VANMVPPYDQIKYAGIGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMSFPLDGNNSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL K TL +K
Sbjct  241  EDWVKIGIPAKAKVLAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVKKTLGIK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L F LSSSLSV
Sbjct  301  GGYYDFVKGSFELWSLQFQLSSSLSV  326



>gb|AAL51055.2|AF454759_1 beta-carbonic anhydrase [Nicotiana tabacum]
Length=321

 Score =   239 bits (609),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVPAYDK++YSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FI
Sbjct  176  IANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV  EH D  F DQC  CEKEAVNVSLGNLLTYPF R+GL K TLALK
Sbjct  236  EDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFGRDGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW L+FGLS SLSV
Sbjct  296  GGHYDFVNGGFELWGLEFGLSPSLSV  321



>gb|AAM22683.1|AF482951_1 carbonic anhydrase [Gossypium hirsutum]
Length=326

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+ KY+G+G+AIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  181  VANMVPPYDQIKYAGIGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMSFPFDGNNSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL K TL +K
Sbjct  241  EDWVKIGIPAKTKVLAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVKKTLGIK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L F LSSSLSV
Sbjct  301  GGYYDFVKGSFELWSLQFQLSSSLSV  326



>gb|AAD29049.1|AF132854_1 carbonic anhydrase isoform 1 [Gossypium hirsutum]
Length=322

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+ KY+G+G+AIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  177  VANMVPPYDQIKYAGIGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMSFPLDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL K TL +K
Sbjct  237  EDWVKIGIPAKAKVLAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVKKTLGIK  296

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L F LSSSLSV
Sbjct  297  GGYYDFVKGSFELWSLQFQLSSSLSV  322



>gb|AAD29050.1|AF132855_1 carbonic anhydrase isoform 2 [Gossypium hirsutum]
Length=319

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+ KY+G+G+AIEYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  174  VANMVPPYDQIKYAGIGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMSFPFDGNNSTDFI  233

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHG  P G QC +CEKEAVNVSLGNLL+YPFVR+GL K TL +K
Sbjct  234  EDWVKIGIPAKTKVLAEHGGEPLGVQCTHCEKEAVNVSLGNLLSYPFVRDGLVKKTLGIK  293

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW+L F LSSSLSV
Sbjct  294  GGYYDFVKGSFELWSLQFQLSSSLSV  319



>gb|AAC49785.1| carbonic anhydrase [Populus tremula x Populus tremuloides]
Length=320

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAAIEYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  175  VANMVPPYDKTKYAGVGAAIEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  234

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+C  AK K+++EH ++PF D C  CEKEAVNVS+G+LLTYPFVR+GL   TL LK
Sbjct  235  EDWVKVCYNAKTKILAEHANSPFPDMCTQCEKEAVNVSIGHLLTYPFVRDGLVNKTLGLK  294

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L++ LS SLSV
Sbjct  295  GGYYDFVKGSFELWGLEYSLSPSLSV  320



>ref|XP_006399988.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 gb|ESQ41441.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
Length=298

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  153  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  212

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E+  + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  213  EDWVKICLPAKSKVLAENESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  272

Query  363  GGYYDFIKGAFELWALDFGLSSS  431
            GGYYDF+KGAFELW L FGLS +
Sbjct  273  GGYYDFVKGAFELWGLQFGLSPA  295



>ref|XP_006603810.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Glycine max]
Length=330

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  185  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  244

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  245  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L FGL+SS SV
Sbjct  305  GGYYDFVKGSFELWGLQFGLASSFSV  330



>gb|KHN23534.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=331

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  186  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  246  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L FGL+SS SV
Sbjct  306  GGYYDFVKGSFELWGLQFGLASSFSV  331



>ref|XP_002871629.1| hypothetical protein ARALYDRAFT_488319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47888.1| hypothetical protein ARALYDRAFT_488319 [Arabidopsis lyrata subsp. 
lyrata]
Length=259

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  234  GGYYDFVNGSFELWELQFGISPVHSI  259



>emb|CCW28006.1| carbonic anhydrase [Petroselinum crispum]
Length=328

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK K++GVG+A+EYAVLHLKV NIVVIGHSACGGIKGLMSF   GP STDFI
Sbjct  183  VANMVPPFDKVKHTGVGSAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFEGPNSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++EHG  PFGDQC  CEKEAVNVSL NLLTYPFVR+GL   TLALK
Sbjct  243  EDWVKIGLPAKSKVLAEHGSKPFGDQCTCCEKEAVNVSLSNLLTYPFVRDGLVNKTLALK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS   SV
Sbjct  303  GGYYDFVNGSFELWGLDFSLSPPTSV  328



>ref|NP_974782.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAG40063.1|AF324712_1 AT5g14740 [Arabidopsis thaliana]
 gb|AAG41445.1|AF326863_1 putative carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAK00368.1|AF339686_1 putative carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAL16197.1|AF428428_1 AT5g14740/T9L3_40 [Arabidopsis thaliana]
 gb|AAN31799.1| putative carbonic anhydrase [Arabidopsis thaliana]
 gb|AAN31810.1| putative carbonic anhydrase [Arabidopsis thaliana]
 gb|AED92069.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=259

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  234  GGYYDFVNGSFELWELQFGISPVHSI  259



>ref|XP_003524544.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Glycine 
max]
 gb|KHN27432.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=328

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+SKY+G GAA+EYAVLHLKV  IVVIGHSACGGIKGL+SFP +G  STDFI
Sbjct  183  VANIVPPYDQSKYAGTGAAVEYAVLHLKVSEIVVIGHSACGGIKGLLSFPYDGTYSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV ++HGDAPF + C++CEKE+VNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  243  EEWVKIGLPAKAKVKTQHGDAPFAELCSHCEKESVNVSLGNLLTYPFVRDGLVNKTLSLK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+FELW L FGL+SS SV
Sbjct  303  GGYYDFVKGSFELWGLQFGLASSFSV  328



>dbj|BAH20249.1| AT5G14740 [Arabidopsis thaliana]
Length=275

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  130  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  189

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  190  EDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  249

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  250  GGYYDFVNGSFELWELQFGISPVHSI  275



>ref|XP_010492287.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
 ref|XP_010492288.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
 ref|XP_010492289.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
Length=259

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK +Y+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPFDKVQYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+AK TLALK
Sbjct  174  EDWVKICLPAKTKVLAESESSKFEDQCGRCEREAVNVSLANLLTYPFVREGVAKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ GAFELW L FG+S   S+
Sbjct  234  GGYYDFVNGAFELWGLQFGISPVQSI  259



>emb|CDX91024.1| BnaC02g05730D [Brassica napus]
Length=259

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KY+GVGAAIEYAVLHLKVENIV+IGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPYDQVKYAGVGAAIEYAVLHLKVENIVIIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAEAESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDF+KGAFELW L FGLS
Sbjct  234  GGYYDFVKGAFELWELQFGLS  254



>ref|XP_006369917.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66486.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=335

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK+KY+GVGAA+EYAVLHLKVE IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  189  VANMVPPYDKTKYAGVGAAVEYAVLHLKVEYIVVIGHSACGGIKGLMSFPYDGTTSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEK-EAVNVSLGNLLTYPFVREGLAKNTLAL  359
            EDWVK+C PAK KV++EH +APF D C  CEK  AVNVSLG+LLTYPFVR+GL   TL L
Sbjct  249  EDWVKVCYPAKTKVLAEHANAPFPDLCTQCEKASAVNVSLGHLLTYPFVRDGLVNKTLGL  308

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSV  440
            KGGYYDF+KG+FELW L++ LS SLSV
Sbjct  309  KGGYYDFVKGSFELWGLEYSLSPSLSV  335



>ref|XP_009126004.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic [Brassica 
rapa]
Length=259

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KY+GVGAAIEYAVLHLKVENIV+IGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPYDQVKYAGVGAAIEYAVLHLKVENIVIIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAEAESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDF+KGAFELW L FGLS
Sbjct  234  GGYYDFVKGAFELWELQFGLS  254



>ref|XP_007031477.1| Carbonic anhydrase 1 isoform 2 [Theobroma cacao]
 gb|EOY02403.1| Carbonic anhydrase 1 isoform 2 [Theobroma cacao]
Length=321

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD+++YSG+GAA+EYAVLHLKV+ IVVIGHSACGGIKGLMSFP +G TSTDFI
Sbjct  176  VANMVPPYDQTRYSGIGAAVEYAVLHLKVQEIVVIGHSACGGIKGLMSFPYDGTTSTDFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++E+   P G QC  CEKEAVNVSLGNLL+YPFVR GL   TLALK
Sbjct  236  EDWVKIGMPAKTKVLAENRGEPLGVQCTCCEKEAVNVSLGNLLSYPFVRTGLVNKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKG FELW+L F LS+ LSV
Sbjct  296  GGYYDFIKGTFELWSLQFALSAPLSV  321



>emb|CDX85584.1| BnaA02g02290D [Brassica napus]
Length=259

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KY+GVGAAIEYAVLHLKVENIV+IGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPYDQVKYAGVGAAIEYAVLHLKVENIVIIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAEAESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDF+KGAFELW L FGLS
Sbjct  234  GGYYDFVKGAFELWELQFGLS  254



>ref|XP_008443519.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Cucumis melo]
Length=343

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+ KYSG G+AIEYAVLHLKV+ IVVIGHSACGGIKGLM+FP +G  STDFI
Sbjct  187  VANLVPPYDQDKYSGTGSAIEYAVLHLKVQYIVVIGHSACGGIKGLMTFPYDGKYSTDFI  246

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVK+ LPAK KV S HG A  G+ C +CEKEAV VSLGNLLTYPFVR+GL   TL LK
Sbjct  247  EEWVKVGLPAKAKVNSAHGGAELGELCTHCEKEAVAVSLGNLLTYPFVRDGLVNGTLGLK  306

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GG+YDFI G FELW L+F ++  LSVKDVATIL WKL
Sbjct  307  GGHYDFINGTFELWGLEFNVTKPLSVKDVATILHWKL  343



>ref|XP_010420125.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic-like [Camelina 
sativa]
Length=259

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+AK TLALK
Sbjct  174  EDWVKICLPAKTKVLAESESSKFEDQCGRCEREAVNVSLANLLTYPFVREGVAKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ GAFELW L +G+S   S+
Sbjct  234  GGYYDFVNGAFELWGLQYGISPVHSI  259



