BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13971_g1_i1 len=528 path=[1:0-527]

Length=528
                                                                      Score     E

dbj|BAA25639.1|  NPCA1                                                  182   5e-53   Nicotiana paniculata
ref|XP_009614638.1|  PREDICTED: carbonic anhydrase, chloroplastic...    182   6e-53   
ref|XP_009614637.1|  PREDICTED: carbonic anhydrase, chloroplastic...    182   7e-53   
ref|XP_006338561.1|  PREDICTED: carbonic anhydrase, chloroplastic...    179   1e-51   
ref|NP_001234048.1|  carbonic anhydrase                                 179   1e-51   
ref|XP_010315870.1|  PREDICTED: carbonic anhydrase isoform X1           179   1e-51   
ref|XP_006338560.1|  PREDICTED: carbonic anhydrase, chloroplastic...    179   1e-51   
gb|EYU44749.1|  hypothetical protein MIMGU_mgv1a009344mg                179   2e-51   
gb|AEK25173.1|  chloroplast carbonic anhydrase                          178   2e-51   
gb|EYU44748.1|  hypothetical protein MIMGU_mgv1a009344mg                179   2e-51   
ref|XP_009801258.1|  PREDICTED: carbonic anhydrase, chloroplastic...    179   2e-51   
gb|KDO66180.1|  hypothetical protein CISIN_1g019915mg                   174   2e-51   
ref|XP_009801266.1|  PREDICTED: carbonic anhydrase, chloroplastic...    178   2e-51   
gb|AAL51055.2|AF454759_1  beta-carbonic anhydrase                       178   3e-51   Nicotiana tabacum [American tobacco]
ref|XP_006369914.1|  hypothetical protein POPTR_0001s34950g             174   5e-51   
ref|XP_008443520.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    177   5e-51   
gb|KDO66178.1|  hypothetical protein CISIN_1g019915mg                   174   5e-51   
ref|XP_008443519.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    178   6e-51   
ref|XP_004158317.1|  PREDICTED: carbonic anhydrase, chloroplastic...    176   2e-50   
ref|XP_004141091.1|  PREDICTED: carbonic anhydrase, chloroplastic...    176   2e-50   
gb|KGN59668.1|  hypothetical protein Csa_3G836520                       176   2e-50   
ref|XP_006369919.1|  hypothetical protein POPTR_0001s34950g             174   4e-50   
gb|KDO66175.1|  hypothetical protein CISIN_1g019915mg                   172   5e-50   
ref|XP_006446500.1|  hypothetical protein CICLE_v10015874mg             173   5e-50   
gb|ABK96524.1|  unknown                                                 174   7e-50   Populus trichocarpa x Populus deltoides
ref|XP_002524642.1|  carbonic anhydrase, putative                       174   8e-50   Ricinus communis
gb|AAC49785.1|  carbonic anhydrase                                      174   1e-49   Populus tremula x Populus tremuloides
gb|KDO66174.1|  hypothetical protein CISIN_1g019915mg                   172   1e-49   
gb|KDO66173.1|  hypothetical protein CISIN_1g019915mg                   172   1e-49   
gb|AAB65822.1|  carbonic anhydrase                                      174   1e-49   Populus tremula x Populus tremuloides
ref|XP_011047313.1|  PREDICTED: carbonic anhydrase 2                    174   2e-49   
ref|XP_006369917.1|  hypothetical protein POPTR_0001s34950g             174   2e-49   
ref|XP_006369916.1|  hypothetical protein POPTR_0001s34950g             173   3e-49   
ref|XP_002298524.2|  carbonic anhydrase isoform 1 family protein        173   3e-49   Populus trichocarpa [western balsam poplar]
gb|ABI14813.1|  chloroplast carbonic anhydrase                          173   3e-49   Pachysandra terminalis
gb|KDO66164.1|  hypothetical protein CISIN_1g019915mg                   172   5e-49   
gb|KDO66171.1|  hypothetical protein CISIN_1g019915mg                   172   6e-49   
gb|KDO66170.1|  hypothetical protein CISIN_1g019915mg                   172   7e-49   
ref|XP_002277957.1|  PREDICTED: carbonic anhydrase 2 isoform X1         172   7e-49   Vitis vinifera
ref|XP_006446502.1|  hypothetical protein CICLE_v10015874mg             172   7e-49   
ref|XP_011098474.1|  PREDICTED: carbonic anhydrase, chloroplastic...    172   7e-49   
gb|KDO66166.1|  hypothetical protein CISIN_1g019915mg                   172   7e-49   
ref|XP_011098473.1|  PREDICTED: carbonic anhydrase, chloroplastic...    172   7e-49   
ref|XP_006446503.1|  hypothetical protein CICLE_v10015874mg             172   8e-49   
ref|XP_007031477.1|  Carbonic anhydrase 1 isoform 2                     172   8e-49   
ref|XP_010551901.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    172   1e-48   
ref|XP_006470326.1|  PREDICTED: carbonic anhydrase, chloroplastic...    171   2e-48   
ref|XP_006470327.1|  PREDICTED: carbonic anhydrase, chloroplastic...    171   2e-48   
gb|AAD29049.1|AF132854_1  carbonic anhydrase isoform 1                  170   3e-48   Gossypium hirsutum [American cotton]
gb|KHG25181.1|  Carbonic anhydrase, chloroplastic                       170   3e-48   
gb|AAA34057.1|  carbonic anhydrase                                      169   3e-48   Nicotiana tabacum [American tobacco]
gb|AAM22683.1|AF482951_1  carbonic anhydrase                            170   3e-48   Gossypium hirsutum [American cotton]
gb|KHG25180.1|  Carbonic anhydrase, chloroplastic                       170   4e-48   
gb|AAD29050.1|AF132855_1  carbonic anhydrase isoform 2                  170   4e-48   Gossypium hirsutum [American cotton]
ref|XP_010687996.1|  PREDICTED: carbonic anhydrase, chloroplastic...    169   7e-48   
gb|KDP45339.1|  hypothetical protein JCGZ_09588                         169   8e-48   
dbj|BAH56801.1|  AT3G01500                                              167   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408513.1|  hypothetical protein EUTSA_v10020995mg             168   3e-47   
ref|XP_006408514.1|  hypothetical protein EUTSA_v10020995mg             168   3e-47   
ref|XP_002882178.1|  hypothetical protein ARALYDRAFT_477371             167   5e-47   
ref|NP_850491.1|  carbonic anhydrase 1                                  167   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108776.1|  Carbonic anhydrase                                 167   7e-47   
ref|NP_186799.2|  carbonic anhydrase 1                                  167   7e-47   Arabidopsis thaliana [mouse-ear cress]
sp|P16016.2|CAHC_SPIOL  RecName: Full=Carbonic anhydrase, chlorop...    166   9e-47   Spinacia oleracea
ref|XP_004489274.1|  PREDICTED: carbonic anhydrase, chloroplastic...    167   9e-47   
ref|XP_006408515.1|  hypothetical protein EUTSA_v10020995mg             167   9e-47   
ref|XP_004489275.1|  PREDICTED: carbonic anhydrase, chloroplastic...    167   9e-47   
gb|ACU15535.1|  unknown                                                 163   1e-46   Glycine max [soybeans]
gb|ADZ97028.1|  carbonic anhydrase 3                                    166   1e-46   
ref|XP_006603810.1|  PREDICTED: carbonic anhydrase, chloroplastic...    166   1e-46   
gb|KHN23534.1|  Carbonic anhydrase, chloroplastic                       166   1e-46   
ref|XP_003553834.1|  PREDICTED: carbonic anhydrase, chloroplastic...    166   1e-46   
ref|XP_010029173.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    166   1e-46   
gb|AAS65454.1|  chloroplast carbonic anhydrase precursor                166   2e-46   Noccaea caerulescens
ref|XP_003524544.1|  PREDICTED: carbonic anhydrase, chloroplastic...    166   2e-46   
ref|XP_006579756.1|  PREDICTED: carbonic anhydrase, chloroplastic...    166   2e-46   
gb|ABC41658.1|  carbonic anhydrase 3                                    165   4e-46   Flaveria pringlei
ref|XP_004304623.1|  PREDICTED: carbonic anhydrase, chloroplastic...    165   4e-46   
gb|AFX73760.1|  carbonic anhydrase                                      165   4e-46   
gb|AFX73761.1|  carbonic anhydrase                                      165   4e-46   
gb|AFX73759.1|  carbonic anhydrase                                      165   4e-46   
gb|ADZ97025.1|  carbonic anhydrase 3                                    165   4e-46   
gb|AFX73762.1|  carbonic anhydrase                                      165   4e-46   
ref|XP_010496305.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    165   4e-46   
gb|ABC41659.1|  carbonic anhydrase 3                                    164   7e-46   Flaveria linearis
ref|XP_009614639.1|  PREDICTED: carbonic anhydrase, chloroplastic...    162   8e-46   
emb|CCW28006.1|  carbonic anhydrase                                     164   9e-46   
gb|ADZ97026.1|  carbonic anhydrase 3                                    164   1e-45   
ref|XP_006298106.1|  hypothetical protein CARUB_v10014147mg             164   1e-45   
gb|AEV42276.1|  chloroplast beta carbonic anhydrase 1                   163   1e-45   
ref|XP_010496563.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    164   2e-45   
ref|XP_010435624.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    163   2e-45   
gb|AAA33652.1|  carbonic anhydrase                                      163   2e-45   Pisum sativum [garden pea]
ref|XP_010524306.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    160   3e-45   
gb|ADI52861.1|  chloroplast beta-carbonic anhydrase                     162   4e-45   
gb|AJA06256.1|  beta-type carbonic anhydrase 1-like protein             162   4e-45   
ref|XP_009125017.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    162   5e-45   
ref|XP_009147437.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    162   5e-45   
gb|AJA06253.1|  beta-type carbonic anhydrase 1-like protein             162   5e-45   
ref|XP_010251256.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    162   6e-45   
ref|XP_003618282.1|  Carbonic anhydrase                                 160   6e-45   
gb|AAD27876.2|AF139464_1  carbonic anhydrase                            162   6e-45   Vigna radiata var. radiata [golden gram]
ref|XP_010251255.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    162   7e-45   
emb|CDY37516.1|  BnaA05g33810D                                          162   9e-45   
sp|P17067.1|CAHC_PEA  RecName: Full=Carbonic anhydrase, chloropla...    161   9e-45   Pisum sativum [garden pea]
ref|XP_008348025.1|  PREDICTED: LOW QUALITY PROTEIN: carbonic anh...    159   9e-45   
ref|XP_007151036.1|  hypothetical protein PHAVU_004G013500g             160   2e-44   
gb|AJA06259.1|  beta-type carbonic anhydrase 1-like protein             160   2e-44   
ref|XP_007151035.1|  hypothetical protein PHAVU_004G013500g             160   2e-44   
ref|XP_003618280.1|  Carbonic anhydrase                                 160   2e-44   
ref|XP_009801271.1|  PREDICTED: carbonic anhydrase, chloroplastic...    159   2e-44   
emb|CDY49059.1|  BnaC05g48870D                                          161   2e-44   
ref|XP_003618281.1|  Carbonic anhydrase                                 160   3e-44   
sp|P46511.1|CAHX_FLABR  RecName: Full=Carbonic anhydrase; AltName...    160   4e-44   Flaveria brownii
sp|P46510.2|CAHX_FLABI  RecName: Full=Carbonic anhydrase; AltName...    159   4e-44   Flaveria bidentis
sp|P46512.1|CAH1_FLALI  RecName: Full=Carbonic anhydrase 1; AltNa...    159   5e-44   Flaveria linearis
gb|ADZ97027.1|  carbonic anhydrase 3                                    159   1e-43   
gb|AGS78351.1|  chloroplast beta-carbonic anhydrase                     158   1e-43   
sp|P46281.1|CAHX_FLAPR  RecName: Full=Carbonic anhydrase; AltName...    158   2e-43   Flaveria pringlei
gb|ABK96336.1|  unknown                                                 155   3e-43   Populus trichocarpa x Populus deltoides
ref|XP_008357742.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    157   3e-43   
ref|XP_006446505.1|  hypothetical protein CICLE_v10015874mg             156   3e-43   
ref|XP_008357741.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    157   3e-43   
gb|KDO66161.1|  hypothetical protein CISIN_1g019915mg                   156   3e-43   
ref|XP_006369918.1|  hypothetical protein POPTR_0001s34950g             155   5e-43   
ref|XP_009377228.1|  PREDICTED: carbonic anhydrase, chloroplastic...    153   6e-43   
ref|XP_003517730.1|  PREDICTED: carbonic anhydrase, chloroplastic...    154   1e-42   
prf||2018192A  carbonic anhydrase                                       155   2e-42
gb|AAO17574.1|  carbonic anhydrase 3                                    153   3e-42   Flaveria bidentis
ref|XP_011009542.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    153   3e-42   
ref|XP_011009544.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    153   3e-42   
gb|ADZ97029.1|  carbonic anhydrase 3                                    152   4e-42   
emb|CDP02111.1|  unnamed protein product                                154   4e-42   
ref|XP_009334081.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    154   5e-42   
ref|XP_006585949.1|  PREDICTED: carbonic anhydrase, chloroplastic...    152   5e-42   
ref|XP_009334082.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    154   5e-42   
ref|XP_007044647.1|  Carbonic anhydrase 2, CA2 isoform 1                152   8e-42   
gb|KHN26874.1|  Carbonic anhydrase, chloroplastic                       150   1e-41   
ref|XP_009375105.1|  PREDICTED: carbonic anhydrase 2-like               153   1e-41   
ref|XP_006602381.1|  PREDICTED: carbonic anhydrase, chloroplastic...    148   2e-41   
ref|XP_003517731.1|  PREDICTED: carbonic anhydrase, chloroplastic...    150   3e-41   
ref|XP_010029174.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    150   3e-41   
ref|XP_008389648.1|  PREDICTED: carbonic anhydrase 2 isoform X1         150   4e-41   
gb|ACU18641.1|  unknown                                                 148   5e-41   Glycine max [soybeans]
ref|XP_010660912.1|  PREDICTED: beta carbonic anhydrase 1, chloro...    150   5e-41   
ref|XP_004489276.1|  PREDICTED: carbonic anhydrase, chloroplastic...    150   6e-41   
ref|XP_011009545.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    149   6e-41   
ref|XP_006378218.1|  hypothetical protein POPTR_0010s05080g             147   8e-41   
gb|ACU19610.1|  unknown                                                 149   1e-40   Glycine max [soybeans]
gb|KHN00357.1|  Carbonic anhydrase, chloroplastic                       149   1e-40   
ref|XP_003519759.1|  PREDICTED: carbonic anhydrase, chloroplastic...    149   1e-40   
ref|XP_006603811.1|  PREDICTED: carbonic anhydrase, chloroplastic...    149   2e-40   
gb|KCW56026.1|  hypothetical protein EUGRSUZ_I01790                     151   2e-40   
gb|ACJ85468.1|  unknown                                                 149   2e-40   Medicago truncatula
gb|AGS78352.1|  cytoplasmic beta carbonic anhydrase                     148   2e-40   
ref|XP_007215653.1|  hypothetical protein PRUPE_ppa008289mg             150   2e-40   
dbj|BAM15482.1|  carbonic anhydrase                                     148   2e-40   
ref|XP_006579757.1|  PREDICTED: carbonic anhydrase, chloroplastic...    148   2e-40   
gb|KHN27017.1|  Carbonic anhydrase, chloroplastic                       148   2e-40   
ref|XP_006470328.1|  PREDICTED: carbonic anhydrase, chloroplastic...    148   2e-40   