>ref|NP_568303.2| carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|P42737.3|BCA2_ARATH RecName: Full=Beta carbonic anhydrase 2, chloroplastic; Short=AtbCA2; 
Short=AtbetaCA2; AltName: Full=Beta carbonate dehydratase 
2; Flags: Precursor [Arabidopsis thaliana]
 pir||T51419 CARBONIC ANHYDRASE 2 - Arabidopsis thaliana
 emb|CAC01873.1| CARBONIC ANHYDRASE 2 [Arabidopsis thaliana]
 gb|AED92068.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=331

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+ K TLALK
Sbjct  246  EDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  306  GGYYDFVNGSFELWELQFGISPVHSI  331



>ref|XP_010453603.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic-like [Camelina 
sativa]
Length=259

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFALDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL NLLTYPFVREG+AK TLALK
Sbjct  174  EDWVKICLPAKTKVLAESESSKFEDQCGRCEREAVNVSLANLLTYPFVREGVAKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ GAFELW L +G+S   S+
Sbjct  234  GGYYDFVNGAFELWGLQYGISPVHSI  259



>gb|AJA06256.1| beta-type carbonic anhydrase 1-like protein [Brassica juncea]
Length=337

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  191  IANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  250

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLA-KNTLAL  359
            EDWVKICLPAK KV SE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL  K TLAL
Sbjct  251  EDWVKICLPAKSKVKSEVGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVEKGTLAL  310

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSV  440
            KGGYYDFIKGAF+L  L+FG S   SV
Sbjct  311  KGGYYDFIKGAFDLSGLEFGPSEPRSV  337



>gb|KDO66172.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=285

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  33   SKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFIEDWVKICLPA  212
            +KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFIEDWVKI +PA
Sbjct  150  TKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPA  209

Query  213  KHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALKGGYYDFIKGA  392
            K KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALKGGYYDF+ G+
Sbjct  210  KSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGS  269

Query  393  FELWALDFGLSSSLSV  440
            FELW LDF LS  LSV
Sbjct  270  FELWGLDFSLSPPLSV  285



>emb|CDY37516.1| BnaA05g33810D [Brassica napus]
Length=345

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK             V  + VENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  189  IANMVPPFDKVSQLHCFFLRRCNVHRIFVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KVISE GD+ F DQC  CE+EAVNVSL NLLTYPFVREGL K TLALK
Sbjct  249  EDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            GGYYDFIKGAFELW L+FGLS + SVKDVATIL WKL
Sbjct  309  GGYYDFIKGAFELWGLEFGLSETSSVKDVATILHWKL  345



>gb|KDO66164.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66165.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=311

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI +PAK KV++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  296

Query  363  GGYYDFIKGAFELW  404
            GGYYDF+ G+FELW
Sbjct  297  GGYYDFVNGSFELW  310



>gb|ADZ97028.1| carbonic anhydrase 3 [Flaveria cronquistii]
Length=327

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  182  VANMVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  241

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+ LPAK KV +EHG A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLALK
Sbjct  242  EDWVKVGLPAKSKVKAEHGSASLDDQCVSCEKEAVNVSLANLLTYPFVRNGLVNKTLALK  301

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ G FELW LDF LS   S
Sbjct  302  GAHYDFVNGTFELWGLDFSLSPPTS  326



>gb|KDO82423.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
Length=150

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  5    IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  64

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  65   EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  124

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  125  GAHYDFVNGKFELWDLDFNILPSVSV  150



>gb|AAO17574.1| carbonic anhydrase 3 [Flaveria bidentis]
Length=258

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  113  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+ LPAK KV +EHG A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLA+K
Sbjct  173  EDWVKVGLPAKSKVKAEHGSASIDDQCVSCEKEAVNVSLANLLTYPFVRNGLINKTLAIK  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ G FELWAL+F LS + S
Sbjct  233  GAHYDFVNGTFELWALEFSLSPTTS  257



>gb|ABC41658.1| carbonic anhydrase 3 [Flaveria pringlei]
Length=328

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  183  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV++ LPAK KV +EHG A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLALK
Sbjct  243  EDWVRVGLPAKSKVKAEHGSASLDDQCVSCEKEAVNVSLANLLTYPFVRNGLMNKTLALK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ GAFELW LDF LS   S
Sbjct  303  GAHYDFVNGAFELWGLDFSLSPPTS  327



>ref|XP_010243030.1| PREDICTED: carbonic anhydrase 2-like [Nelumbo nucifera]
Length=257

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KY GVGAAIEYAVLHLKV+ IVVIGHS CGGIKGLMS PD+G TSTDFI
Sbjct  112  IANMVPPYDQNKYPGVGAAIEYAVLHLKVQYIVVIGHSCCGGIKGLMSIPDDGSTSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICL A+ KV S++    F +QC  CEKEAVN+SL NLLTYPFVR+GL K TLALK
Sbjct  172  EDWVKICLAARKKVKSDNNSLSFQEQCTECEKEAVNISLKNLLTYPFVRDGLMKKTLALK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G+FELW L+F L+ SLSV
Sbjct  232  GGFYDFVNGSFELWGLNFSLTPSLSV  257



>ref|XP_010044623.1| PREDICTED: carbonic anhydrase 2 [Eucalyptus grandis]
Length=257

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAAIEYAVLHL+VENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  112  IANMVPPYDQNKYSGVGAAIEYAVLHLRVENIVVIGHSCCGGIKGLMSIPDDGATASEFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKIC PAK KV S+H    F +QC +CEKEAVNVSLGNLLTYPFVRE   K T+A+K
Sbjct  172  EHWVKICSPAKTKVKSDHSKLSFAEQCGHCEKEAVNVSLGNLLTYPFVREAAVKKTIAVK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+KG FELW LDF LS +LS
Sbjct  232  GAHYDFVKGTFELWDLDFKLSPALS  256



>ref|XP_003631258.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Vitis vinifera]
 ref|XP_010651261.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Vitis vinifera]
 ref|XP_010651265.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Vitis vinifera]
 emb|CBI28524.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPYDQTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+ICLPAK KV +E+ D  F +QC  CEKEAVNVSLGNLLTYPFVRE + K TLALK
Sbjct  171  EQWVQICLPAKSKVKTEYTDLTFAEQCTNCEKEAVNVSLGNLLTYPFVREAVVKKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSL  434
            G +YDF+ G+FELW+ +  LS  L
Sbjct  231  GAHYDFVNGSFELWSFEVNLSPPL  254



>ref|XP_009774414.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
sylvestris]
Length=256

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGA IEYAV+HLKVENI+VIGHSACGGIK LM  P++G  STDFI
Sbjct  111  IANMVPPYDKTKYSGVGAVIEYAVVHLKVENILVIGHSACGGIKALMELPEDGSESTDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++EHGD  F +Q  YCEKEAVNVSL NLLTYPFV + L   TLALK
Sbjct  171  EDWVKIGLPAKAKVLAEHGDKTFKEQVKYCEKEAVNVSLANLLTYPFVSDALVNKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDF+KG FELW L+FGLS
Sbjct  231  GGYYDFMKGRFELWGLNFGLS  251



>emb|CDP00162.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAA+EYAVLHLKVENI+VIGHS CGGIKGLMS PD+G TS+DFI
Sbjct  111  IANMVPPYDKTKYSGAGAAVEYAVLHLKVENILVIGHSCCGGIKGLMSIPDDGTTSSDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK K+ S      F +QC   EKEAVN+SLGNLLTYPFVRE +AK TLAL+
Sbjct  171  EDWVKICLPAKAKIKSTCSGLDFAEQCTNLEKEAVNISLGNLLTYPFVREAVAKKTLALR  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+KG+FELW LDF L  +L++
Sbjct  231  GGHYDFVKGSFELWDLDFNLLPALTI  256



>ref|XP_003631257.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
 ref|XP_010651253.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
Length=277

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  132  IANMVPPYDQTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  191

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+ICLPAK KV +E+ D  F +QC  CEKEAVNVSLGNLLTYPFVRE + K TLALK
Sbjct  192  EQWVQICLPAKSKVKTEYTDLTFAEQCTNCEKEAVNVSLGNLLTYPFVREAVVKKTLALK  251

Query  363  GGYYDFIKGAFELWALDFGLSSSL  434
            G +YDF+ G+FELW+ +  LS  L
Sbjct  252  GAHYDFVNGSFELWSFEVNLSPPL  275



>gb|AAA50156.1| carbonic anhydrase [Arabidopsis thaliana]
Length=259

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  114  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+EAVNVSL N  TYPFVREG+ K TLALK
Sbjct  174  EDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANRCTYPFVREGVVKGTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYY F+ G+FELW L FG+S   S+
Sbjct  234  GGYYAFVNGSFELWELQFGISPVHSI  259



>gb|KCW56026.1| hypothetical protein EUGRSUZ_I01790 [Eucalyptus grandis]
Length=379

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+G G+AIEYAVLHLKV+ IVVIGHSACGGIKGLM+F  +GP STDFI
Sbjct  234  VANMVPPYDQTKYAGTGSAIEYAVLHLKVQEIVVIGHSACGGIKGLMTFKYDGPNSTDFI  293

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV S+   A   D C +CEKEAVNVSLGNLLTYPFVR+GL   TL+LK
Sbjct  294  EDWVKICLPAKAKVNSQFNGAALPDLCGHCEKEAVNVSLGNLLTYPFVRDGLVNKTLSLK  353

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ GAFELW LDFGLS  LSV
Sbjct  354  GGYYDFVNGAFELWGLDFGLSPPLSV  379



>ref|XP_010496305.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Camelina 
sativa]
Length=332

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP +D+ +++GVG+A+EYAVLHLKVE+IVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  187  VANMVPPFDQVRHTGVGSAVEYAVLHLKVESIVVIGHSACGGIKGLMSFPFDGNNSTDFI  246

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPA+ KV++EHGDA F  QCA CE+E+VNVSL NLLTYPFVREGL   TL+LK
Sbjct  247  EDWVKIGLPARTKVLAEHGDASFEHQCAQCERESVNVSLANLLTYPFVREGLVNGTLSLK  306

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG++DF+KGAFELW L+F +S + SV
Sbjct  307  GGHFDFVKGAFELWGLEFNISETSSV  332