ref|XP_007044648.1|  Carbonic anhydrase 2, CA2 isoform 2                148   2e-40   
ref|XP_007215654.1|  hypothetical protein PRUPE_ppa008289mg             149   2e-40   
ref|XP_006408512.1|  hypothetical protein EUTSA_v10020995mg             148   3e-40   
ref|XP_002525377.1|  carbonic anhydrase, putative                       148   3e-40   Ricinus communis
ref|XP_006365235.1|  PREDICTED: carbonic anhydrase, chloroplastic...    148   3e-40   
ref|XP_003613229.1|  Carbonic anhydrase                                 148   4e-40   
ref|XP_006365234.1|  PREDICTED: carbonic anhydrase, chloroplastic...    147   4e-40   
ref|XP_003613228.1|  Carbonic anhydrase                                 148   4e-40   
ref|XP_006446499.1|  hypothetical protein CICLE_v10015874mg             147   4e-40   
ref|NP_850490.1|  carbonic anhydrase 1                                  147   4e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93915.1|  carbonic anhydrase, chloroplast precursor              147   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08930.1|  Carbonic anhydrase, chloroplastic                       147   4e-40   
ref|XP_002314617.1|  hypothetical protein POPTR_0010s05080g             147   5e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006483853.1|  PREDICTED: carbonic anhydrase, chloroplastic...    147   5e-40   
ref|XP_008230599.1|  PREDICTED: carbonic anhydrase 2, chloroplast...    149   6e-40   
ref|XP_003618284.1|  Carbonic anhydrase                                 147   7e-40   
ref|XP_004238665.1|  PREDICTED: carbonic anhydrase 2 isoform X2         147   8e-40   
ref|XP_004304624.1|  PREDICTED: carbonic anhydrase, chloroplastic...    147   8e-40   
gb|KDP26586.1|  hypothetical protein JCGZ_17744                         146   1e-39   
ref|XP_004238664.1|  PREDICTED: carbonic anhydrase 2 isoform X1         147   1e-39   
ref|XP_007157457.1|  hypothetical protein PHAVU_002G071200g             147   1e-39   
ref|XP_010492290.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    145   2e-39   
ref|XP_006574621.1|  PREDICTED: carbonic anhydrase, chloroplastic...    145   2e-39   
gb|ABK94941.1|  unknown                                                 145   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010251257.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    146   2e-39   
gb|AAA34026.1|  carbonic anhydrase precursor                            145   2e-39   Spinacia oleracea
gb|KCW86712.1|  hypothetical protein EUGRSUZ_B03320                     148   2e-39   
prf||1707317A  carbonic anhydrase                                       145   2e-39
ref|XP_009363559.1|  PREDICTED: carbonic anhydrase 2                    145   3e-39   
ref|XP_008389649.1|  PREDICTED: carbonic anhydrase 2 isoform X2         145   3e-39   
gb|KFK23338.1|  hypothetical protein AALP_AAs64867U000100               143   3e-39   
ref|XP_010492287.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    145   3e-39   
gb|KDO82415.1|  hypothetical protein CISIN_1g0235891mg                  145   4e-39   
gb|KDO82416.1|  hypothetical protein CISIN_1g0235891mg                  144   4e-39   
ref|XP_010044623.1|  PREDICTED: carbonic anhydrase 2                    144   5e-39   
ref|NP_974782.1|  carbonic anhydrase 2                                  144   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071084.1|  PREDICTED: carbonic anhydrase 2-like               145   7e-39   
ref|XP_002871629.1|  hypothetical protein ARALYDRAFT_488319             144   7e-39   
ref|XP_008340028.1|  PREDICTED: carbonic anhydrase 2-like               144   1e-38   
gb|AFK48090.1|  unknown                                                 143   1e-38   
ref|XP_007153731.1|  hypothetical protein PHAVU_003G060400g             143   1e-38   
ref|XP_007153732.1|  hypothetical protein PHAVU_003G060400g             143   1e-38   
dbj|BAH20249.1|  AT5G14740                                              144   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100460.1|  Carbonic anhydrase                                 143   2e-38   
ref|NP_001078583.1|  carbonic anhydrase 2                               144   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157458.1|  hypothetical protein PHAVU_002G071200g             143   2e-38   
ref|XP_010453603.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    142   2e-38   
ref|XP_010420125.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    142   2e-38   
ref|XP_009626669.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    143   3e-38   
ref|XP_009626667.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    143   3e-38   
ref|NP_001031884.1|  carbonic anhydrase 2                               144   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031883.1|  carbonic anhydrase 2                               144   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568303.2|  carbonic anhydrase 2                                  144   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004155356.1|  PREDICTED: carbonic anhydrase, chloroplastic...    143   3e-38   
gb|AES96187.2|  carbonic anhydrase family protein                       142   3e-38   
ref|XP_010533166.1|  PREDICTED: beta carbonic anhydrase 4-like is...    142   4e-38   
ref|XP_008362142.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    144   5e-38   
gb|AAA50156.1|  carbonic anhydrase                                      142   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251258.1|  PREDICTED: carbonic anhydrase 2-like isoform X4    141   9e-38   
ref|XP_004135244.1|  PREDICTED: carbonic anhydrase, chloroplastic...    142   1e-37   
ref|XP_010243030.1|  PREDICTED: carbonic anhydrase 2-like               141   1e-37   
ref|XP_011034133.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    141   1e-37   
ref|XP_004297629.1|  PREDICTED: carbonic anhydrase, chloroplastic...    141   1e-37   
ref|XP_010682554.1|  PREDICTED: carbonic anhydrase 2 isoform X1         141   1e-37   
ref|XP_003631257.1|  PREDICTED: carbonic anhydrase 2 isoform X1         141   1e-37   
gb|KHG09974.1|  Carbonic anhydrase, chloroplastic                       141   1e-37   
ref|XP_004297630.1|  PREDICTED: carbonic anhydrase, chloroplastic...    140   2e-37   
ref|XP_006288492.1|  hypothetical protein CARUB_v10001757mg             140   2e-37   
gb|AEV42277.1|  beta carbonic anhydrase 2                               141   2e-37   
emb|CAN61667.1|  hypothetical protein VITISV_037833                     142   2e-37   Vitis vinifera
ref|XP_011034132.1|  PREDICTED: carbonic anhydrase, chloroplastic...    140   3e-37   
ref|XP_004298398.1|  PREDICTED: carbonic anhydrase, chloroplastic...    140   3e-37   
gb|EYU22489.1|  hypothetical protein MIMGU_mgv1a009030mg                140   4e-37   
ref|XP_010533173.1|  PREDICTED: beta carbonic anhydrase 4-like is...    139   4e-37   
ref|XP_006438385.1|  hypothetical protein CICLE_v10032517mg             139   4e-37   
gb|EYU22490.1|  hypothetical protein MIMGU_mgv1a009030mg                139   4e-37   
ref|XP_008341456.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    141   4e-37   
ref|XP_010682555.1|  PREDICTED: carbonic anhydrase 2 isoform X2         139   7e-37   
ref|XP_006416059.1|  hypothetical protein EUTSA_v10008530mg             139   8e-37   
gb|AAO17573.1|  carbonic anhydrase 2                                    139   9e-37   Flaveria bidentis
ref|XP_006399988.1|  hypothetical protein EUTSA_v10014232mg             139   9e-37   
emb|CDP00162.1|  unnamed protein product                                139   9e-37   
gb|EYU22488.1|  hypothetical protein MIMGU_mgv1a009030mg                140   1e-36   
ref|XP_008446208.1|  PREDICTED: carbonic anhydrase 2-like               138   1e-36   
gb|KDO82418.1|  hypothetical protein CISIN_1g0235891mg                  138   1e-36   
emb|CDX85584.1|  BnaA02g02290D                                          138   1e-36   
ref|XP_007223694.1|  hypothetical protein PRUPE_ppa010344mg             138   1e-36   
ref|XP_006369920.1|  hypothetical protein POPTR_0001s34950g             138   1e-36   
ref|XP_004155357.1|  PREDICTED: carbonic anhydrase, chloroplastic...    138   1e-36   
ref|XP_008221815.1|  PREDICTED: carbonic anhydrase 2-like               138   2e-36   
gb|EYU31260.1|  hypothetical protein MIMGU_mgv1a012197mg                138   2e-36   
gb|AJA06255.1|  beta-type carbonic anhydrase 4-like protein             138   2e-36   
ref|XP_011086567.1|  PREDICTED: carbonic anhydrase 2-like               137   2e-36   
ref|XP_003631258.1|  PREDICTED: carbonic anhydrase 2 isoform X2         137   2e-36   
gb|KHG21576.1|  Carbonic anhydrase, chloroplastic                       137   2e-36   
ref|XP_008341457.1|  PREDICTED: carbonic anhydrase, chloroplastic...    137   2e-36   
emb|CDX91024.1|  BnaC02g05730D                                          137   2e-36   
ref|XP_009126004.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    137   3e-36   
ref|XP_006357150.1|  PREDICTED: carbonic anhydrase, chloroplastic...    137   3e-36   
gb|ABC41657.1|  carbonic anhydrase 2                                    138   3e-36   Flaveria pringlei
gb|AJA06258.1|  beta-type carbonic anhydrase 4-like protein             137   4e-36   
ref|XP_004135245.1|  PREDICTED: carbonic anhydrase, chloroplastic...    137   5e-36   
ref|XP_006399989.1|  hypothetical protein EUTSA_v10014232mg             136   7e-36   
ref|XP_009783083.1|  PREDICTED: carbonic anhydrase, chloroplastic...    136   8e-36   
ref|XP_006390892.1|  hypothetical protein EUTSA_v10018978mg             136   1e-35   
ref|XP_006390894.1|  hypothetical protein EUTSA_v10018978mg             135   1e-35   
ref|XP_009127790.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    135   2e-35   
emb|CDY57304.1|  BnaCnng31770D                                          135   2e-35   
gb|AJA06261.1|  beta-type carbonic anhydrase 4-like protein             135   2e-35   
ref|XP_009127791.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    135   2e-35   
ref|XP_009630802.1|  PREDICTED: carbonic anhydrase, chloroplastic...    135   2e-35   
ref|XP_006301888.1|  hypothetical protein CARUB_v10022362mg             135   3e-35   
gb|EPS62235.1|  carbonic anhydrase                                      134   3e-35   
gb|AJA06254.1|  beta-type carbonic anhydrase 3-like protein             134   4e-35   
gb|KEH20012.1|  carbonic anhydrase family protein                       134   4e-35   
ref|XP_009105702.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    134   5e-35   
ref|XP_010551572.1|  PREDICTED: beta carbonic anhydrase 4-like          134   6e-35   
emb|CDY69444.1|  BnaCnng63520D                                          134   6e-35   
ref|XP_009105701.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    134   6e-35   
ref|XP_002888778.1|  hypothetical protein ARALYDRAFT_476161             134   9e-35   
gb|EYU31259.1|  hypothetical protein MIMGU_mgv1a012197mg                133   2e-34   
ref|XP_010552640.1|  PREDICTED: beta carbonic anhydrase 4               132   2e-34   
ref|XP_008230600.1|  PREDICTED: carbonic anhydrase, chloroplastic...    133   2e-34   
ref|XP_006446501.1|  hypothetical protein CICLE_v10015874mg             131   3e-34   
ref|XP_006357151.1|  PREDICTED: carbonic anhydrase, chloroplastic...    131   5e-34   
ref|XP_010474258.1|  PREDICTED: beta carbonic anhydrase 4-like          132   6e-34   
ref|XP_010427815.1|  PREDICTED: beta carbonic anhydrase 4 isoform X2    131   7e-34   
ref|XP_010427814.1|  PREDICTED: beta carbonic anhydrase 4 isoform X1    131   8e-34   
ref|XP_010415718.1|  PREDICTED: beta carbonic anhydrase 4-like is...    130   1e-33   
ref|XP_010415715.1|  PREDICTED: beta carbonic anhydrase 4-like is...    131   1e-33   
ref|XP_010477677.1|  PREDICTED: beta carbonic anhydrase 3               130   1e-33   
ref|XP_009774414.1|  PREDICTED: carbonic anhydrase, chloroplastic...    130   2e-33   
ref|NP_001233847.1|  carbonic anhydrase                                 130   2e-33   
emb|CDY25799.1|  BnaA07g09830D                                          130   2e-33   
ref|NP_177198.1|  beta carbonic anhydrase 4                             130   3e-33   
emb|CDY28477.1|  BnaC07g13050D                                          129   5e-33   
ref|NP_849872.1|  beta carbonic anhydrase 4                             128   1e-32   
ref|XP_009103160.1|  PREDICTED: beta carbonic anhydrase 3               127   2e-32   
pdb|1EKJ|A  Chain A, The X-Ray Crystallographic Structure Of Beta...    126   2e-32   
ref|XP_010460149.1|  PREDICTED: beta carbonic anhydrase 3               127   3e-32   
ref|NP_173785.1|  beta carbonic anhydrase 3                             126   6e-32   
emb|CDY61543.1|  BnaA09g29930D                                          125   2e-31   
ref|XP_009115504.1|  PREDICTED: beta carbonic anhydrase 3               125   2e-31   
gb|AJA06260.1|  beta-type carbonic anhydrase 3-like protein             124   3e-31   
ref|XP_008363408.1|  PREDICTED: carbonic anhydrase 2-like               124   3e-31   
ref|XP_008371810.1|  PREDICTED: carbonic anhydrase 2-like               124   3e-31   
ref|XP_008371811.1|  PREDICTED: carbonic anhydrase 2-like               124   3e-31   
ref|XP_009368246.1|  PREDICTED: carbonic anhydrase 2-like isoform X3    124   4e-31   
ref|XP_002890592.1|  predicted protein                                  124   5e-31   
ref|XP_009148004.1|  PREDICTED: beta carbonic anhydrase 3-like          123   6e-31   
ref|XP_006844988.1|  hypothetical protein AMTR_s00058p00191040          122   1e-30   
ref|XP_007201386.1|  hypothetical protein PRUPE_ppa010302mg             121   3e-30   
gb|ABR13313.1|  putative carbonic anhydrase                             121   3e-30   
ref|XP_003601274.1|  Carbonic anhydrase                                 118   1e-29   
ref|XP_008243631.1|  PREDICTED: carbonic anhydrase 2-like               119   1e-29   
ref|XP_010663172.1|  PREDICTED: carbonic anhydrase 2-like               119   2e-29   
gb|AFK33684.1|  unknown                                                 119   2e-29   
emb|CAD66064.1|  carbonic anhydrase                                     119   2e-29   
ref|XP_008243629.1|  PREDICTED: carbonic anhydrase 2-like               119   2e-29   
gb|ABR17241.1|  unknown                                                 118   2e-29   
gb|EPS70533.1|  carbonic anhydrase                                      118   3e-29   
gb|AJA06257.1|  beta-type carbonic anhydrase 3-like protein             118   5e-29   
ref|XP_007031476.1|  Carbonic anhydrase 1 isoform 1                     119   5e-29   
ref|XP_003601277.1|  Carbonic anhydrase                                 118   6e-29   
ref|XP_009768900.1|  PREDICTED: carbonic anhydrase 2-like               117   8e-29   
gb|ABK22341.1|  unknown                                                 117   1e-28   
ref|XP_003601273.1|  Carbonic anhydrase                                 118   1e-28   
emb|CDY64834.1|  BnaCnng45230D                                          117   1e-28   