>ref|XP_002524642.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF37661.1| carbonic anhydrase, putative [Ricinus communis]
Length=326

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YD++KY+GVGAA+EYAVLHLKVE IVVIGHS CGGIKGLMSFP +G  STDFI
Sbjct  181  VANMVPPYDQTKYAGVGAAVEYAVLHLKVEYIVVIGHSCCGGIKGLMSFPYDGNKSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV + LPAK KVI+E G  PF DQC YCEKEAVNVSL NLLTYPFVR+ LA  TL LK
Sbjct  241  EDWVAVGLPAKSKVIAERGSVPFPDQCTYCEKEAVNVSLANLLTYPFVRDALASKTLGLK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G YYDF+ G FELW L++  + SLSV
Sbjct  301  GAYYDFVSGKFELWGLEYSFTPSLSV  326



>ref|XP_006438387.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 gb|ESR51627.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
Length=199

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  54   IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  113

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  114  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  173

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  174  GAHYDFVNGKFELWDLDFNILPSVSV  199



>gb|KDO82415.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
Length=260

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  115  IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  174

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  175  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  234

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  235  GAHYDFVNGKFELWDLDFNILPSVSV  260



>ref|XP_006483853.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=280

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  135  IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  194

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  195  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  254

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  255  GAHYDFVNGKFELWDLDFNILPSVSV  280



>gb|KDO82416.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
 gb|KDO82417.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
Length=259

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  114  IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  174  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  234  GAHYDFVNGKFELWDLDFNILPSVSV  259



>gb|AEK25173.1| chloroplast carbonic anhydrase [Dimocarpus longan]
Length=321

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+ KY+GVGAA+EYAVLHLKV+ IVVIGHSACGGIKGLMSF   G  STDFI
Sbjct  176  VANIVPPYDQIKYAGVGAAVEYAVLHLKVQEIVVIGHSACGGIKGLMSFTFEGANSTDFI  235

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK  V++EHG  PF  QC YCEK AV+VS+GNLL+YPFVR+GL K TLALK
Sbjct  236  EDWVKIGLPAKGSVLAEHGGVPFEQQCTYCEKAAVSVSIGNLLSYPFVRDGLVKKTLALK  295

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW+++FGLS  LSV
Sbjct  296  GGYYDFVNGSFELWSVEFGLSPPLSV  321



>gb|KDO82422.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
Length=209

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  64   IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  123

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  124  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  183

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  184  GAHYDFVNGKFELWDLDFNILPSVSV  209



>gb|KDO82418.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82419.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82420.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82421.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
Length=256

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  111  IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  171  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  231  GAHYDFVNGKFELWDLDFNILPSVSV  256



>ref|XP_006438385.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 ref|XP_006438386.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 ref|XP_006483854.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Citrus sinensis]
 ref|XP_006483855.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Citrus sinensis]
 gb|ESR51625.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 gb|ESR51626.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
Length=256

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PDNG T++DFI
Sbjct  111  IANMVPPYDQKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDNGTTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  E  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + KNTLALK
Sbjct  171  EEWVKICSSAKSKVKKECNDLSFEEQCKNCEKEAVNVSLGNLLTYPFVRESVVKNTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +  S+SV
Sbjct  231  GAHYDFVNGKFELWDLDFNILPSVSV  256



>gb|ABC41659.1| carbonic anhydrase 3 [Flaveria linearis]
Length=331

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  186  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV++ LPAK KV +EHG A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLALK
Sbjct  246  EDWVRVGLPAKSKVKAEHGSASIDDQCVSCEKEAVNVSLANLLTYPFVRNGLINKTLALK  305

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ G FELW LDF LS   S
Sbjct  306  GAHYDFVNGTFELWGLDFCLSPPTS  330



>ref|NP_001031884.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AED92071.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=330

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+ AVNVSL NLLTYPFVREG+ K TLALK
Sbjct  246  EDWVKICLPAKSKVLAESESSAFEDQCGRCER-AVNVSLANLLTYPFVREGVVKGTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  305  GGYYDFVNGSFELWELQFGISPVHSI  330



>ref|XP_010100460.1| Carbonic anhydrase [Morus notabilis]
 gb|EXB82594.1| Carbonic anhydrase [Morus notabilis]
Length=256

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D++KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS P++G T+++FI
Sbjct  111  IANMVPPFDQTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPEDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK+K+ SE  D  F +QC  CEKEAVNVSLGNLLTYPFVR+ L K TLALK
Sbjct  171  ENWVQICAPAKNKIKSECSDLSFTEQCTNCEKEAVNVSLGNLLTYPFVRDTLVKKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF +S S+SV
Sbjct  231  GAHYDFVDGTFELWDLDFKISGSVSV  256



>ref|NP_001233847.1| carbonic anhydrase [Solanum lycopersicum]
 emb|CAQ30514.1| carbonic anhydrase [Solanum lycopersicum]
Length=255

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK +YSG GAAIEYAVLHLKVENI+VIGHS+CGGIK LMS P++G  ST+FI
Sbjct  110  IANMVPPYDKLRYSGTGAAIEYAVLHLKVENILVIGHSSCGGIKALMSLPEDGSESTEFI  169

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV++EH +  F +QC YCEKEAVNVSL NLLTYPFVR+GL   TL+LK
Sbjct  170  ENWVKIGLPAKAKVLAEHPNISFEEQCKYCEKEAVNVSLANLLTYPFVRDGLVNKTLSLK  229

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKG F+LW L FGLS   S+
Sbjct  230  GGYYDFIKGEFKLWGLHFGLSHPCSI  255



>ref|XP_007044648.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 ref|XP_007044649.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 gb|EOY00480.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 gb|EOY00481.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
Length=257

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  112  IANMVPPYDKTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV IC PAK KV SE  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + K +L LK
Sbjct  172  EQWVSICAPAKTKVKSECNDLSFSEQCTNCEKEAVNVSLGNLLTYPFVREAVVKKSLVLK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G F+LW LDF ++ +L+V
Sbjct  232  GAHYDFVDGKFDLWNLDFNITPTLAV  257



>gb|ADZ97026.1| carbonic anhydrase 3 [Flaveria anomala]
Length=332

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  187  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  246

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV++ LPAK KV +EH  A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLALK
Sbjct  247  EDWVRVGLPAKSKVKAEHASASIDDQCVSCEKEAVNVSLANLLTYPFVRNGLINKTLALK  306

Query  363  GGYYDFIKGAFELWALDFGLS  425
            G +YDF+ GAFELW LDF LS
Sbjct  307  GAHYDFVNGAFELWGLDFNLS  327



>ref|XP_007044647.1| Carbonic anhydrase 2, CA2 isoform 1 [Theobroma cacao]
 gb|EOY00479.1| Carbonic anhydrase 2, CA2 isoform 1 [Theobroma cacao]
Length=279

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  134  IANMVPPYDKTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  193

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV IC PAK KV SE  D  F +QC  CEKEAVNVSLGNLLTYPFVRE + K +L LK
Sbjct  194  EQWVSICAPAKTKVKSECNDLSFSEQCTNCEKEAVNVSLGNLLTYPFVREAVVKKSLVLK  253

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G F+LW LDF ++ +L+V
Sbjct  254  GAHYDFVDGKFDLWNLDFNITPTLAV  279



>gb|ADZ97025.1| carbonic anhydrase 3 [Flaveria angustifolia]
Length=328

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  183  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  242

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV++ LPAK KV +EHG A   DQC  CEKEAVNV L NLLTYPFVR GL   TLALK
Sbjct  243  EDWVRVGLPAKSKVKAEHGSASLDDQCVSCEKEAVNVFLANLLTYPFVRNGLMNKTLALK  302

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ GAFELW LDF LS   S
Sbjct  303  GAHYDFVNGAFELWGLDFSLSPPTS  327



>ref|XP_007215654.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
 gb|EMJ16853.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
Length=327

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK++YSG GAA+EYAVLHLKV+ IVVIGHSACGGIKGL+S P++G TSTDFI
Sbjct  181  VANLVPPFDKTRYSGTGAAVEYAVLHLKVQYIVVIGHSACGGIKGLLSIPEDGKTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            EDWV I  PA  KV ++HG DAPF + C++CEKEAVNVS+GNLL+YPFVR+GL K TLA+
Sbjct  241  EDWVSIASPAGKKVKADHGADAPFAELCSHCEKEAVNVSIGNLLSYPFVRDGLLKKTLAI  300

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSV  440
            KGGYYDF+KG FELW +DF  S SLSV
Sbjct  301  KGGYYDFVKGGFELWDVDFSFSPSLSV  327



>ref|XP_009609431.1| PREDICTED: carbonic anhydrase, chloroplastic-like, partial [Nicotiana 
tomentosiformis]
Length=176

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGA IEYAV+HLKVENI+VIGHSACGGIK LM  P++G  STDFI
Sbjct  31   IANMVPPYDKTKYSGVGAIIEYAVVHLKVENILVIGHSACGGIKALMELPEDGSESTDFI  90

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++EHGD  F +Q   CEKEAVNVSL NLLTYPFV + L   TLALK
Sbjct  91   EDWVKIGLPAKAKVLAEHGDKTFEEQVKCCEKEAVNVSLANLLTYPFVSDALVNKTLALK  150

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDFIKG FELW L+FGLS
Sbjct  151  GGYYDFIKGRFELWGLNFGLS  171



>emb|CDP02111.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+ K+S  GAAIE+AVLHLKVENIVVIGHSACGGIKGLMS P++G TSTDFI
Sbjct  181  VANLVPPYDQLKHSEFGAAIEFAVLHLKVENIVVIGHSACGGIKGLMSIPEDGTTSTDFI  240

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPA+ KV +EHG  P  +Q    EKE VNVSLGNLLTYPFVR+GL K TLA+K
Sbjct  241  EDWVKIGLPARAKVKTEHGSKPLPEQIVLAEKETVNVSLGNLLTYPFVRDGLVKRTLAVK  300

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFI+G+FELW L+F  S S+SV
Sbjct  301  GGYYDFIQGSFELWGLEFNFSPSVSV  326



>ref|XP_004297630.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=253

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D +K+SGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  108  IANMVPPFDTTKHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  167

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK+K+ S  GD  F DQC   EKEAVNVSLGNLLTYPFVRE +  NTLALK
Sbjct  168  ENWVQICAPAKNKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLALK  227