ref|XP_007138081.1|  hypothetical protein PHAVU_009G178900g             116   3e-28   
emb|CAA63712.1|  Carbonic anhydrase                                     116   3e-28   
ref|XP_009343614.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    115   5e-28   
ref|XP_009368243.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    115   5e-28   
emb|CDX93637.1|  BnaA06g04110D                                          115   5e-28   
gb|KHN19308.1|  Carbonic anhydrase, chloroplastic                       115   5e-28   
ref|XP_009626670.1|  PREDICTED: carbonic anhydrase 2-like               115   6e-28   
gb|ACU22936.1|  unknown                                                 115   8e-28   
ref|XP_003601272.1|  Carbonic anhydrase                                 114   1e-27   
ref|XP_009416559.1|  PREDICTED: carbonic anhydrase 2                    114   2e-27   
ref|XP_009148007.1|  PREDICTED: beta carbonic anhydrase 3-like          114   2e-27   
ref|XP_004501932.1|  PREDICTED: LOW QUALITY PROTEIN: carbonic anh...    114   3e-27   
gb|ABK25251.1|  unknown                                                 111   4e-27   
gb|AAY17069.1|  chloroplast carbonic anhydrase                          111   4e-27   
ref|NP_001236204.1|  carbonic anhydrase                                 113   4e-27   
ref|XP_007208630.1|  hypothetical protein PRUPE_ppa018794mg             113   6e-27   
ref|XP_009396482.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    112   7e-27   
ref|XP_009396483.1|  PREDICTED: carbonic anhydrase, chloroplastic...    111   8e-27   
ref|XP_004290540.1|  PREDICTED: carbonic anhydrase 2, chloroplast...    112   1e-26   
ref|XP_009406302.1|  PREDICTED: carbonic anhydrase 2-like               111   2e-26   
ref|XP_008801822.1|  PREDICTED: carbonic anhydrase 2 isoform X1         111   2e-26   
gb|ABK23747.1|  unknown                                                 110   4e-26   
gb|ACN39779.1|  unknown                                                 110   4e-26   
ref|XP_011028722.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    109   6e-26   
ref|XP_009402540.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    108   7e-26   
gb|ABK26336.1|  unknown                                                 109   1e-25   
ref|XP_010925558.1|  PREDICTED: carbonic anhydrase 2                    109   1e-25   
ref|XP_006476774.1|  PREDICTED: carbonic anhydrase, chloroplastic...    109   1e-25   
ref|XP_008801824.1|  PREDICTED: carbonic anhydrase, chloroplastic...    107   1e-25   
ref|XP_006439813.1|  hypothetical protein CICLE_v10024575mg             108   2e-25   
ref|XP_008801823.1|  PREDICTED: carbonic anhydrase, chloroplastic...    107   2e-25   
ref|XP_002268175.2|  PREDICTED: carbonic anhydrase, chloroplastic...    107   2e-25   
ref|XP_002282681.2|  PREDICTED: carbonic anhydrase 2-like isoform X2    108   3e-25   
ref|XP_010663174.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    108   3e-25   
ref|XP_008782456.1|  PREDICTED: carbonic anhydrase, chloroplastic...    106   4e-25   
ref|XP_009394248.1|  PREDICTED: beta carbonic anhydrase 2, chloro...    107   4e-25   
ref|XP_008223297.1|  PREDICTED: carbonic anhydrase 2-like               108   4e-25   
gb|KDO69671.1|  hypothetical protein CISIN_1g045791mg                   108   5e-25   
ref|XP_009394249.1|  PREDICTED: carbonic anhydrase, chloroplastic...    105   1e-24   
ref|XP_009796887.1|  PREDICTED: carbonic anhydrase 2-like               106   1e-24   
ref|XP_009411254.1|  PREDICTED: carbonic anhydrase 1-like isoform X1    105   2e-24   
ref|XP_002971798.1|  hypothetical protein SELMODRAFT_95906              105   2e-24   
gb|KDO66172.1|  hypothetical protein CISIN_1g019915mg                   106   3e-24   
ref|XP_009411255.1|  PREDICTED: carbonic anhydrase 1-like isoform X2    104   3e-24   
ref|XP_004294571.1|  PREDICTED: carbonic anhydrase, chloroplastic...    105   4e-24   
ref|XP_002322163.1|  carbonic anhydrase family protein                  105   4e-24   
ref|XP_011028568.1|  PREDICTED: carbonic anhydrase 2-like isoform X2    105   4e-24   
emb|CAN59937.1|  hypothetical protein VITISV_001879                     102   9e-24   
ref|XP_002322164.1|  carbonic anhydrase family protein                  104   1e-23   
emb|CDY47630.1|  BnaC05g18860D                                          103   2e-23   
ref|XP_008806899.1|  PREDICTED: carbonic anhydrase, chloroplastic...    101   2e-23   
ref|XP_011028567.1|  PREDICTED: carbonic anhydrase 2-like isoform X1    103   3e-23   
ref|XP_008806898.1|  PREDICTED: carbonic anhydrase, chloroplastic...    101   3e-23   
ref|XP_010251259.1|  PREDICTED: carbonic anhydrase 2-like               102   4e-23   
ref|XP_008806897.1|  PREDICTED: carbonic anhydrase, chloroplastic...    101   5e-23   
ref|XP_010936732.1|  PREDICTED: carbonic anhydrase, chloroplastic...    101   5e-23   
sp|P46513.1|CAH2_FLALI  RecName: Full=Carbonic anhydrase 2; AltNa...    100   8e-23   
ref|XP_011043070.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    101   2e-22   
ref|XP_006373020.1|  hypothetical protein POPTR_0017s07220g             100   2e-22   
ref|XP_006373022.1|  hypothetical protein POPTR_0017s07220g             100   2e-22   
gb|KHG02121.1|  Carbonic anhydrase, chloroplastic                       100   3e-22   
dbj|BAL46502.1|  carbonic anhydrase                                     100   3e-22   
ref|XP_011043069.1|  PREDICTED: beta carbonic anhydrase 5, chloro...    100   4e-22   
ref|XP_002323724.2|  hypothetical protein POPTR_0017s07220g             100   4e-22   
ref|XP_002967228.1|  hypothetical protein SELMODRAFT_86779            99.4    5e-22   
ref|NP_001143026.1|  uncharacterized protein LOC100275493             97.1    7e-22   
ref|XP_006438387.1|  hypothetical protein CICLE_v10032517mg           97.1    2e-21   
gb|KDO82422.1|  hypothetical protein CISIN_1g0235891mg                97.1    2e-21   
ref|XP_007042851.1|  Carbonic anhydrase isoform 1                     98.6    2e-21   
ref|XP_007042852.1|  Carbonic anhydrase isoform 2                     98.2    2e-21   
ref|XP_008357879.1|  PREDICTED: carbonic anhydrase, chloroplastic...  95.9    3e-21   
gb|KDP31102.1|  hypothetical protein JCGZ_11478                       97.1    4e-21   
gb|KDO51526.1|  hypothetical protein CISIN_1g021901mg                 95.5    4e-21   
ref|XP_011023050.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  97.8    4e-21   
gb|KDO51528.1|  hypothetical protein CISIN_1g021901mg                 95.5    4e-21   
ref|XP_006380348.1|  hypothetical protein POPTR_0007s03330g           97.4    4e-21   
ref|XP_002309867.2|  hypothetical protein POPTR_0007s03330g           97.8    5e-21   
gb|KDO51525.1|  hypothetical protein CISIN_1g021901mg                 95.5    5e-21   
ref|XP_011023051.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  97.1    5e-21   
ref|XP_008237225.1|  PREDICTED: carbonic anhydrase 2                  97.4    6e-21   
gb|KDO51529.1|  hypothetical protein CISIN_1g021901mg                 95.5    8e-21   
gb|KDO51524.1|  hypothetical protein CISIN_1g021901mg                 95.9    9e-21   
ref|XP_002977578.1|  hypothetical protein SELMODRAFT_106986           95.1    9e-21   
ref|XP_002975172.1|  hypothetical protein SELMODRAFT_102513           95.1    9e-21   
ref|XP_010232070.1|  PREDICTED: carbonic anhydrase, chloroplastic...  95.9    1e-20   
ref|XP_004290413.1|  PREDICTED: carbonic anhydrase, chloroplastic...  96.3    1e-20   
ref|XP_006423763.1|  hypothetical protein CICLE_v10028905mg           96.3    1e-20   
gb|KDO51519.1|  hypothetical protein CISIN_1g021901mg                 96.3    1e-20   
ref|XP_006423761.1|  hypothetical protein CICLE_v10028905mg           96.3    1e-20   
ref|XP_006487506.1|  PREDICTED: carbonic anhydrase 1-like isoform X1  96.3    1e-20   
ref|XP_006487507.1|  PREDICTED: carbonic anhydrase 1-like isoform X2  96.3    1e-20   
ref|XP_009399692.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  96.3    1e-20   
tpg|DAA58387.1|  TPA: hypothetical protein ZEAMMB73_899140            92.8    2e-20   
ref|XP_007200444.1|  hypothetical protein PRUPE_ppa008903mg           95.9    2e-20   
ref|XP_009366309.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  94.7    2e-20   
gb|KDP40984.1|  hypothetical protein JCGZ_24983                       95.5    2e-20   
ref|XP_009366310.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  94.7    3e-20   
ref|XP_008382185.1|  PREDICTED: carbonic anhydrase 2-like isoform X2  95.5    3e-20   
ref|XP_006394162.1|  hypothetical protein EUTSA_v10004840mg           94.7    3e-20   
dbj|BAG87598.1|  unnamed protein product                              94.0    3e-20   
ref|XP_008382186.1|  PREDICTED: carbonic anhydrase 2-like isoform X3  95.5    3e-20   
ref|XP_008382184.1|  PREDICTED: carbonic anhydrase 2-like isoform X1  95.5    3e-20   
ref|XP_009368295.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  95.1    4e-20   
ref|XP_009368296.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  95.1    4e-20   
ref|XP_009368297.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  95.1    4e-20   
emb|CDY58271.1|  BnaAnng15140D                                        95.1    4e-20   
ref|XP_006423760.1|  hypothetical protein CICLE_v10028905mg           94.0    4e-20   
gb|KDO51520.1|  hypothetical protein CISIN_1g021901mg                 93.6    4e-20   
ref|XP_008373208.1|  PREDICTED: carbonic anhydrase, chloroplastic...  94.0    5e-20   
gb|EMT19451.1|  Carbonic anhydrase, chloroplastic                     93.2    5e-20   
ref|XP_008373209.1|  PREDICTED: carbonic anhydrase, chloroplastic...  94.0    5e-20   
ref|XP_010232071.1|  PREDICTED: carbonic anhydrase, chloroplastic...  94.0    5e-20   
ref|XP_002522651.1|  carbonic anhydrase, putative                     94.7    5e-20   
ref|XP_009150514.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  94.7    5e-20   
ref|XP_009366308.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  94.4    6e-20   
ref|XP_009366307.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  94.4    6e-20   
gb|AFW83402.1|  hypothetical protein ZEAMMB73_627637                  90.5    6e-20   
gb|ADD65763.1|  putative carbonic anhydrase                           94.0    6e-20   
emb|CDM83497.1|  unnamed protein product                              94.0    6e-20   
ref|XP_006341013.1|  PREDICTED: carbonic anhydrase 2, chloroplast...  94.4    7e-20   
gb|AGT17160.1|  carbonic anhydrase                                    92.8    7e-20   
ref|XP_004246441.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.6    7e-20   
sp|P40880.1|CAHC_HORVU  RecName: Full=Carbonic anhydrase, chlorop...  94.0    8e-20   
emb|CDX84518.1|  BnaC03g49820D                                        95.1    9e-20   
ref|XP_004246438.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.6    1e-19   
ref|XP_010325847.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.6    1e-19   
gb|AFW83401.1|  hypothetical protein ZEAMMB73_627637                  89.4    1e-19   
ref|XP_008373206.1|  PREDICTED: carbonic anhydrase 2 isoform X1       93.6    1e-19   
ref|XP_009792595.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.6    1e-19   
ref|XP_004246439.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.6    1e-19   
ref|XP_010101209.1|  Carbonic anhydrase 2                             93.2    1e-19   
ref|XP_008373207.1|  PREDICTED: carbonic anhydrase 2 isoform X2       93.6    1e-19   
ref|XP_004246440.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  93.2    1e-19   
gb|ACN26857.1|  unknown                                               92.0    1e-19   
ref|NP_001147846.1|  carbonic anhydrase                               92.8    1e-19   
ref|NP_001151431.1|  LOC100285064                                     92.0    1e-19   
gb|ACF78806.1|  unknown                                               92.8    2e-19   
ref|XP_009792594.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  92.8    2e-19   
ref|XP_007036209.1|  Carbonic anhydrase 2, CA2                        92.4    2e-19   
ref|XP_011087942.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  92.0    3e-19   
ref|XP_008672557.1|  PREDICTED: uncharacterized protein LOC100275...  94.0    3e-19   
ref|XP_011087941.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  92.4    3e-19   
gb|EYU18430.1|  hypothetical protein MIMGU_mgv1a010730mg              92.4    3e-19   
gb|ABK26951.1|  unknown                                               91.7    5e-19   
gb|ACU23311.1|  unknown                                               91.7    5e-19   
emb|CBI24044.3|  unnamed protein product                              92.0    6e-19   
ref|XP_003545722.1|  PREDICTED: carbonic anhydrase, chloroplastic...  91.7    6e-19   
ref|XP_006597362.1|  PREDICTED: carbonic anhydrase, chloroplastic...  91.7    6e-19   
gb|KHN33561.1|  Carbonic anhydrase, chloroplastic                     91.7    6e-19   
gb|ACF78735.1|  unknown                                               92.0    7e-19   
gb|EPS63715.1|  hypothetical protein M569_11069                       89.0    7e-19   
gb|AFK46145.1|  unknown                                               91.3    8e-19   
ref|XP_010664393.1|  PREDICTED: beta carbonic anhydrase 6, mitoch...  91.3    8e-19   
ref|XP_010648128.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  90.9    8e-19   
ref|XP_004485609.1|  PREDICTED: carbonic anhydrase, chloroplastic...  91.3    8e-19   
ref|XP_002964535.1|  hypothetical protein SELMODRAFT_25779            89.7    8e-19   
ref|XP_008672558.1|  PREDICTED: uncharacterized protein LOC100275...  92.4    8e-19   
ref|XP_003543141.1|  PREDICTED: carbonic anhydrase, chloroplastic...  91.3    8e-19   
ref|XP_010664390.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  91.3    9e-19   
ref|XP_010664392.1|  PREDICTED: beta carbonic anhydrase 6, mitoch...  90.9    9e-19   
ref|XP_010664391.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  91.3    9e-19   
ref|XP_010254501.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  91.3    1e-18   
ref|XP_010254502.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  91.3    1e-18   
ref|XP_010664386.1|  PREDICTED: beta carbonic anhydrase 3-like is...  91.7    1e-18   
emb|CDO97393.1|  unnamed protein product                              90.9    1e-18   
ref|NP_001043676.1|  Os01g0639900                                     90.9    1e-18   
ref|XP_010664387.1|  PREDICTED: beta carbonic anhydrase 3-like is...  91.3    1e-18   
ref|XP_010664389.1|  PREDICTED: beta carbonic anhydrase 3-like is...  91.3    1e-18   
gb|KFK28127.1|  hypothetical protein AALP_AA8G476000                  91.7    1e-18   
ref|NP_001146832.1|  carbonic anhydrase                               92.8    1e-18   
ref|XP_010648126.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  90.9    1e-18   
ref|XP_010648127.1|  PREDICTED: beta carbonic anhydrase 5, chloro...  90.9    1e-18   



>dbj|BAA25639.1| NPCA1 [Nicotiana paniculata]
Length=322

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  44   LIRNEPVFAAPTPIINPILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  103

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  104  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHV  163

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  164  LNFQPGEAFVVRNIANMV  181



>ref|XP_009614638.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
 sp|P27141.1|CAHC_TOBAC RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Flags: Precursor [Nicotiana tabacum]
 gb|AAA34065.1| chloroplast carbonic anhydrase [Nicotiana tabacum]
 prf||1909357A carbonic anhydrase
Length=321

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  43   LIRNEPVFAAPTPIINPILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  102

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  103  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHV  162

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  163  LNFQPGEAFVVRNIANMV  180



>ref|XP_009614637.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=333

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  43   LIRNEPVFAAPTPIINPILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  102

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  103  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHV  162

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  163  LNFQPGEAFVVRNIANMV  180



>ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Solanum tuberosum]
 dbj|BAM15483.1| carbonic anhydrase, partial [Solanum tuberosum]
Length=321

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 9/141 (6%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++    RE+M K +Y +AI  L K+LSEK E G +AAA +++IT
Sbjct  40   IPSLIRNEPVFAAPTPIINPIVREEMAKESYDQAIAALEKLLSEKAELGPVAAARVDQIT  99

Query  228  AELQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            AEL+++D      P + +K GF+HFKTEKY+ N ALYGELAKGQSPKFMVFAC+DSRVCP
Sbjct  100  AELKSADGSKAFDPVEHMKAGFIHFKTEKYDTNPALYGELAKGQSPKFMVFACSDSRVCP  159

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVL+FQPGEAF+VRNIANMV
Sbjct  160  SHVLNFQPGEAFMVRNIANMV  180



>ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum]
 emb|CAH60891.1| carbonic anhydrase [Solanum lycopersicum]
Length=321

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 9/141 (6%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++    RE+M K +Y +AI  L K+LSEK E G +AAA +++IT
Sbjct  40   IPSLIRNEPVFAAPTPIINPIVREEMAKESYDQAIAALEKLLSEKAELGPVAAARVDQIT  99

Query  228  AELQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            AEL+++D      P + +K GF+HFKTEKY+ N ALYGELAKGQSPKFMVFAC+DSRVCP
Sbjct  100  AELKSADGGKAFDPVEHMKAGFIHFKTEKYDTNPALYGELAKGQSPKFMVFACSDSRVCP  159

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVL+FQPGEAF+VRNIANMV
Sbjct  160  SHVLNFQPGEAFMVRNIANMV  180