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW LDF ++ +L++
Sbjct  228  GGHYDFVGGGFELWDLDFNITPNLTL  253



>gb|KDO66171.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=312

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 119/146 (82%), Gaps = 10/146 (7%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD++KY+GVGAA+EYAVLHLKV NIVVIGHSACGGIKGLMSF  +G  STDFI
Sbjct  177  VANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFI  236

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV          ++EHGD PFGDQC YCEKEAVNVSL NLLTYPFVREGL   TLALK
Sbjct  237  EDWV----------LTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALK  286

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW LDF LS  LSV
Sbjct  287  GGYYDFVNGSFELWGLDFSLSPPLSV  312



>ref|XP_004297629.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D +K+SGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  130  IANMVPPFDTTKHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  189

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK+K+ S  GD  F DQC   EKEAVNVSLGNLLTYPFVRE +  NTLALK
Sbjct  190  ENWVQICAPAKNKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLALK  249

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G FELW LDF ++ +L++
Sbjct  250  GGHYDFVGGGFELWDLDFNITPNLTL  275



>gb|ADZ97029.1| carbonic anhydrase 3 [Flaveria vaginata]
Length=257

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+AIEYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  112  VANIVPPFDKLKYAGVGSAIEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVK+ LPAK KV +EH  A   DQC  CEKEAVNVSL NLLTYPFVR GL   TLA+K
Sbjct  172  EDWVKVGLPAKSKVKAEHRSASIDDQCLSCEKEAVNVSLANLLTYPFVRNGLINKTLAIK  231

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ G FELW L+F LS   S
Sbjct  232  GAHYDFVNGTFELWGLEFSLSPPTS  256



>gb|KCW86712.1| hypothetical protein EUGRSUZ_B03320 [Eucalyptus grandis]
Length=385

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAAIEYAVLHL+VENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  240  IANMVPPYDQNKYSGVGAAIEYAVLHLRVENIVVIGHSCCGGIKGLMSIPDDGATASEFI  299

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKIC PAK KV S+H    F +QC +CEKEAVNVSLGNLLTYPFVRE   K T+A+K
Sbjct  300  EHWVKICSPAKTKVKSDHSKLSFAEQCGHCEKEAVNVSLGNLLTYPFVREAAVKKTIAVK  359

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+KG FELW LDF LS +LS
Sbjct  360  GAHYDFVKGTFELWDLDFKLSPALS  384



>gb|KHG09974.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=279

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP YDK KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  134  IASMVPPYDKKKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  193

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV IC PAK KV SE  +  F +QC  CEKEAVNVSLGNLLTYPFVRE + K T+ALK
Sbjct  194  EQWVSICTPAKTKVKSEQNELSFSEQCTNCEKEAVNVSLGNLLTYPFVREAVVKKTVALK  253

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G F+LW LDF +S +L++
Sbjct  254  GAHYDFVNGKFDLWNLDFKISPTLAI  279



>ref|XP_009630802.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009630809.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009597723.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009597724.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=256

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGA IEYAV+HLKVENI+VIGHSACGGIK LM  P++G  STDFI
Sbjct  111  IANMVPPYDKTKYSGVGAIIEYAVVHLKVENILVIGHSACGGIKALMELPEDGSESTDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++EHGD  F +Q   CEKEAVNVSL NLLTYPFV + L   TLALK
Sbjct  171  EDWVKIGLPAKAKVLAEHGDKTFEEQVKCCEKEAVNVSLANLLTYPFVSDALVNKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDFIKG FELW L+FGLS
Sbjct  231  GGYYDFIKGRFELWGLNFGLS  251



>ref|NP_001031883.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AED92070.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=330

 Score =   226 bits (576),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK KY+GVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP +G  STDFI
Sbjct  186  IANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFI  245

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK KV++E   + F DQC  CE+  +NVSL NLLTYPFVREG+ K TLALK
Sbjct  246  EDWVKICLPAKSKVLAESESSAFEDQCGRCER-VLNVSLANLLTYPFVREGVVKGTLALK  304

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW L FG+S   S+
Sbjct  305  GGYYDFVNGSFELWELQFGISPVHSI  330



>ref|XP_010682555.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=266

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+K+SG GAAIEYAVL LKVENIVVIGHS CGGIKGLMS PD+G TSTDFI
Sbjct  121  IANMVPPYDKTKFSGTGAAIEYAVLFLKVENIVVIGHSCCGGIKGLMSIPDDGNTSTDFI  180

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK KV S+     F DQC  CEKEAVNVSLGNLLTYPFVRE +   TLALK
Sbjct  181  EEWVQICNPAKSKVKSDLSCGEFLDQCKNCEKEAVNVSLGNLLTYPFVREAVLNKTLALK  240

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF LS S+S+
Sbjct  241  GAHYDFVKGCFELWDLDFTLSPSISL  266



>ref|XP_007157458.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
 gb|ESW29452.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
Length=256

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  111  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV +E  D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  171  EQWVQICTPARSKVKAETSDLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  S+S+
Sbjct  231  GAHYDFVNGNFELWDLNFKLLPSVSL  256



>ref|XP_007157457.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
 gb|ESW29451.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
Length=278

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  133  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV +E  D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  193  EQWVQICTPARSKVKAETSDLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  S+S+
Sbjct  253  GAHYDFVNGNFELWDLNFKLLPSVSL  278



>ref|XP_008357741.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Malus domestica]
Length=334

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPT-STDF  179
            +AN+VP YDK KY+G GAAIEYAVLHLKV  IVVIGHSACGGIK L+S P++G T  TD 
Sbjct  176  VANLVPPYDKVKYAGTGAAIEYAVLHLKVSYIVVIGHSACGGIKALLSIPEDGSTLGTDV  235

Query  180  IEDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLA  356
            IEDW++I  PA  KV ++HG D PF + C+ CEKEAVNVS+GNLL+YPFVR GL K TLA
Sbjct  236  IEDWIRIXSPAAKKVKADHGPDTPFPELCSRCEKEAVNVSIGNLLSYPFVRXGLLKKTLA  295

Query  357  LKGGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            +KGGYYDFI G FELW +DF L+ + SVK+VAT+L WKL
Sbjct  296  IKGGYYDFINGHFELWDVDFSLNPNFSVKEVATVLHWKL  334



>gb|ABE66400.1| carbonic anhydrase [Striga asiatica]
Length=159

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP +D+ KYSGVGAAIEYAV+HLKVENI+VIGHS CGGIKGLMS PD+G T +DFI
Sbjct  14   IASMVPPFDRKKYSGVGAAIEYAVIHLKVENILVIGHSCCGGIKGLMSIPDDGTTQSDFI  73

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV IC  AK KV +E  +  F +QC + EKEAVNVSLGNLLTYPFVRE + K TL+LK
Sbjct  74   EEWVNICKLAKTKVKAECNNLDFSEQCTHLEKEAVNVSLGNLLTYPFVREAVVKKTLSLK  133

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+KG+FELW LDF LS S++V
Sbjct  134  GGHYDFVKGSFELWNLDFNLSPSMTV  159



>ref|XP_010682554.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=287

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+K+SG GAAIEYAVL LKVENIVVIGHS CGGIKGLMS PD+G TSTDFI
Sbjct  142  IANMVPPYDKTKFSGTGAAIEYAVLFLKVENIVVIGHSCCGGIKGLMSIPDDGNTSTDFI  201

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK KV S+     F DQC  CEKEAVNVSLGNLLTYPFVRE +   TLALK
Sbjct  202  EEWVQICNPAKSKVKSDLSCGEFLDQCKNCEKEAVNVSLGNLLTYPFVREAVLNKTLALK  261

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF LS S+S+
Sbjct  262  GAHYDFVKGCFELWDLDFTLSPSISL  287



>ref|XP_004304623.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +ANMVP YDK KY+G G+AIEYAVLHLKV  IVVIGHSACGGIKGL+SFPD+GPTSTDFI
Sbjct  179  VANMVPPYDKVKYAGTGSAIEYAVLHLKVSYIVVIGHSACGGIKGLLSFPDDGPTSTDFI  238

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI   AK KV + H  A F + C +CEKEAVNVS+GNLL+YPFVR+GL   TL LK
Sbjct  239  EDWVKIGRAAKTKVKALHEGASFPELCTHCEKEAVNVSIGNLLSYPFVRDGLVNKTLGLK  298

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG FELW +DFGLS   SV
Sbjct  299  GGYYDFVKGNFELWDVDFGLSPDFSV  324



>ref|XP_006378214.1| hypothetical protein POPTR_0010s05030g [Populus trichocarpa]
 gb|ERP56011.1| hypothetical protein POPTR_0010s05030g [Populus trichocarpa]
Length=174

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  29   IANMVPPYDKTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGSTASDFI  88

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK  V  + G   F +QC  CEKEAVNVSLGNLLTYPFVR+ +  + ++LK
Sbjct  89   ENWVKICSAAKSTVAKKAGSLTFEEQCHNCEKEAVNVSLGNLLTYPFVRDAVVNDAVSLK  148

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  149  GAHYDFVKGTFELWDLDFTISPSISV  174



>ref|XP_009334081.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Pyrus x bretschneideri]
Length=337

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPT-STDF  179
            +AN+VP YDK KY+G GAA+EYAVLHLKV  IVVIGHSACGGIK L+S P++G T  TDF
Sbjct  179  VANLVPPYDKVKYAGTGAAVEYAVLHLKVSYIVVIGHSACGGIKALLSIPEDGSTLGTDF  238

Query  180  IEDWVKICLPAKHKVISEHG-DAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLA  356
            IEDW+ I  PA  KV ++ G D+PF + C +CEKEAVNVS+GNLL+YPFVREGL K TLA
Sbjct  239  IEDWIGIGSPAAKKVKADRGADSPFPELCGHCEKEAVNVSIGNLLSYPFVREGLLKKTLA  298

Query  357  LKGGYYDFIKGAFELWALDFGLSSSLSVKDVATILQWKL  473
            +KGGYYDF+ G FELW +DF L+ + SVK+VAT+L WKL
Sbjct  299  IKGGYYDFVNGHFELWDVDFSLNPTFSVKEVATVLHWKL  337



>gb|KFK22712.1| hypothetical protein AALP_AAs74477U000200 [Arabis alpina]
Length=141

 Score =   218 bits (554),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  36   KYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFIEDWVKICLPAK  215
            KYSGVGAAIEYAVL+LKVENIVV GHSACGGIKGLMS   +G  STDFIEDWVKICLPA 
Sbjct  7    KYSGVGAAIEYAVLNLKVENIVVTGHSACGGIKGLMSSALDGNNSTDFIEDWVKICLPAN  66

Query  216  HKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALKGGYYDFIKGAF  395
             KVISE G + F DQCA CE+EAVNVSL NLLTYPFVREGL K TLALKG +YDF+KGAF
Sbjct  67   AKVISELGGSSFKDQCARCEREAVNVSLANLLTYPFVREGLVKGTLALKGSHYDFVKGAF  126

Query  396  ELWALDFGLSSSLSV  440
            ELW L+FGLS + SV
Sbjct  127  ELWGLEFGLSETSSV  141



>ref|XP_006585949.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Glycine max]
Length=259

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  114  IANMVPPYDKTKYSGTGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +E     F +QC  CEKEAVNVSLGNLLTY FVR+ + K TLALK
Sbjct  174  EHWVQICTPAKSKVKTEANTLEFSEQCTSCEKEAVNVSLGNLLTYRFVRDAVVKKTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+KG FELW LD  +S+S+SV
Sbjct  234  GAHYNFVKGTFELWDLDLKISNSVSV  259



>gb|KHN27017.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=260

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAV+HLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  114  IANMVPPYDKTKYSGTGAAIEYAVVHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLA-KNTLAL  359
            E WV+IC PAK KV +E     F +QC  CEKEAVNVSLGNLLTYPFVR+ +  K TLAL
Sbjct  174  EHWVQICTPAKSKVKTEASTLEFSEQCTNCEKEAVNVSLGNLLTYPFVRDAVVKKKTLAL  233

Query  360  KGGYYDFIKGAFELWALDFGLSSSLSV  440
            KG +Y+F+KG FELW LDF +S+S+SV
Sbjct  234  KGAHYNFVKGTFELWDLDFKISNSVSV  260



>gb|AEV42277.1| beta carbonic anhydrase 2 [Mesembryanthemum nodiflorum]
Length=287

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+K+SG GAAIEYAVLHL VENIVVIGHS CGGIKGLMS PD G TSTDFI
Sbjct  142  IANMVPPFDKTKFSGTGAAIEYAVLHLNVENIVVIGHSCCGGIKGLMSIPDCGTTSTDFI  201

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI  PA+ KV +E   A F +QC  CEKEAVNVSLGNLLTYPFVRE + K TLALK
Sbjct  202  EEWVKIAQPARTKVKAEVSSAEFTEQCKNCEKEAVNVSLGNLLTYPFVREAVMKKTLALK  261

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDFGLS   +V
Sbjct  262  GAHYDFVNGRFELWNLDFGLSPCTAV  287



>ref|XP_006574621.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Glycine max]
Length=256

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  111  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +   D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  171  EQWVQICTPAKSKVKAGKSDLSFSEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  ++SV
Sbjct  231  GAHYDFVNGNFELWDLNFKLLPTISV  256



>ref|XP_002314617.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 ref|XP_006378217.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 gb|ABK94740.1| unknown [Populus trichocarpa]
 gb|EEF00788.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 gb|ERP56014.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
Length=256

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPYDKTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGSTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK  V  + G   F +QC  CEKEAVNVSLGNLLTYPFVR+ +  + ++LK
Sbjct  171  ENWVKICSAAKSTVAKKAGSLTFEEQCHNCEKEAVNVSLGNLLTYPFVRDAVVNDAVSLK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  231  GAHYDFVKGTFELWDLDFTISPSISV  256



>ref|XP_003519759.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Glycine max]
Length=278

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  133  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +   D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  193  EQWVQICTPAKSKVKAGKSDLSFSEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  ++SV
Sbjct  253  GAHYDFVNGNFELWDLNFKLLPTISV  278



>gb|ADZ97027.1| carbonic anhydrase 3 [Flaveria brownii]
Length=334

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK KY+GVG+A+EYAVLHLKVE IVVIGHS CGGIKGLM+FPD GPTSTDFI
Sbjct  189  VANIVPPFDKLKYAGVGSAVEYAVLHLKVEQIVVIGHSKCGGIKGLMTFPDEGPTSTDFI  248

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWV++ LPAK KV +EHG A   DQC  CEKEAVNV L NLLTYPFVR GL   TL +K
Sbjct  249  EDWVRVGLPAKSKVKAEHGSASIDDQCVSCEKEAVNVFLANLLTYPFVRNGLIHKTLPIK  308

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ G FELW LDF LS   S
Sbjct  309  GAHYDFVNGTFELWGLDFCLSPPTS  333



>gb|ABK94941.1| unknown [Populus trichocarpa]
Length=256

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPYDKTKYSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGSTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK  V  + G   F +QC  CEKEAVNVSLGNLLTYPFVR+ +  + ++LK
Sbjct  171  ENWVKICSAAKSTVAKKAGSLTFEEQCHNCEKEAVNVSLGNLLTYPFVRDAVVNDAVSLK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  231  GAHYDFVKGTFELWDLDFTISPSISV  256



>ref|XP_002525377.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF37015.1| carbonic anhydrase, putative [Ricinus communis]
Length=280

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP YD++KYSG+GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  135  IASMVPPYDQTKYSGMGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  194

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK +V +E     F +QC  CEKEAVNVSLGNLLTYPFV EG+ K TLALK
Sbjct  195  ENWVKICSSAKSRVKTECNSLSFEEQCHNCEKEAVNVSLGNLLTYPFVVEGVTKKTLALK  254

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KGAFELW LDF ++ +++V
Sbjct  255  GAHYDFVKGAFELWDLDFKITPTVAV  280



>gb|KHG21576.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=254

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP YDK+KY GVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  109  IASMVPPYDKNKYCGVGAAIEYAVLHLKVENIVVIGHSNCGGIKGLMSIPDDGTTASDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV IC  AK KV SE  +  F +QC YCEKEAVNVSLGNLLTYPFVRE L K TL LK
Sbjct  169  EQWVSICGSAKTKVKSEKNEMSFAEQCTYCEKEAVNVSLGNLLTYPFVREALVKKTLVLK  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G F+LW L+F +S +L +
Sbjct  229  GAHYDFVNGKFDLWNLNFQISPTLDL  254



>ref|XP_003517731.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX2 [Glycine 
max]
Length=256

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  111  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +   D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  171  EQWVQICTPAKSKVKAGPSDLSFSEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  ++SV
Sbjct  231  GAHYDFVNGTFELWDLNFKLFPTVSV  256



>gb|ACU19610.1| unknown [Glycine max]
Length=259

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  114  IANMVPPYDKTKYSGTGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  173

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +E     F +QC  CEKEAVNVSLGNLLTY FVR+ + K TLALK
Sbjct  174  EHWVQICTPAKSKVKTEANTLEFFEQCTSCEKEAVNVSLGNLLTYRFVRDAVVKKTLALK  233

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+KG FELW LD  +S+S+SV
Sbjct  234  GAHYNFVKGTFELWDLDLKISNSVSV  259



>ref|XP_003517730.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX1 [Glycine 
max]
 ref|XP_006573037.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Glycine max]
 ref|XP_006573038.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X4 
[Glycine max]
 gb|KHN12106.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=278

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  133  IANMVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV +   D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALK
Sbjct  193  EQWVQICTPAKSKVKAGPSDLSFSEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALK  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW L+F L  ++SV
Sbjct  253  GAHYDFVNGTFELWDLNFKLFPTVSV  278



>ref|XP_011009545.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009546.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009547.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009548.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009549.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
Length=256

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVE+IVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPYDKTKYSGVGAAIEYAVLHLKVESIVVIGHSCCGGIKGLMSIPDDGSTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  +     F +QC  CEKEAVNVSLGNLLTYPFVR  +  + ++LK
Sbjct  171  ENWVKICSAAKSKVTEKSASLSFAEQCHNCEKEAVNVSLGNLLTYPFVRNAVVNDAVSLK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  231  GAHYDFVKGTFELWDLDFTISPSISV  256



>ref|XP_007223694.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 ref|XP_007223695.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 gb|EMJ24893.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 gb|EMJ24894.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
Length=253

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D  KY+GVGAAIEYAVLHLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  108  IANMVPPFDPKKYAGVGAAIEYAVLHLKVENIIVIGHSCCGGIKGLMSIPDDGTTASDFI  167

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKIC PAK+K+ + +    F +QC   EKEAVNVSLGNLLTYPFVREG+   TL+L 
Sbjct  168  EDWVKICSPAKNKIKTAYSGLTFKEQCTNLEKEAVNVSLGNLLTYPFVREGVVNKTLSLN  227

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+F+LW LDF ++  LSV
Sbjct  228  GGYYDFVNGSFQLWDLDFKITPHLSV  253



>gb|KEH20013.1| carbonic anhydrase family protein [Medicago truncatula]
Length=180

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDKSKYSG GAAIEYAV+HLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  36   IANMVPPYDKSKYSGTGAAIEYAVVHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  95

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV  E  ++ F +QC   EKEAVNVSLGNLLTYPFVR+ + K T+ALK
Sbjct  96   EQWVQICNPAKSKV-KEASNSDFSEQCTNLEKEAVNVSLGNLLTYPFVRDAVVKKTIALK  154

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ GAFELW +DF +S S+S
Sbjct  155  GAHYDFVNGAFELWDIDFKISPSVS  179



>ref|XP_006844988.1| hypothetical protein AMTR_s00058p00191040 [Amborella trichopoda]
 gb|ERN06663.1| hypothetical protein AMTR_s00058p00191040 [Amborella trichopoda]
Length=257

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD+ KY+G+GAAIEYAVLHLKVENI+V+GHS CGGIKGLMS  D+G T+TDFI
Sbjct  112  IANMVPPYDQVKYAGMGAAIEYAVLHLKVENIIVVGHSRCGGIKGLMSLNDDGSTTTDFI  171

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPAK+KV S++G  P  +QC+ CE EAVNVSLGNL+TYPFVREG+A  TLAL 
Sbjct  172  EDWVKICLPAKNKVRSQYGSLPAAEQCSKCEVEAVNVSLGNLITYPFVREGVANGTLALY  231

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYY+F+ G+F+ W +++G +
Sbjct  232  GGYYNFVDGSFQTWGVNYGFT  252