>ref|XP_010315870.1| PREDICTED: carbonic anhydrase isoform X1 [Solanum lycopersicum]
Length=333

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 9/141 (6%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++    RE+M K +Y +AI  L K+LSEK E G +AAA +++IT
Sbjct  40   IPSLIRNEPVFAAPTPIINPIVREEMAKESYDQAIAALEKLLSEKAELGPVAAARVDQIT  99

Query  228  AELQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            AEL+++D      P + +K GF+HFKTEKY+ N ALYGELAKGQSPKFMVFAC+DSRVCP
Sbjct  100  AELKSADGGKAFDPVEHMKAGFIHFKTEKYDTNPALYGELAKGQSPKFMVFACSDSRVCP  159

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVL+FQPGEAF+VRNIANMV
Sbjct  160  SHVLNFQPGEAFMVRNIANMV  180



>ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=333

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 9/141 (6%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++    RE+M K +Y +AI  L K+LSEK E G +AAA +++IT
Sbjct  40   IPSLIRNEPVFAAPTPIINPIVREEMAKESYDQAIAALEKLLSEKAELGPVAAARVDQIT  99

Query  228  AELQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            AEL+++D      P + +K GF+HFKTEKY+ N ALYGELAKGQSPKFMVFAC+DSRVCP
Sbjct  100  AELKSADGSKAFDPVEHMKAGFIHFKTEKYDTNPALYGELAKGQSPKFMVFACSDSRVCP  159

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVL+FQPGEAF+VRNIANMV
Sbjct  160  SHVLNFQPGEAFMVRNIANMV  180



>gb|EYU44749.1| hypothetical protein MIMGU_mgv1a009344mg [Erythranthe guttata]
Length=333

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 108/139 (78%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPT----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP      LL+EDM K +Y EAI  L K+LSE  E G +AAA I+EITAEL
Sbjct  54   LIRNEPVFAAPAPIIHPLLKEDMGKDSYEEAIAALGKLLSENGELGPVAAARIDEITAEL  113

Query  219  QTSDAPT------QQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            +T D         +++K GF+HFK EKYE+N ALYGELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  114  KTVDGSVSSSESIERLKTGFIHFKKEKYEQNPALYGELAKGQSPKFMVFACSDSRVCPSH  173

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRNIANMV
Sbjct  174  VLDFQPGEAFVVRNIANMV  192



>gb|AEK25173.1| chloroplast carbonic anhydrase [Dimocarpus longan]
Length=321

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 11/141 (8%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+LSEK E   +AAA + +ITA
Sbjct  41   PSLIRNEPVFAAPAPIINPTWREDMANKSYEEAIEALKKLLSEKDELKPVAAAKVEQITA  100

Query  225  ELQTS------DAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            +LQT+      DA  +++K+GF+HFK EKYEKN ALYGELAKGQSPKFMVFAC+DSRVCP
Sbjct  101  QLQTTADGKPFDA-VERMKDGFIHFKREKYEKNPALYGELAKGQSPKFMVFACSDSRVCP  159

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPGEAFVVRN+AN+V
Sbjct  160  SHVLDFQPGEAFVVRNVANIV  180



>gb|EYU44748.1| hypothetical protein MIMGU_mgv1a009344mg [Erythranthe guttata]
Length=345

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 108/139 (78%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPT----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP      LL+EDM K +Y EAI  L K+LSE  E G +AAA I+EITAEL
Sbjct  54   LIRNEPVFAAPAPIIHPLLKEDMGKDSYEEAIAALGKLLSENGELGPVAAARIDEITAEL  113

Query  219  QTSDAPT------QQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            +T D         +++K GF+HFK EKYE+N ALYGELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  114  KTVDGSVSSSESIERLKTGFIHFKKEKYEQNPALYGELAKGQSPKFMVFACSDSRVCPSH  173

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRNIANMV
Sbjct  174  VLDFQPGEAFVVRNIANMV  192



>ref|XP_009801258.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=333

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M   +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  43   LIRNEPVFAAPTPIINPILREEMANESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  102

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPK+MVFAC+DSRVCPSH+
Sbjct  103  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKYMVFACSDSRVCPSHI  162

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  163  LNFQPGEAFVVRNIANMV  180



>gb|KDO66180.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=190

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_009801266.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M   +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  43   LIRNEPVFAAPTPIINPILREEMANESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  102

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPK+MVFAC+DSRVCPSH+
Sbjct  103  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKYMVFACSDSRVCPSHI  162

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  163  LNFQPGEAFVVRNIANMV  180



>gb|AAL51055.2|AF454759_1 beta-carbonic anhydrase [Nicotiana tabacum]
Length=321

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M   +Y +AI  L K+LSEK E G IAAA +++ITAEL
Sbjct  43   LIRNEPVFAAPTPIINPILREEMANESYEQAIAALEKLLSEKGELGPIAAARVDQITAEL  102

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            Q+SD      P + +K GF+HFKTEKYEKN ALYGEL+KGQSPK+MVFAC+DSRVCPSH+
Sbjct  103  QSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKYMVFACSDSRVCPSHI  162

Query  54   LDFQPGEAFVVRNIANMV  1
            L+FQPGEAFVVRNIANMV
Sbjct  163  LNFQPGEAFVVRNIANMV  180



>ref|XP_006369914.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 ref|XP_006369915.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66483.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66484.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=218

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K E   +AAA + +IT
Sbjct  52   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEELKTVAAAKVEQIT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  111  AELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  171  CPSHVLDFQPGEAFVLRNVANMV  193



>ref|XP_008443520.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Cucumis melo]
Length=332

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 10/142 (7%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI+N PV+AAP  ++    REDM  G+Y EAIE L K+L EK +  A A + + +IT
Sbjct  50   FPNLIQNRPVFAAPSPIITPTWREDMGNGSYEEAIEALEKLLREKGDLKATATSKVEQIT  109

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D       P ++IK GF+HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVC
Sbjct  110  AELKTADGEKPAFDPVERIKTGFIHFKKEKYDKNPELYGELAKGQSPKFMVFACSDSRVC  169

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRN+AN+V
Sbjct  170  PSHVLDFQPGEAFVVRNVANLV  191



>gb|KDO66178.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66179.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=209

 Score =   174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_008443519.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Cucumis melo]
Length=343

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 10/142 (7%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI+N PV+AAP  ++    REDM  G+Y EAIE L K+L EK +  A A + + +IT
Sbjct  50   FPNLIQNRPVFAAPSPIITPTWREDMGNGSYEEAIEALEKLLREKGDLKATATSKVEQIT  109

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D       P ++IK GF+HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVC
Sbjct  110  AELKTADGEKPAFDPVERIKTGFIHFKKEKYDKNPELYGELAKGQSPKFMVFACSDSRVC  169

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRN+AN+V
Sbjct  170  PSHVLDFQPGEAFVVRNVANLV  191



>ref|XP_004158317.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Cucumis sativus]
Length=331

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLLR----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI+N PV+AAP  L+     EDM  G+Y EAIE L K+L EK +  A A + + +IT
Sbjct  49   FPNLIQNRPVFAAPSPLITPTWTEDMANGSYEEAIEALEKLLREKGDLKATATSKVAQIT  108

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D       P ++IK GF+HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVC
Sbjct  109  AELKTADGEKPAFDPVERIKTGFIHFKKEKYDKNPELYGELAKGQSPKFMVFACSDSRVC  168

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRN+AN+V
Sbjct  169  PSHVLDFQPGEAFVVRNVANLV  190



>ref|XP_004141091.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Cucumis sativus]
Length=328

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLLR----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI+N PV+AAP  L+     EDM  G+Y EAIE L K+L EK +  A A + + +IT
Sbjct  46   FPNLIQNRPVFAAPSPLITPTWTEDMANGSYEEAIEALEKLLREKGDLKATATSKVAQIT  105

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D       P ++IK GF+HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVC
Sbjct  106  AELKTADGEKPAFDPVERIKTGFIHFKKEKYDKNPELYGELAKGQSPKFMVFACSDSRVC  165

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRN+AN+V
Sbjct  166  PSHVLDFQPGEAFVVRNVANLV  187



>gb|KGN59668.1| hypothetical protein Csa_3G836520 [Cucumis sativus]
Length=330

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLLR----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI+N PV+AAP  L+     EDM  G+Y EAIE L K+L EK +  A A + + +IT
Sbjct  48   FPNLIQNRPVFAAPSPLITPTWTEDMANGSYEEAIEALEKLLREKGDLKATATSKVAQIT  107

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D       P ++IK GF+HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVC
Sbjct  108  AELKTADGEKPAFDPVERIKTGFIHFKKEKYDKNPELYGELAKGQSPKFMVFACSDSRVC  167

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRN+AN+V
Sbjct  168  PSHVLDFQPGEAFVVRNVANLV  189



>ref|XP_006369919.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66488.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=283

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K E   +AAA + +IT
Sbjct  52   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEELKTVAAAKVEQIT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  111  AELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  171  CPSHVLDFQPGEAFVLRNVANMV  193



>gb|KDO66175.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=243

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_006446500.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59740.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66176.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66177.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=254

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|ABK96524.1| unknown [Populus trichocarpa x Populus deltoides]
Length=321

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LSEK E   +AAA + +IT
Sbjct  39   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSEKDELKTVAAAKVEQIT  97

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  98   AELQTTSSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  157

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  158  CPSHVLDFQPGEAFVLRNVANMV  180



>ref|XP_002524642.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF37661.1| carbonic anhydrase, putative [Ricinus communis]
Length=326

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K  Y EAIE L+K+LSEK E  A A A + +ITAEL
Sbjct  47   LIRNEPVFAAPAPIINPSLREEMGKEAYDEAIEALKKLLSEKGELKAEATAKVEQITAEL  106

Query  219  QTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            QT+ +      P +++K GF+HFK EKY+KN  LY EL+KGQSPKFMVFAC+DSRVCPSH
Sbjct  107  QTASSDSKPFNPVERMKEGFIHFKKEKYDKNPGLYSELSKGQSPKFMVFACSDSRVCPSH  166

Query  57   VLDFQPGEAFVVRNIANMV  1
            +LDFQPGEAFVVRN+ANMV
Sbjct  167  ILDFQPGEAFVVRNVANMV  185



>gb|AAC49785.1| carbonic anhydrase [Populus tremula x Populus tremuloides]
Length=320

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 10/141 (7%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL---REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  +L   R +    +Y EAIE L+K+LS+K E   +AAA + +ITAE
Sbjct  39   PTLIRNQPVFAAPAPILYPRRGEEMGNDYNEAIESLKKLLSDKEELKTVAAAKVEQITAE  98

Query  222  LQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            LQT  +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRVCP
Sbjct  99   LQTVSSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRVCP  158

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPGEAFVVRN+ANMV
Sbjct  159  SHVLDFQPGEAFVVRNVANMV  179



>gb|KDO66174.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=271

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|KDO66173.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=268

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|AAB65822.1| carbonic anhydrase [Populus tremula x Populus tremuloides]
Length=320

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 10/141 (7%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL---REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  +L   R +    +Y EAIE L+K+LS+K E   +AAA + +ITAE
Sbjct  39   PTLIRNQPVFAAPAPILYPRRGEEMGNDYNEAIESLKKLLSDKEELKTVAAAKVEQITAE  98

Query  222  LQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            LQT  +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRVCP
Sbjct  99   LQTVSSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRVCP  158

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPGEAFVVRN+ANMV
Sbjct  159  SHVLDFQPGEAFVVRNVANMV  179



>ref|XP_011047313.1| PREDICTED: carbonic anhydrase 2 [Populus euphratica]
Length=332

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K +   +AAA + +IT
Sbjct  39   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEDLKTVAAAKVEQIT  97

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  98   AELQTASSSDPKAFEPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  157

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+ANMV
Sbjct  158  CPSHVLDFQPGEAFVVRNVANMV  180



>ref|XP_006369917.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66486.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=335

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K E   +AAA + +IT
Sbjct  52   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEELKTVAAAKVEQIT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  111  AELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  171  CPSHVLDFQPGEAFVLRNVANMV  193



>ref|XP_006369916.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66485.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=334

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K E   +AAA + +IT
Sbjct  52   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEELKTVAAAKVEQIT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  111  AELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  171  CPSHVLDFQPGEAFVLRNVANMV  193



>ref|XP_002298524.2| carbonic anhydrase isoform 1 family protein [Populus trichocarpa]
 gb|EEE83329.2| carbonic anhydrase isoform 1 family protein [Populus trichocarpa]
Length=345