>ref|XP_006380015.1| hypothetical protein POPTR_0008s19410g [Populus trichocarpa]
 gb|ERP57812.1| hypothetical protein POPTR_0008s19410g [Populus trichocarpa]
Length=177

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSG G+AIEYAVLHLKVENIVVIGHS CGGIKGLMSFPD+G +STDFI
Sbjct  32   IANMVPPYDQTKYSGAGSAIEYAVLHLKVENIVVIGHSCCGGIKGLMSFPDDGSSSTDFI  91

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV ++     F +QC  CEKEAVNVSLGNLLTYPFVRE +    ++LK
Sbjct  92   ENWVKICSAAKTKVAAKGEGLSFEEQCHSCEKEAVNVSLGNLLTYPFVREAVVNGAVSLK  151

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+++
Sbjct  152  GAHYDFVKGTFELWDLDFAISPSIAI  177



>gb|AES96187.2| carbonic anhydrase family protein [Medicago truncatula]
Length=256

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV  E     F +QC  CEKEAVNVSLGNLLTYPFVR+G+ K +LALK
Sbjct  171  EQWVQICNPARSKVKLETSSLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVKKSLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ G FELW L+F L  S+S+
Sbjct  231  GAHYNFVNGTFELWDLNFNLLPSVSI  256



>ref|XP_003613228.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES96186.1| carbonic anhydrase family protein [Medicago truncatula]
Length=278

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  133  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV  E     F +QC  CEKEAVNVSLGNLLTYPFVR+G+ K +LALK
Sbjct  193  EQWVQICNPARSKVKLETSSLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVKKSLALK  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ G FELW L+F L  S+S+
Sbjct  253  GAHYNFVNGTFELWDLNFNLLPSVSI  278



>ref|XP_011009542.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Populus euphratica]
 ref|XP_011009543.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Populus euphratica]
Length=277

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVE+IVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  132  IANMVPPYDKTKYSGVGAAIEYAVLHLKVESIVVIGHSCCGGIKGLMSIPDDGSTASDFI  191

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  +     F +QC  CEKEAVNVSLGNLLTYPFVR  +  + ++LK
Sbjct  192  ENWVKICSAAKSKVTEKSASLSFAEQCHNCEKEAVNVSLGNLLTYPFVRNAVVNDAVSLK  251

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  252  GAHYDFVKGTFELWDLDFTISPSISV  277



>ref|XP_008801824.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Phoenix 
dactylifera]
 ref|XP_008801825.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Phoenix 
dactylifera]
 ref|XP_008801826.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=201

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KY+GVG+AIEYAV+HLKVENIVVIGHS CGGIKGLMS  D+G TST FI
Sbjct  66   IANMVPPYDQTKYAGVGSAIEYAVIHLKVENIVVIGHSRCGGIKGLMSVKDDGTTSTAFI  125

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPA+ KV ++H   PF DQC  CEKEAVNVSL NLLTYPFV+EGL K TL L 
Sbjct  126  EDWVKICLPAREKVKAQHAGLPFEDQCTQCEKEAVNVSLQNLLTYPFVKEGLEKKTLKLI  185

Query  363  GGYYDFIKGAFELW  404
            GG+YDF+KG+FE W
Sbjct  186  GGHYDFVKGSFETW  199



>ref|XP_011009544.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Populus euphratica]
Length=275

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGAAIEYAVLHLKVE+IVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  130  IANMVPPYDKTKYSGVGAAIEYAVLHLKVESIVVIGHSCCGGIKGLMSIPDDGSTASDFI  189

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV  +     F +QC  CEKEAVNVSLGNLLTYPFVR  +  + ++LK
Sbjct  190  ENWVKICSAAKSKVTEKSASLSFAEQCHNCEKEAVNVSLGNLLTYPFVRNAVVNDAVSLK  249

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+SV
Sbjct  250  GAHYDFVKGTFELWDLDFTISPSISV  275



>ref|XP_008801822.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Phoenix dactylifera]
Length=266

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KY+GVG+AIEYAV+HLKVENIVVIGHS CGGIKGLMS  D+G TST FI
Sbjct  131  IANMVPPYDQTKYAGVGSAIEYAVIHLKVENIVVIGHSRCGGIKGLMSVKDDGTTSTAFI  190

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPA+ KV ++H   PF DQC  CEKEAVNVSL NLLTYPFV+EGL K TL L 
Sbjct  191  EDWVKICLPAREKVKAQHAGLPFEDQCTQCEKEAVNVSLQNLLTYPFVKEGLEKKTLKLI  250

Query  363  GGYYDFIKGAFELW  404
            GG+YDF+KG+FE W
Sbjct  251  GGHYDFVKGSFETW  264



>ref|XP_010551572.1| PREDICTED: beta carbonic anhydrase 4-like [Tarenaya hassleriana]
Length=257

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNG-PTSTDF  179
            IANMVP +D+ ++SGVGAAIEYAV+HLKVENI+VIGHS CGGIKGLMS  D+  PT +DF
Sbjct  111  IANMVPPFDQKRHSGVGAAIEYAVIHLKVENILVIGHSCCGGIKGLMSIEDDAAPTQSDF  170

Query  180  IEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            IE+WVKIC PAK+K+  E  D  F DQC  CEKEAVNVSLGNLL+YPFVREG+ KNTL++
Sbjct  171  IENWVKICAPAKNKIKQELKDLSFDDQCTNCEKEAVNVSLGNLLSYPFVREGVVKNTLSI  230

Query  360  KGGYYDFIKGAFELWALDFGLSSSLS  437
            +G +YDF+ G FELW LDF  S S S
Sbjct  231  RGAHYDFVNGTFELWELDFKTSPSFS  256



>ref|XP_008340028.1| PREDICTED: carbonic anhydrase 2-like [Malus domestica]
Length=254

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD +KYSG+GAAIEYAVLHLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  109  IANMVPPYDLTKYSGMGAAIEYAVLHLKVENILVIGHSCCGGIKGLMSIPDDGSTASDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKIC PAK K+ + +    F +QC   EKE+VN+SLGNLLTYPFVRE +   TL+LK
Sbjct  169  ESWVKICSPAKTKIKAAYSGLSFTEQCTNLEKESVNISLGNLLTYPFVREAVVNKTLSLK  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+F+LW LDF ++ +L+V
Sbjct  229  GGYYDFVKGSFQLWDLDFKITPNLTV  254



>ref|XP_004135245.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Cucumis 
sativus]
 gb|KGN51806.1| hypothetical protein Csa_5G601560 [Cucumis sativus]
Length=258

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYA+LHLKVENIVVIGHS CGGIKGLMS PD+G  S+DFI
Sbjct  113  IANMVPPFDKTKYSGAGAAIEYAILHLKVENIVVIGHSCCGGIKGLMSIPDDGAISSDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC PAK+K  S+  D  F D+C  CEKEAVNVSLGNLL+YPFVRE +    L ++
Sbjct  173  ENWVKICTPAKNKTQSDCTDLSFEDKCTNCEKEAVNVSLGNLLSYPFVREAVVNKRLFIR  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ GAFELW LDF +S SL+V
Sbjct  233  GAHYNFVSGAFELWNLDFNISPSLAV  258



>ref|XP_004155357.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Cucumis 
sativus]
Length=258

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYA+LHLKVENIVVIGHS CGGIKGLMS PD+G  S+DFI
Sbjct  113  IANMVPPFDKTKYSGAGAAIEYAILHLKVENIVVIGHSCCGGIKGLMSIPDDGAISSDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC PAK+K  S+  D  F D+C  CEKEAVNVSLGNLL+YPFVRE +    L ++
Sbjct  173  ENWVKICTPAKNKTQSDCTDLSFEDKCTNCEKEAVNVSLGNLLSYPFVREAVVNKRLFIR  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ GAFELW LDF +S SL+V
Sbjct  233  GAHYNFVSGAFELWNLDFNISPSLAV  258



>ref|XP_008801823.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=207

 Score =   217 bits (552),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KY+GVG+AIEYAV+HLKVENIVVIGHS CGGIKGLMS  D+G TST FI
Sbjct  72   IANMVPPYDQTKYAGVGSAIEYAVIHLKVENIVVIGHSRCGGIKGLMSVKDDGTTSTAFI  131

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKICLPA+ KV ++H   PF DQC  CEKEAVNVSL NLLTYPFV+EGL K TL L 
Sbjct  132  EDWVKICLPAREKVKAQHAGLPFEDQCTQCEKEAVNVSLQNLLTYPFVKEGLEKKTLKLI  191

Query  363  GGYYDFIKGAFELW  404
            GG+YDF+KG+FE W
Sbjct  192  GGHYDFVKGSFETW  205



>ref|XP_006357150.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=269

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK +YSG GAAIEYAVL L+VENI+VIGHS CGGI  LMS P +G  ST+FI
Sbjct  124  IANMVPPYDKLRYSGTGAAIEYAVLDLQVENILVIGHSTCGGINALMSLPQDGSESTEFI  183

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV++EH +  F +QC YCEKEAVNVSL NLLTYPFVR+GL    LALK
Sbjct  184  ENWVKIGLPAKAKVLTEHPNISFEEQCKYCEKEAVNVSLANLLTYPFVRDGLVNKKLALK  243

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKG F+LW L FGLS   S+
Sbjct  244  GGYYDFIKGEFKLWGLHFGLSHPCSI  269



>ref|XP_007153732.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
 gb|ESW25726.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
Length=256

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAV HLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  111  IANMVPPYDKTKYSGTGAAIEYAVQHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC  AK KV +E     F +QC  CEKEAVNVS+GNLLTYPFVR+ +   TLALK
Sbjct  171  ENWVQICTQAKSKVKTEASALEFSEQCTNCEKEAVNVSVGNLLTYPFVRDCVVNETLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+KG FELW LDF +S+S+SV
Sbjct  231  GAHYNFVKGTFELWDLDFKISNSVSV  256



>gb|EPS70533.1| carbonic anhydrase, partial [Genlisea aurea]
Length=210

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP +DK+KYSGVGAAIEY  LHLKV  IVVIGHSACGGIKGL+SFP +G +STDFI
Sbjct  65   VANIVPPFDKTKYSGVGAAIEYGTLHLKVREIVVIGHSACGGIKGLLSFPFDGTSSTDFI  124