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 13/143 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLR-----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  +L      E+M K +Y EAIE L+K+LS+K E   +AAA + +IT
Sbjct  52   PTLIRNQPVFAAPAPILYPPRRGEEMGK-DYNEAIESLKKLLSDKEELKTVAAAKVEQIT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT+ +       P ++IK+GF+HFK EKY+KN  LY ELAKGQSPKFMVFAC+DSRV
Sbjct  111  AELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSELAKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFV+RN+ANMV
Sbjct  171  CPSHVLDFQPGEAFVLRNVANMV  193



>gb|ABI14813.1| chloroplast carbonic anhydrase [Pachysandra terminalis]
Length=324

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 8/136 (6%)
 Frame = -1

Query  384  IRNHPVYAAP-PTL---LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ  217
            IR  PV+AAP P +   LREDM K +Y EAI  L+K+LSEK +  A+AAA I +ITAELQ
Sbjct  48   IRKEPVFAAPAPYITPNLREDMGKDSYEEAIAGLKKLLSEKGDLDAVAAAKIEQITAELQ  107

Query  216  TSDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLD  49
            T+++    P +++K GF+HFK EKYE N AL+GELAKGQSPKFMVFAC+DSRVCPSHVLD
Sbjct  108  TTESKAFDPIERMKTGFIHFKKEKYETNPALFGELAKGQSPKFMVFACSDSRVCPSHVLD  167

Query  48   FQPGEAFVVRNIANMV  1
            FQPGEAF+VRNIANMV
Sbjct  168  FQPGEAFMVRNIANMV  183



>gb|KDO66164.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66165.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=311

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|KDO66171.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=312

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|KDO66170.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=321

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_002277957.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
 emb|CBI34917.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 10/141 (7%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LI+N PV+AAP  ++    REDM  G+Y EA+E LRK+L EK     +AAA I++ITA
Sbjct  43   PNLIQNKPVFAAPAPIITPTWREDMGNGSYDEAVEGLRKLLREKANLEPVAAAKIDQITA  102

Query  225  ELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            +L++SD       P +++K GF++FK EKY+KN AL+ ELAKGQSPKFMVFAC+DSRVCP
Sbjct  103  QLKSSDGSSSPFDPVERMKTGFIYFKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCP  162

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPG+AFVVRN+ANMV
Sbjct  163  SHVLDFQPGDAFVVRNVANMV  183



>ref|XP_006446502.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59742.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66167.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66168.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66169.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=322

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_011098474.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Sesamum indicum]
Length=327

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 11/142 (8%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPT----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP      LLREDM K +Y EAI  L+K+LSEK E G +AAA I EITA
Sbjct  45   PSLIRNEPVFAAPAPIIHPLLREDMGKDSYEEAIAALQKLLSEKGELGPVAAAKIGEITA  104

Query  225  ELQTSDAP-------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            ELQT+D          +++KNGF+HFK EKYEK   LY ELA+GQSP +MVFAC+DSRVC
Sbjct  105  ELQTADGSATLNSESVEKLKNGFIHFKREKYEKQPGLYTELARGQSPTYMVFACSDSRVC  164

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVL+  PGEAF+VRNIANMV
Sbjct  165  PSHVLNLHPGEAFMVRNIANMV  186



>gb|KDO66166.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=329

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_011098473.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Sesamum indicum]
Length=339

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 11/142 (8%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPT----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP      LLREDM K +Y EAI  L+K+LSEK E G +AAA I EITA
Sbjct  45   PSLIRNEPVFAAPAPIIHPLLREDMGKDSYEEAIAALQKLLSEKGELGPVAAAKIGEITA  104

Query  225  ELQTSDAP-------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            ELQT+D          +++KNGF+HFK EKYEK   LY ELA+GQSP +MVFAC+DSRVC
Sbjct  105  ELQTADGSATLNSESVEKLKNGFIHFKREKYEKQPGLYTELARGQSPTYMVFACSDSRVC  164

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVL+  PGEAF+VRNIANMV
Sbjct  165  PSHVLNLHPGEAFMVRNIANMV  186



>ref|XP_006446503.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59743.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66162.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66163.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=334

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPVFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_007031477.1| Carbonic anhydrase 1 isoform 2 [Theobroma cacao]
 gb|EOY02403.1| Carbonic anhydrase 1 isoform 2 [Theobroma cacao]
Length=321

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 12/143 (8%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL-----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP  LL      E+M   +Y EAIE L+K++SEK E  A AAA +N+IT
Sbjct  38   PTLIRNQPVFAAPAPLLVPSNWNEEMGSKSYEEAIEALKKLMSEKGELKASAAAKVNQIT  97

Query  228  AELQT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AEL+T       SDA  +++K GF++FK EKYEKN ALY ELAKGQSPK+MV AC+DSRV
Sbjct  98   AELKTASSDGKPSDASVERLKEGFIYFKREKYEKNPALYAELAKGQSPKYMVVACSDSRV  157

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLD QPGEAFVVRN+ANMV
Sbjct  158  CPSHVLDMQPGEAFVVRNVANMV  180



>ref|XP_010551901.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=341

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++    RE M   +Y EAIE L+K+L EK E    AAA +  IT
Sbjct  47   VPSLIRNEPVFAAPAPIITPSWREGMGNESYEEAIEALKKLLIEKGELDEEAAAKMGPIT  106

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A+ QT  +       P ++IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRV
Sbjct  107  AQAQTGSSSDSKPFDPVERIKQGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRV  166

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+AN+V
Sbjct  167  CPSHVLDFQPGEAFVVRNVANIV  189



>ref|XP_006470326.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=334

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN P++AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPLFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK+GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>ref|XP_006470327.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Citrus sinensis]
Length=322

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN P++AAP  ++    REDM   +Y EAIE L+K+L EK +   +AAA + +ITA
Sbjct  42   PSLIRNEPLFAAPAPIINPNWREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITA  101

Query  225  ELQT-SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT SD       ++IK+GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPS
Sbjct  102  QLQTPSDTKAFDSVERIKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  162  HVLDFQPGEAFVVRNVANIV  181



>gb|AAD29049.1|AF132854_1 carbonic anhydrase isoform 1 [Gossypium hirsutum]
Length=322

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL--REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            P LI++ PV+AAP  LL  RE+M   +Y EAIE L+K+LSEK E  A AAA +++ITAEL
Sbjct  42   PTLIQDRPVFAAPVPLLTPREEMGNKSYDEAIEALKKLLSEKGELKAEAAARVDQITAEL  101

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       SD+  +++K GFV+FK EKYEKN ALYGELAKGQSPK+M+ AC+DSRVCPS
Sbjct  102  NTTSADGKPSDSSVERLKEGFVYFKKEKYEKNPALYGELAKGQSPKYMIVACSDSRVCPS  161

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLD QPGEAFVVRN+ANMV
Sbjct  162  HVLDMQPGEAFVVRNVANMV  181



>gb|KHG25181.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=326

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL--REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            P LI++ PV+AAP  LL  RE+M   +Y EAIE L+K+LSEK E  A AAA +++ITAEL
Sbjct  46   PTLIQDRPVFAAPVPLLTPREEMGNKSYDEAIEALKKLLSEKGELKAEAAARVDQITAEL  105

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       SD+  +++K GFV+FK EKYEKN ALYGELAKGQSPK+M+ AC+DSRVCPS
Sbjct  106  NTTSADGKPSDSSVERLKEGFVYFKKEKYEKNPALYGELAKGQSPKYMIVACSDSRVCPS  165

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLD QPGEAFVVRN+ANMV
Sbjct  166  HVLDMQPGEAFVVRNVANMV  185



>gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum]
Length=264

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 5/121 (4%)
 Frame = -1

Query  348  LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKN  184
            +LRE+M K +Y +AI  L K+LSEK E G IAAA +++ITAELQ+SD      P + +K 
Sbjct  3    ILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAELQSSDGSKPFDPVEHMKA  62

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF+HFKTEKYEKN ALYGEL+KGQSPKFMVFAC+DSRVCPSHVL+FQPGEAFVVRNIANM
Sbjct  63   GFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANM  122

Query  3    V  1
            +
Sbjct  123  I  123



>gb|AAM22683.1|AF482951_1 carbonic anhydrase [Gossypium hirsutum]
Length=326

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL--REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            P LI++ PV+AAP  LL  RE+M   +Y EAIE L+K+LSEK E  A AAA +++ITAEL
Sbjct  46   PTLIQDRPVFAAPIPLLTPREEMGNKSYDEAIEALKKLLSEKGELKAEAAARVDQITAEL  105

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       SD+  +++K GFV+FK EKYEKN ALYGELAKGQSPK+M+ AC+DSRVCPS
Sbjct  106  NTASADGKPSDSSVERLKEGFVYFKKEKYEKNPALYGELAKGQSPKYMIVACSDSRVCPS  165

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLD QPGEAFVVRN+ANMV
Sbjct  166  HVLDMQPGEAFVVRNVANMV  185



>gb|KHG25180.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=338

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL--REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            P LI++ PV+AAP  LL  RE+M   +Y EAIE L+K+LSEK E  A AAA +++ITAEL
Sbjct  46   PTLIQDRPVFAAPVPLLTPREEMGNKSYDEAIEALKKLLSEKGELKAEAAARVDQITAEL  105

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       SD+  +++K GFV+FK EKYEKN ALYGELAKGQSPK+M+ AC+DSRVCPS
Sbjct  106  NTTSADGKPSDSSVERLKEGFVYFKKEKYEKNPALYGELAKGQSPKYMIVACSDSRVCPS  165

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLD QPGEAFVVRN+ANMV
Sbjct  166  HVLDMQPGEAFVVRNVANMV  185



>gb|AAD29050.1|AF132855_1 carbonic anhydrase isoform 2 [Gossypium hirsutum]
Length=319

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL--REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            P LI++ PV+AAP  LL  RE+M   +Y EAIE L+K+LSEK E  A AAA +++ITAEL
Sbjct  39   PTLIQDRPVFAAPIPLLTPREEMGNKSYDEAIEALKKLLSEKGELKAEAAARVDQITAEL  98

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       SD+  +++K GFV+FK EKYEKN ALYGELAKGQSPK+M+ AC+DSRVCPS
Sbjct  99   NTASADGKPSDSSVERLKEGFVYFKKEKYEKNPALYGELAKGQSPKYMIVACSDSRVCPS  158

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLD QPGEAFVVRN+ANMV
Sbjct  159  HVLDMQPGEAFVVRNVANMV  178



>ref|XP_010687996.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 108/142 (76%), Gaps = 15/142 (11%)
 Frame = -1

Query  393  PRLIRNHPVYAAP-----PTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP     PTL +EDM    Y E+I  L+++L E  E    AAA + +IT
Sbjct  47   PALIRNEPVFAAPTPIITPTL-KEDMA---YEESIAALKRLLIENGELENEAAAKVAQIT  102

Query  228  AELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVC  67
            AEL+T+D+      P ++IK GF+HFK EKYEKN ALYGELAKGQSPKFMVFAC+DSRVC
Sbjct  103  AELKTADSKPVASEPVERIKQGFIHFKREKYEKNPALYGELAKGQSPKFMVFACSDSRVC  162

Query  66   PSHVLDFQPGEAFVVRNIANMV  1
            PSHVLDFQPGEAFVVRNIA+MV
Sbjct  163  PSHVLDFQPGEAFVVRNIASMV  184



>gb|KDP45339.1| hypothetical protein JCGZ_09588 [Jatropha curcas]
Length=336

 Score =   169 bits (429),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 110/141 (78%), Gaps = 10/141 (7%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    R++M K +Y EAIE L+K+LSEK E  A AAA + +ITA
Sbjct  44   PTLIRNEPVFAAPAPIINPNWRKEMGKDSYEEAIEALKKLLSEKGELKATAAARVEQITA  103

Query  225  ELQTSDAPT------QQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
            ELQT+ + +      +++K GF++FK EKY+KN  LY EL+KGQSPKFMVFAC+DSRVCP
Sbjct  104  ELQTASSDSKPFDAVERMKEGFIYFKKEKYDKNPGLYTELSKGQSPKFMVFACSDSRVCP  163

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPGEAFVVRN+ANMV
Sbjct  164  SHVLDFQPGEAFVVRNVANMV  184