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV+++H  A   DQ A  E+EAVNVSL NLLTYPFVR+GL   TLALK
Sbjct  125  EEWVKIALPAKLKVLAQHAAATPADQLALAEREAVNVSLANLLTYPFVRDGLLNGTLALK  184

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+FELW+  F LS SL+V
Sbjct  185  GGYYDFVNGSFELWSAQFALSPSLAV  210



>ref|XP_003613229.1| Carbonic anhydrase [Medicago truncatula]
Length=290

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  145  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  204

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV  E     F +QC  CEKEAVNVSLGNLLTYPFVR+G+ K +LALK
Sbjct  205  EQWVQICNPARSKVKLETSSLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVKKSLALK  264

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ G FELW L+F L  S+S+
Sbjct  265  GAHYNFVNGTFELWDLNFNLLPSVSI  290



>ref|XP_004135244.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Cucumis 
sativus]
Length=278

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYA+LHLKVENIVVIGHS CGGIKGLMS PD+G  S+DFI
Sbjct  133  IANMVPPFDKTKYSGAGAAIEYAILHLKVENIVVIGHSCCGGIKGLMSIPDDGAISSDFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC PAK+K  S+  D  F D+C  CEKEAVNVSLGNLL+YPFVRE +    L ++
Sbjct  193  ENWVKICTPAKNKTQSDCTDLSFEDKCTNCEKEAVNVSLGNLLSYPFVREAVVNKRLFIR  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ GAFELW LDF +S SL+V
Sbjct  253  GAHYNFVSGAFELWNLDFNISPSLAV  278



>ref|XP_006357151.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=255

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK +YSG GAAIEYAVL L+VENI+VIGHS CGGI  LMS P +G  ST+FI
Sbjct  110  IANMVPPYDKLRYSGTGAAIEYAVLDLQVENILVIGHSTCGGINALMSLPQDGSESTEFI  169

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKI LPAK KV++EH +  F +QC YCEKEAVNVSL NLLTYPFVR+GL    LALK
Sbjct  170  ENWVKIGLPAKAKVLTEHPNISFEEQCKYCEKEAVNVSLANLLTYPFVRDGLVNKKLALK  229

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDFIKG F+LW L FGLS   S+
Sbjct  230  GGYYDFIKGEFKLWGLHFGLSHPCSI  255



>ref|XP_004155356.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Cucumis 
sativus]
Length=278

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYA+LHLKVENIVVIGHS CGGIKGLMS PD+G  S+DFI
Sbjct  133  IANMVPPFDKTKYSGAGAAIEYAILHLKVENIVVIGHSCCGGIKGLMSIPDDGAISSDFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC PAK+K  S+  D  F D+C  CEKEAVNVSLGNLL+YPFVRE +    L ++
Sbjct  193  ENWVKICTPAKNKTQSDCTDLSFEDKCTNCEKEAVNVSLGNLLSYPFVREAVVNKRLFIR  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ GAFELW LDF +S SL+V
Sbjct  253  GAHYNFVSGAFELWNLDFNISPSLAV  278



>gb|ACU23858.1| unknown [Glycine max]
Length=143

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  12   MVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFIEDW  191
            MVP YDK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G T+++FIE W
Sbjct  1    MVPPYDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFIEQW  60

Query  192  VKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALKGGY  371
            V+IC PAK KV +   D  F +QC  CEKEAVNVSLGNLLTYPFVR+G+   TLALKG +
Sbjct  61   VQICTPAKSKVKAGKSDLSFSEQCTNCEKEAVNVSLGNLLTYPFVRDGVVNKTLALKGAH  120

Query  372  YDFIKGAFELWALDFGLSSSLSV  440
            YDF+ G FELW L+F L  ++SV
Sbjct  121  YDFVNGNFELWDLNFKLLPTISV  143



>gb|KEH20012.1| carbonic anhydrase family protein [Medicago truncatula]
Length=255

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDKSKYSG GAAIEYAV+HLKVENIVVIGHS CGGIKGLMS PD+G T++DFI
Sbjct  111  IANMVPPYDKSKYSGTGAAIEYAVVHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV  E  ++ F +QC   EKEAVNVSLGNLLTYPFVR+ + K T+ALK
Sbjct  171  EQWVQICNPAKSKV-KEASNSDFSEQCTNLEKEAVNVSLGNLLTYPFVRDAVVKKTIALK  229

Query  363  GGYYDFIKGAFELWALDFGLSSSLS  437
            G +YDF+ GAFELW +DF +S S+S
Sbjct  230  GAHYDFVNGAFELWDIDFKISPSVS  254



>ref|XP_009783083.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Nicotiana 
sylvestris]
Length=256

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSGVGA IEYAVLHL +ENI+VIGHSACGGIK LM  P++G  S DFI
Sbjct  111  IANMVPPYDKTKYSGVGAIIEYAVLHLNIENILVIGHSACGGIKALMELPEDGSESNDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKI LPAK KV++EHGD  F +Q   CEKEAVNVSL NLLTYPFV + L    LALK
Sbjct  171  EDWVKIGLPAKAKVLAEHGDKTFEEQVKCCEKEAVNVSLANLLTYPFVSDALVNKNLALK  230

Query  363  GGYYDFIKGAFELWALDFGLS  425
            GGYYDFI G FELW L+FGLS
Sbjct  231  GGYYDFINGRFELWGLNFGLS  251



>ref|XP_011034133.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Populus euphratica]
Length=256

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSG G+AIEYAVLHLKVENIVVIGHS CGGIKGLMSFPD+G +STDFI
Sbjct  111  IANMVPPYDQTKYSGAGSAIEYAVLHLKVENIVVIGHSCCGGIKGLMSFPDDGSSSTDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV ++     F +QC  CEKEAVNVSLGNLLTYPFVRE +    ++LK
Sbjct  171  ENWVKICSAAKTKVAAKGEGLSFEEQCHSCEKEAVNVSLGNLLTYPFVREAVVNGAVSLK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+KG FELW LDF +S S+++
Sbjct  231  GAHYDFVKGTFELWDLDFAISPSIAI  256



>ref|XP_010530542.1| PREDICTED: beta carbonic anhydrase 4-like [Tarenaya hassleriana]
Length=175

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNG-PTSTDF  179
            IANMVP YDK ++SGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS  D+  PT +DF
Sbjct  29   IANMVPPYDKKRHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIEDDAAPTKSDF  88

Query  180  IEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            IE+WVKIC PAK+K+  E  +  F +QC  CEKEAVNVSLGNLL+YPFVREG+ KNTL++
Sbjct  89   IENWVKICAPAKNKIKQELTEMSFDEQCTNCEKEAVNVSLGNLLSYPFVREGVVKNTLSI  148

Query  360  KGGYYDFIKGAFELWALDFGLSSSLS  437
            +G +YDF+ G FELW LDF  + + +
Sbjct  149  RGAHYDFVNGTFELWELDFKTTPAFA  174



>ref|XP_008389649.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
 ref|XP_008389650.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
 ref|XP_008389651.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
Length=254

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D +KYSGVGAAIEYAVLHLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  109  IANMVPPFDLTKYSGVGAAIEYAVLHLKVENILVIGHSCCGGIKGLMSIPDDGSTASDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKIC PAK K+ +      F +QC   EKE+VNVSL NLLTYPFVRE L   TL+LK
Sbjct  169  ESWVKICAPAKTKIKAACSGLSFTEQCTNLEKESVNVSLANLLTYPFVREALVNKTLSLK  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+F+LW LDF ++ +L+V
Sbjct  229  GGYYDFVKGSFQLWDLDFKITPNLTV  254



>ref|XP_008389648.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Malus domestica]
Length=275

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D +KYSGVGAAIEYAVLHLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  130  IANMVPPFDLTKYSGVGAAIEYAVLHLKVENILVIGHSCCGGIKGLMSIPDDGSTASDFI  189

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKIC PAK K+ +      F +QC   EKE+VNVSL NLLTYPFVRE L   TL+LK
Sbjct  190  ESWVKICAPAKTKIKAACSGLSFTEQCTNLEKESVNVSLANLLTYPFVREALVNKTLSLK  249

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+KG+F+LW LDF ++ +L+V
Sbjct  250  GGYYDFVKGSFQLWDLDFKITPNLTV  275



>ref|XP_008221815.1| PREDICTED: carbonic anhydrase 2-like [Prunus mume]
Length=253

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D  KY+GVGAAIEYAVLHLKVENI+VIGHS CGGIKGLMS PD+G T+++FI
Sbjct  108  IANMVPPFDPKKYAGVGAAIEYAVLHLKVENIIVIGHSCCGGIKGLMSIPDDGTTASEFI  167

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            EDWVKIC PAK+K+ + +    F +QC   EKEAVNVSLGNLLTYPFVREG+   TL+L 
Sbjct  168  EDWVKICSPAKNKIKTAYSGLTFKEQCTNLEKEAVNVSLGNLLTYPFVREGVVNKTLSLN  227

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GGYYDF+ G+F+LW L+F ++  LSV
Sbjct  228  GGYYDFVNGSFQLWDLEFKITPHLSV  253



>ref|XP_009626669.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009804035.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nicotiana sylvestris]
Length=269

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D++KYSGVGAA+EYAV+HLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  124  IANMVPPFDQTKYSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIPDDGSTNSDFI  183

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKICLPAK KV +E       +QC   EKEAVNVSLGNLLTYPFVRE + + +LALK
Sbjct  184  EEWVKICLPAKAKVKAECCHLDPTEQCTKLEKEAVNVSLGNLLTYPFVREAVVQKSLALK  243

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G+FELW +DF L+ S+S+
Sbjct  244  GGHYDFVNGSFELWNIDFNLTPSVSL  269



>ref|XP_010533173.1| PREDICTED: beta carbonic anhydrase 4-like isoform X2 [Tarenaya 
hassleriana]
Length=257

 Score =   216 bits (550),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNG-PTSTDF  179
            IANMVP YDK ++SGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS  D+  PT +DF
Sbjct  111  IANMVPPYDKKRHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIEDDAAPTKSDF  170

Query  180  IEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            IE+WVKIC PAK+K+  E  +  F +QC  CEKEAVNVSLGNLL+YPFVREG+ KNTL++
Sbjct  171  IENWVKICAPAKNKIKQELTEMSFDEQCTNCEKEAVNVSLGNLLSYPFVREGVVKNTLSI  230