>dbj|BAH56801.1| AT3G01500 [Arabidopsis thaliana]
Length=290

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  53   VPTLIRNEPVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQIT  112

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  113  AALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  172

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPG+AFVVRNIANMV
Sbjct  173  CPSHVLDFQPGDAFVVRNIANMV  195



>ref|XP_006408513.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49966.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=331

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  48   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYQEAIEALKKLLIEKEELKTVAAAKVEQIT  107

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  108  AELQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  168  CPSHVLNFQPGEAFVVRNIANMV  190



>ref|XP_006408514.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 dbj|BAJ33678.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49967.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=342

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  48   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYQEAIEALKKLLIEKEELKTVAAAKVEQIT  107

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  108  AELQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  168  CPSHVLNFQPGEAFVVRNIANMV  190



>ref|XP_002882178.1| hypothetical protein ARALYDRAFT_477371 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58437.1| hypothetical protein ARALYDRAFT_477371 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  52   VPTLIRNEPVFAAPAPIIAPYWSEEMGSDAYEEAIEALKKLLIEKEELKTVAAAKVEQIT  111

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  112  AALQTGTSSDKKAFDPVENIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  171

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPG+AFVVRNIANMV
Sbjct  172  CPSHVLDFQPGDAFVVRNIANMV  194



>ref|NP_850491.1| carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AAF01535.1|AC009325_5 carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 emb|CAA46508.1| carbonic anhydrase [Arabidopsis thaliana]
 gb|AAL07024.1| putative carbonic anhydrase, chloroplast precursor [Arabidopsis 
thaliana]
 gb|AAL32863.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 gb|AAM10220.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 dbj|BAE98589.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
 gb|AEE73677.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=336

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  53   VPTLIRNEPVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQIT  112

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  113  AALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  172

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPG+AFVVRNIANMV
Sbjct  173  CPSHVLDFQPGDAFVVRNIANMV  195



>ref|XP_010108776.1| Carbonic anhydrase [Morus notabilis]
 gb|EXC20291.1| Carbonic anhydrase [Morus notabilis]
Length=332

 Score =   167 bits (422),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LREDM K +Y EAI  L+K+LSEK +   +AA+ + +ITAEL
Sbjct  42   LIRNKPVFAAPAPIITPTLREDMGKESYEEAIAALQKLLSEKGDLKPVAASKVEQITAEL  101

Query  219  QT-SDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            Q+ +D      P ++IK+GF+ FK EKY+ N ALY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  102  QSPADGKPDFDPVERIKSGFIKFKKEKYDANPALYSELAKGQSPKFMVFACSDSRVCPSH  161

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+AN+V
Sbjct  162  VLDFQPGEAFVVRNVANIV  180



>ref|NP_186799.2| carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|P27140.2|BCA1_ARATH RecName: Full=Beta carbonic anhydrase 1, chloroplastic; Short=AtbCA1; 
Short=AtbetaCA1; AltName: Full=Beta carbonate dehydratase 
1; AltName: Full=Protein SALICYLIC ACID-BINDING PROTEIN 
3; Short=AtSABP3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16116.1|AF428284_1 AT3g01500/F4P13_5 [Arabidopsis thaliana]
 gb|AAL16228.1|AF428459_1 AT3g01500/F4P13_5 [Arabidopsis thaliana]
 gb|AEE73675.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=347

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  53   VPTLIRNEPVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQIT  112

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  113  AALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  172

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPG+AFVVRNIANMV
Sbjct  173  CPSHVLDFQPGDAFVVRNIANMV  195



>sp|P16016.2|CAHC_SPIOL RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Flags: Precursor [Spinacia oleracea]
 gb|AAA34027.1| carbonic anhydrase (EC 4.2.1.1) [Spinacia oleracea]
Length=319

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 105/140 (75%), Gaps = 12/140 (9%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  +    L+EDM    Y EAI  L+K+LSEK E    AA+ + +IT+
Sbjct  42   PSLIRNQPVFAAPAPIITPTLKEDMA---YEEAIAALKKLLSEKGELENEAASKVAQITS  98

Query  225  ELQ-----TSDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            EL      ++  P Q+IK GF+ FK EKYEKN ALYGEL+KGQ+PKFMVFAC+DSRVCPS
Sbjct  99   ELADGGTPSASYPVQRIKEGFIKFKKEKYEKNPALYGELSKGQAPKFMVFACSDSRVCPS  158

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAF+VRNIANMV
Sbjct  159  HVLDFQPGEAFMVRNIANMV  178



>ref|XP_004489274.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=344

 Score =   167 bits (422),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 111/145 (77%), Gaps = 14/145 (10%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPT-----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEI  232
             P LI++ PV+A+  +     +LRE+M KG Y EAIEEL+K+L EK E  A AA  + +I
Sbjct  49   FPSLIQDKPVFASSSSPIITPILREEMGKG-YEEAIEELQKLLREKNELKATAAEKVEQI  107

Query  231  TAEL---QTSDA-PT----QQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADS  76
            TA+L    TSD  PT    ++IK+GF+HFK EKY+KN ALYGELAKGQSP FMVFAC+DS
Sbjct  108  TAQLGTTSTSDGVPTSEASERIKSGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDS  167

Query  75   RVCPSHVLDFQPGEAFVVRNIANMV  1
            RVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  168  RVCPSHVLDFQPGEAFVVRNVANMV  192



>ref|XP_006408515.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49968.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=363

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  48   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYQEAIEALKKLLIEKEELKTVAAAKVEQIT  107

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  108  AELQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  168  CPSHVLNFQPGEAFVVRNIANMV  190



>ref|XP_004489275.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=333

 Score =   167 bits (422),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 111/145 (77%), Gaps = 14/145 (10%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPT-----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEI  232
             P LI++ PV+A+  +     +LRE+M KG Y EAIEEL+K+L EK E  A AA  + +I
Sbjct  49   FPSLIQDKPVFASSSSPIITPILREEMGKG-YEEAIEELQKLLREKNELKATAAEKVEQI  107

Query  231  TAEL---QTSDA-PT----QQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADS  76
            TA+L    TSD  PT    ++IK+GF+HFK EKY+KN ALYGELAKGQSP FMVFAC+DS
Sbjct  108  TAQLGTTSTSDGVPTSEASERIKSGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDS  167

Query  75   RVCPSHVLDFQPGEAFVVRNIANMV  1
            RVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  168  RVCPSHVLDFQPGEAFVVRNVANMV  192



>gb|ACU15535.1| unknown [Glycine max]
Length=224

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  49   LIQDRPVFAAPAPIITPTVREDMAK-EYEKAIEELQKLLREKSELKATAAEKVEQITASL  107

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       S   + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  108  GTLSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  167

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEA VVRN+AN+V
Sbjct  168  HVLDFQPGEALVVRNVANIV  187



>gb|ADZ97028.1| carbonic anhydrase 3 [Flaveria cronquistii]
Length=327

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  ++    R DM   +Y EAI  L+K+LSEK +   +AAA I++ITA+L
Sbjct  49   LIRNQPVFAAPTPIITPTVRGDMGSESYDEAIAALKKLLSEKEDLAHVAAAKIDQITAQL  108

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            QT DA       ++IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  109  QTPDAKPAFDAVERIKTGFSKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPSHV  168

Query  54   LDFQPGEAFVVRNIANMV  1
            LDFQPGEAFVVRN+ANMV
Sbjct  169  LDFQPGEAFVVRNVANMV  186



>ref|XP_006603810.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Glycine max]
Length=330

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  51   LIQDRPVFAAPAPIITPTVREDMAK-EYEQAIEELQKLLREKSELKATAAEKVEQITASL  109

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  110  GTSSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  169

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  170  HVLDFQPGEAFVVRNVANIV  189



>gb|KHN23534.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=331

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  52   LIQDRPVFAAPAPIITPTVREDMAK-EYEQAIEELQKLLREKSELKATAAEKVEQITASL  110

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  111  GTSSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  170

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  171  HVLDFQPGEAFVVRNVANIV  190



>ref|XP_003553834.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX2 [Glycine 
max]
Length=341

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  51   LIQDRPVFAAPAPIITPTVREDMAK-EYEQAIEELQKLLREKSELKATAAEKVEQITASL  109

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  110  GTSSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  169

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  170  HVLDFQPGEAFVVRNVANIV  189



>ref|XP_010029173.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Eucalyptus grandis]
Length=338

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 11/139 (8%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLLR----EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  ++     E+M K +Y EAIE L+K+LSEK +  A AAA + +ITAEL
Sbjct  49   LIRNEPVFAAPAPVINPTWTEEMGK-DYDEAIEALKKLLSEKGDLKATAAAKVEQITAEL  107

Query  219  QTSD------APTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            QT+       +   +IK GF  FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  108  QTASPDIKPSSSVDRIKTGFTFFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPSH  167

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  168  VLDFQPGEAFVVRNVANMV  186



>gb|AAS65454.1| chloroplast carbonic anhydrase precursor [Noccaea caerulescens]
Length=336

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M   +Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  53   VPTLIRNEPVFAAPAPIITPYWSEEMGTESYQEAIEALQKLLIEKEELKTVAAAKVEQIT  112

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKYE N AL+GELAKGQSPKFMVFAC+DSRV
Sbjct  113  AELQTGTSSDKKAFDPVETIKQGFITFKKEKYETNPALHGELAKGQSPKFMVFACSDSRV  172

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPG+AF+VRNIANMV
Sbjct  173  CPSHVLNFQPGDAFIVRNIANMV  195



>ref|XP_003524544.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X1 [Glycine 
max]
 gb|KHN27432.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=328

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  49   LIQDRPVFAAPAPIITPTVREDMAK-EYEKAIEELQKLLREKSELKATAAEKVEQITASL  107

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  108  GTSSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  167

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  168  HVLDFQPGEAFVVRNVANIV  187



>ref|XP_006579756.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X2 [Glycine 
max]
Length=339

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  49   LIQDRPVFAAPAPIITPTVREDMAK-EYEKAIEELQKLLREKSELKATAAEKVEQITASL  107

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK GF+HFK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  108  GTSSSDGIPSSEASDRIKAGFIHFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  167

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  168  HVLDFQPGEAFVVRNVANIV  187



>gb|ABC41658.1| carbonic anhydrase 3 [Flaveria pringlei]
Length=328

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  ++    R DM   +Y EAI  L+K+LSEK E   +AAA I+EITA+L
Sbjct  50   LIRNQPVFAAPTPIITPTVRGDMGSESYDEAIAALKKLLSEKEELAPVAAAKIDEITAQL  109

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            QT D        ++IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  110  QTLDTKPAFDAVERIKTGFAKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPSHV  169

Query  54   LDFQPGEAFVVRNIANMV  1
            LDFQPGEAFVVRN+AN+V
Sbjct  170  LDFQPGEAFVVRNVANIV  187



>ref|XP_004304623.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV+  P  +  EDM K NY EAI  L+K+LSEK +   +AA+ + +ITA+L T
Sbjct  48   PNLIQNKPVFTVPSPVPAEDMGK-NYEEAIAALQKLLSEKDDLKTVAASKVEQITAQLAT  106

Query  213  SDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            +DA      P ++IK GF+ FK EKY+ N ALYGELAKGQ+PKFM+FAC+DSRVCPSH+L
Sbjct  107  ADAGSNPFDPVERIKTGFIKFKKEKYDTNPALYGELAKGQAPKFMLFACSDSRVCPSHIL  166

Query  51   DFQPGEAFVVRNIANMV  1
            D QPGEAFVVRN+ANMV
Sbjct  167  DMQPGEAFVVRNVANMV  183



>gb|AFX73760.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26986.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26987.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFY26988.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K +Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  50   LIQDKPVFAAPSHIITPTVREDMAK-DYEQAIEELQKLLKEKTELKATAAEKVEQITASL  108

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK+GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  109  GTSSSDGIPSSKASDRIKSGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  168

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  169  HVLDFQPGEAFVVRNVANIV  188



>gb|AFX73761.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K +Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  50   LIQDKPVFAAPSHIITPTVREDMAK-DYEQAIEELQKLLKEKTELKATAAEKVEQITASL  108

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK+GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  109  GTSSSDGIPSSEASDRIKSGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  168

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  169  HVLDFQPGEAFVVRNVANIV  188



>gb|AFX73759.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K +Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  50   LIQDKPVFAAPSHIITPTVREDMAK-DYEQAIEELQKLLKEKTELKATAAEKVEQITASL  108