Query  360  KGGYYDFIKGAFELWALDFGLSSSLS  437
            +G +YDF+ G FELW LDF  + + +
Sbjct  231  RGAHYDFVNGTFELWELDFKTTPAFA  256



>ref|XP_009626667.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626668.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009804034.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana sylvestris]
 gb|AIL30494.1| chloroplast carbonic anhydrase isoform 1 [Nicotiana tabacum]
Length=279

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +D++KYSGVGAA+EYAV+HLKVENI+VIGHS CGGIKGLMS PD+G T++DFI
Sbjct  134  IANMVPPFDQTKYSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIPDDGSTNSDFI  193

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKICLPAK KV +E       +QC   EKEAVNVSLGNLLTYPFVRE + + +LALK
Sbjct  194  EEWVKICLPAKAKVKAECCHLDPTEQCTKLEKEAVNVSLGNLLTYPFVREAVVQKSLALK  253

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+ G+FELW +DF L+ S+S+
Sbjct  254  GGHYDFVNGSFELWNIDFNLTPSVSL  279



>gb|AFK48090.1| unknown [Lotus japonicus]
Length=256

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G  ++DFI
Sbjct  111  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTPASDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PAK KV ++ G   F +QC  CEKEAVNVSLGNLLTYPFV+E +   TLALK
Sbjct  171  EQWVRICNPAKSKVKTDTGSLSFSEQCTNCEKEAVNVSLGNLLTYPFVKERVLDKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ G FELW L+F +  S+SV
Sbjct  231  GAHYNFVTGNFELWDLNFKVQPSISV  256



>ref|XP_008446208.1| PREDICTED: carbonic anhydrase 2-like [Cucumis melo]
 ref|XP_008446210.1| PREDICTED: carbonic anhydrase 2-like [Cucumis melo]
 gb|ADN33836.1| carbonic anhydrase [Cucumis melo subsp. melo]
Length=258

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G  S+DFI
Sbjct  113  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGAFSSDFI  172

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC PAK+K  S   D  F D+C  CEKEAVNVSLGNLL+YPFVRE +    + ++
Sbjct  173  ENWVQICTPAKNKTQSNCNDLSFEDKCTECEKEAVNVSLGNLLSYPFVREAVVNKKVFIR  232

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ GAFELW LDF +S SL+V
Sbjct  233  GAHYNFVSGAFELWNLDFNISPSLAV  258



>dbj|BAA95793.1| carbonic anhydrase [Nicotiana tabacum]
Length=130

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +3

Query  51   GAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFIEDWVKICLPAKHKVIS  230
            GAAIEYAVLHLKVENIVVIGHSACGGIKGLMS P +G  ST FIEDWVKI LPAK KV  
Sbjct  1    GAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFIEDWVKIGLPAKAKVQG  60

Query  231  EHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALKGGYYDFIKGAFELWAL  410
            EH D  F DQC  CEKEAVNVSLGNLLTYPFVREGL K TLALKGG+YDF+ G FELW L
Sbjct  61   EHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGL  120

Query  411  DFGLSSSLSV  440
            +FGLS SLSV
Sbjct  121  EFGLSPSLSV  130



>ref|XP_010925558.1| PREDICTED: carbonic anhydrase 2 [Elaeis guineensis]
Length=266

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KY+GVG+AIEYAV+HLKVENIVVIGHS CGGIKGLMS  D+G TSTDFI
Sbjct  131  IANMVPPYDQTKYAGVGSAIEYAVIHLKVENIVVIGHSRCGGIKGLMSLKDDGTTSTDFI  190

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WVKI LPA+ KV ++H   PF DQC  CEKEAVNVSL NLLTYPFV+EGLAK TL L 
Sbjct  191  EAWVKIGLPARDKVKAQHAGLPFEDQCTLCEKEAVNVSLQNLLTYPFVKEGLAKKTLKLI  250

Query  363  GGYYDFIKGAFELW  404
            GG+YDF+KG+FE W
Sbjct  251  GGHYDFVKGSFETW  264



>ref|XP_011086567.1| PREDICTED: carbonic anhydrase 2-like [Sesamum indicum]
Length=254

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP YD+ KYSG+GAAIEYAVLHLKVENI+VIGHS CGGIKGLMS P++G TS+DFI
Sbjct  109  IASMVPPYDRKKYSGMGAAIEYAVLHLKVENILVIGHSCCGGIKGLMSIPEDGTTSSDFI  168

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV IC  AK KV +E  +  F +QC + EKEAVNVSLGNLLTYPFVR+ + K TL+LK
Sbjct  169  EEWVNICKTAKAKVRTECSNMDFSEQCNHLEKEAVNVSLGNLLTYPFVRDAVVKKTLSLK  228

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF+KG+FELW LD  +S  +SV
Sbjct  229  GGHYDFVKGSFELWNLDCNVSPCVSV  254



>ref|XP_006365235.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=268

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAA+EYAV+HLKVENI+VIGHS CGGIKGLMS PD+G T +DFI
Sbjct  123  IANMVPPYDQTKYSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIPDDGSTKSDFI  182

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV +E  D    +QC   EKEAVNVSLGNLLTYPFVRE + K ++ALK
Sbjct  183  EEWVKICSTAKAKVKAEFCDLDHNEQCTKLEKEAVNVSLGNLLTYPFVREAVVKKSIALK  242

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF  G+FELW +DF L+ S+S+
Sbjct  243  GGHYDFENGSFELWNIDFKLTPSVSL  268



>ref|XP_010533166.1| PREDICTED: beta carbonic anhydrase 4-like isoform X1 [Tarenaya 
hassleriana]
Length=280

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNG-PTSTDF  179
            IANMVP YDK ++SGVGAAIEYAVLHLKVENIVVIGHS CGGIKGLMS  D+  PT +DF
Sbjct  134  IANMVPPYDKKRHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIEDDAAPTKSDF  193

Query  180  IEDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLAL  359
            IE+WVKIC PAK+K+  E  +  F +QC  CEKEAVNVSLGNLL+YPFVREG+ KNTL++
Sbjct  194  IENWVKICAPAKNKIKQELTEMSFDEQCTNCEKEAVNVSLGNLLSYPFVREGVVKNTLSI  253

Query  360  KGGYYDFIKGAFELWALDFGLSSSLS  437
            +G +YDF+ G FELW LDF  + + +
Sbjct  254  RGAHYDFVNGTFELWELDFKTTPAFA  279



>gb|ACJ85468.1| unknown [Medicago truncatula]
Length=278

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP +DK+KYSG GAAIEYAVLHLKVENIVVIGHS CGGIKG MS PD+G T++DFI
Sbjct  133  IANMVPPFDKTKYSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGFMSIPDDGTTASDFI  192

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E WV+IC PA+ KV  E     F +QC  CEKEAVNVSLGNLLTYPFVR+G+ K +LALK
Sbjct  193  EQWVQICNPARSKVKLETSSLSFAEQCTNCEKEAVNVSLGNLLTYPFVRDGVVKKSLALK  252

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+ G FELW L+F L   +S+
Sbjct  253  GAHYNFVNGTFELWDLNFNLLPYVSI  278



>gb|KDP26586.1| hypothetical protein JCGZ_17744 [Jatropha curcas]
Length=256

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IA+MVP YD++KYSG+GAAIEYAVLHLKVENIVVIGHS CGGIKGLMS PD+G TS+DFI
Sbjct  111  IASMVPPYDQTKYSGMGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGSTSSDFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV IC  AK KV +      F +QC  CEKEAVNVSLGNLLTYPFV+EG+ K TLALK
Sbjct  171  ENWVSICSAAKSKVKTRCSSLSFEEQCHNCEKEAVNVSLGNLLTYPFVKEGVLKKTLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +YDF+ G FELW LDF ++  + V
Sbjct  231  GAHYDFVNGNFELWNLDFKITPPVVV  256



>ref|XP_007153731.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
 gb|ESW25725.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
Length=256

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YDK+KYSG GAAIEYAV HLKVENIVVIGHS CGGIKGLMS PD+G T+++FI
Sbjct  111  IANMVPPYDKTKYSGTGAAIEYAVQHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFI  170

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WV+IC  AK KV +E     F +QC  CEK  VNVS+GNLLTYPFVR+ +   TLALK
Sbjct  171  ENWVQICTQAKSKVKTEASALEFSEQCTNCEKATVNVSVGNLLTYPFVRDCVVNETLALK  230

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            G +Y+F+KG FELW LDF +S+S+SV
Sbjct  231  GAHYNFVKGTFELWDLDFKISNSVSV  256



>ref|XP_006365234.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=271

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            IANMVP YD++KYSGVGAA+EYAV+HLKVENI+VIGHS CGGIKGLMS PD+G T +DFI
Sbjct  126  IANMVPPYDQTKYSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIPDDGSTKSDFI  185

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVKIC  AK KV +E  D    +QC   EKEAVNVSLGNLLTYPFVRE + K ++ALK
Sbjct  186  EEWVKICSTAKAKVKAEFCDLDHNEQCTKLEKEAVNVSLGNLLTYPFVREAVVKKSIALK  245

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDF  G+FELW +DF L+ S+S+
Sbjct  246  GGHYDFENGSFELWNIDFKLTPSVSL  271



>ref|XP_008443520.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Cucumis melo]
Length=332

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    IANMVPAYDKSKYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDNGPTSTDFI  182
            +AN+VP YD+ KYSG G+AIEYAVLHLKV+ IVVIGHSACGGIKGLM+FP +G  STDFI
Sbjct  187  VANLVPPYDQDKYSGTGSAIEYAVLHLKVQYIVVIGHSACGGIKGLMTFPYDGKYSTDFI  246

Query  183  EDWVKICLPAKHKVISEHGDAPFGDQCAYCEKEAVNVSLGNLLTYPFVREGLAKNTLALK  362
            E+WVK+ LPAK KV S HG A  G+ C +CEKEAV VSLGNLLTYPFVR+GL   TL LK
Sbjct  247  EEWVKVGLPAKAKVNSAHGGAELGELCTHCEKEAVAVSLGNLLTYPFVRDGLVNGTLGLK  306

Query  363  GGYYDFIKGAFELWALDFGLSSSLSV  440
            GG+YDFI G FELW L+F ++  LSV
Sbjct  307  GGHYDFINGTFELWGLEFNVTKPLSV  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1201164684765