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK+GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  109  GTSSSGGIPSSKASDRIKSGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  168

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  169  HVLDFQPGEAFVVRNVANIV  188



>gb|ADZ97025.1| carbonic anhydrase 3 [Flaveria angustifolia]
Length=328

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 9/138 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  ++    R DM   +Y EAI  L+K+LSEK E   +AAA I+EITA+L
Sbjct  50   LIRNQPVFAAPTPIITPTVRGDMGSESYDEAIAALKKLLSEKEELAPVAAAKIDEITAQL  109

Query  219  QTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            QT D        ++IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPSHV
Sbjct  110  QTLDTKPAFDAVERIKTGFAKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPSHV  169

Query  54   LDFQPGEAFVVRNIANMV  1
            LDFQPGEAFVVRN+AN+V
Sbjct  170  LDFQPGEAFVVRNVANIV  187



>gb|AFX73762.1| carbonic anhydrase [Vigna unguiculata]
 gb|AFX73763.1| carbonic anhydrase [Vigna unguiculata]
Length=329

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K +Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  50   LIQDKPVFAAPSHIITPTVREDMAK-DYEQAIEELQKLLKEKTELKATAAEKVEQITASL  108

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK+GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  109  GTSSSDGIPSSEASDRIKSGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  168

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  169  HVLDFQPGEAFVVRNVANIV  188



>ref|XP_010496305.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Camelina 
sativa]
Length=332

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M   +Y EAIE L+K+L EK E   +AAA + +IT
Sbjct  49   VPTLIRNEPVFAAPAPIIAPYWSEEMGSESYNEAIEALKKLLIEKGELKTVAAAKVEQIT  108

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AEL+T  +       P + IK GF+ FK EKY+ N  L+GEL+KGQSPKFMVFAC+DSRV
Sbjct  109  AELKTGTSSDKKAFDPVEAIKQGFITFKKEKYDSNPELWGELSKGQSPKFMVFACSDSRV  168

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+ANMV
Sbjct  169  CPSHVLDFQPGEAFVVRNVANMV  191



>gb|ABC41659.1| carbonic anhydrase 3 [Flaveria linearis]
Length=331

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 9/140 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LIRN PV+AAP  ++    R DM   +Y EAI  L+K+LSE+ +   +AAA I+EIT+
Sbjct  51   PSLIRNQPVFAAPTPIITPTVRGDMGSESYDEAIAALKKLLSEREDLAPVAAAKIDEITS  110

Query  225  ELQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            +LQT D        ++IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPS
Sbjct  111  QLQTLDTKPAFDAVERIKTGFAKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPS  170

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  171  HVLDFQPGEAFVVRNVANIV  190



>ref|XP_009614639.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Nicotiana 
tomentosiformis]
Length=269

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M K +Y +AI  L K+LSEK E G IAAA +++ITAELQ+SD      P + +K GF+HF
Sbjct  1    MAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAELQSSDGSKPFDPVEHMKAGFIHF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KTEKYEKN ALYGEL+KGQSPKFMVFAC+DSRVCPSHVL+FQPGEAFVVRNIANMV
Sbjct  61   KTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMV  116



>emb|CCW28006.1| carbonic anhydrase [Petroselinum crispum]
Length=328

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 10/137 (7%)
 Frame = -1

Query  384  IRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ  217
            IRN PV+AAP  L    L EDM    Y EAI  L+K++SEK E G +AAA +++ITAEL+
Sbjct  52   IRNEPVFAAPAPLITPILGEDMGT-EYEEAIAGLKKLISEKGELGPVAAAKVDQITAELK  110

Query  216  TSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            T D      P +++K GF+ FK EKYE N ALY EL+KGQSPKFMVFAC+DSRVCPSHVL
Sbjct  111  TPDGGKAFDPVERLKTGFIKFKKEKYETNPALYEELSKGQSPKFMVFACSDSRVCPSHVL  170

Query  51   DFQPGEAFVVRNIANMV  1
            DFQPGEAFVVRN+ANMV
Sbjct  171  DFQPGEAFVVRNVANMV  187



>gb|ADZ97026.1| carbonic anhydrase 3 [Flaveria anomala]
Length=332

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -1

Query  384  IRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ  217
            IRN PV+AAP  ++    R DM   +Y EAI  L+K+LSEK+E   +AAA I+EITA+LQ
Sbjct  55   IRNQPVFAAPTPIITPTVRGDMGSESYDEAIAALKKLLSEKKELAPVAAAKIDEITAQLQ  114

Query  216  TSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            T D         +IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPSHVL
Sbjct  115  TLDTKPAFDAVDRIKTGFAKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPSHVL  174

Query  51   DFQPGEAFVVRNIANMV  1
            DFQPGEAFVVRN+AN+V
Sbjct  175  DFQPGEAFVVRNVANIV  191



>ref|XP_006298106.1| hypothetical protein CARUB_v10014147mg [Capsella rubella]
 gb|EOA31004.1| hypothetical protein CARUB_v10014147mg [Capsella rubella]
Length=334

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M   +Y EAIE L+K+L EK E   +AAA + + T
Sbjct  51   VPTLIRNEPVFAAPAPVIAPYWSEEMGSESYDEAIEALKKLLIEKEELKTVAAAKVEQAT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  111  AELQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSH+L+FQPG+AF+VRNIANMV
Sbjct  171  CPSHILNFQPGDAFMVRNIANMV  193



>gb|AEV42276.1| chloroplast beta carbonic anhydrase 1 [Mesembryanthemum nodiflorum]
Length=325

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 101/143 (71%), Gaps = 15/143 (10%)
 Frame = -1

Query  393  PRLIRNHPVYAAP-----PTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            P LIRN PV+AAP     PTL   DM    Y EA+  L+K+L E  E    AAA ++EIT
Sbjct  45   PALIRNQPVFAAPAPIINPTLRDHDMA---YEEAVAALKKLLIENGELEPKAAAKVSEIT  101

Query  228  AELQT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT       S     +IK+GF+HFK EKYEK   LYGELAKGQSP +MVFAC+DSRV
Sbjct  102  AELQTTANGSTISSPAVDKIKDGFIHFKREKYEKKPELYGELAKGQSPPYMVFACSDSRV  161

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRNIANMV
Sbjct  162  CPSHVLDFQPGEAFVVRNIANMV  184



>ref|XP_010496563.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Camelina 
sativa]
Length=344

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M   +Y EAIE L+K+L EK E   +AAA + ++T
Sbjct  50   VPTLIRNEPVFAAPAPIIAPYWSEEMGSESYDEAIEALKKLLIEKGELKTVAAAKVEQVT  109

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKY+ N  L+GEL+KGQSPKFMVFAC+DSRV
Sbjct  110  AELQTGTSSDKKASDPVETIKQGFITFKKEKYDANPELWGELSKGQSPKFMVFACSDSRV  169

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRN+ANMV
Sbjct  170  CPSHVLNFQPGEAFVVRNVANMV  192



>ref|XP_010435624.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic [Camelina 
sativa]
Length=345

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M   +Y EAIE L+K+L EK E   +AAA + ++T
Sbjct  51   VPTLIRNEPVFAAPAPIIAPYWSEEMGSESYDEAIEALKKLLIEKGELKTVAAAKVEQVT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AELQT  +       P + IK GF+ FK EKY+ N  L+GEL+KGQSPKFMVFAC+DSRV
Sbjct  111  AELQTGTSSDKKAFDPVETIKQGFITFKKEKYDANPELWGELSKGQSPKFMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRN+ANMV
Sbjct  171  CPSHVLNFQPGEAFVVRNVANMV  193



>gb|AAA33652.1| carbonic anhydrase [Pisum sativum]
 prf||1710354A carbonic anhydrase
Length=329

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 108/144 (75%), Gaps = 13/144 (9%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
             P LI++ PV+A+   +    LRE+M KG Y EAIEEL+K+L EK E  A AA  + +IT
Sbjct  46   FPSLIQDKPVFASSSPIITPVLREEMGKG-YDEAIEELQKLLREKTELKATAAEKVEQIT  104

Query  228  AELQTSDAP--------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSR  73
            A+L T+ +         +++IK GF+HFK EKY+KN ALYGELAKGQSP FMVFAC+DSR
Sbjct  105  AQLGTTSSSDGIPKSEASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSR  164

Query  72   VCPSHVLDFQPGEAFVVRNIANMV  1
            VCPSHVLDFQPG+AFVVRN+AN+V
Sbjct  165  VCPSHVLDFQPGKAFVVRNVANLV  188



>ref|XP_010524306.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=255

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 3/114 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDAPTQQIKNGFVHFKT  163
            M   +Y +AIE L+K+L EK E  A+AAA + +ITAELQT   SD+P ++IK GFVHFK 
Sbjct  1    MGNESYEQAIEALKKLLIEKGELKAVAAAKVEQITAELQTGSSSDSPVERIKQGFVHFKK  60

Query  162  EKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            EKY+KN ALYG+LAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFVVRNIANMV
Sbjct  61   EKYDKNPALYGKLAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNIANMV  114



>gb|ADI52861.1| chloroplast beta-carbonic anhydrase [Brassica napus]
Length=331

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + + T
Sbjct  48   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQAT  107

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  108  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  168  CPSHVLNFQPGEAFVVRNIANMV  190



>gb|AJA06256.1| beta-type carbonic anhydrase 1-like protein [Brassica juncea]
Length=337

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + +IT
Sbjct  53   VPTLIRNEPVVAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQIT  112

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  113  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  172

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  173  CPSHVLNFQPGEAFVVRNIANMV  195



>ref|XP_009125017.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic-like [Brassica 
rapa]
 emb|CDY28672.1| BnaCnng05580D [Brassica napus]
Length=344

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV AAP  ++     E+M   +Y EA E L+K+L EK E   +AAA + +IT
Sbjct  50   VPTLIRNEPVLAAPAPIITPYWSEEMGSESYQEATEALKKLLIEKEELKTVAAAKVEQIT  109

Query  228  AELQT---SDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AEL+T   SD     P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  110  AELKTGAPSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  169

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPG+AFVVRNIANMV
Sbjct  170  CPSHVLNFQPGDAFVVRNIANMV  192



>ref|XP_009147437.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic [Brassica 
rapa]
Length=345

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + + T
Sbjct  51   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQAT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  111  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  171  CPSHVLNFQPGEAFVVRNIANMV  193



>gb|AJA06253.1| beta-type carbonic anhydrase 1-like protein [Orychophragmus violaceus]
Length=331

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + ++T
Sbjct  48   IPTLIRNEPVFAAPAPIITPYWSEEMGTEAYDEAIEALKKLIIEKEELKTVAAAKVEQVT  107

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            AEL+T  +       P + IK GF+ FK EKYE N  LYGELAKGQSPK+MVFAC+DSRV
Sbjct  108  AELKTGTSSDKKAFDPVENIKQGFITFKKEKYETNPTLYGELAKGQSPKYMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPG+AFVVRNIANMV
Sbjct  168  CPSHVLNFQPGDAFVVRNIANMV  190



>ref|XP_010251256.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nelumbo nucifera]
Length=326

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 109/139 (78%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K +Y EAI  L+++L EK +  A+AAA I +ITAEL
Sbjct  47   LIRNEPVFAAPAPIITPILREEMGKDSYEEAIAGLQQLLREKGDLEAVAAAKIEQITAEL  106

Query  219  QTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            Q +        P +++K+GFVHFKTEK++K+ AL+GELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  107  QGAVVDGKVFDPVERMKHGFVHFKTEKFQKSPALFGELAKGQSPKFMVFACSDSRVCPSH  166

Query  57   VLDFQPGEAFVVRNIANMV  1
            +L+ QPGEAF+VRNIANMV
Sbjct  167  ILNLQPGEAFMVRNIANMV  185



>ref|XP_003618282.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES74500.1| carbonic anhydrase family protein [Medicago truncatula]
Length=278

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 106/143 (74%), Gaps = 15/143 (10%)
 Frame = -1

Query  387  LIRNHPVYAAPPT-----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            LI++ PV+A+  +     +LRE+M KG Y EAIEEL+K+L EK E  A AA  + +ITA+
Sbjct  49   LIQDKPVFASSSSPIITPVLREEMGKG-YDEAIEELQKLLREKTELKATAAEKVEQITAQ  107

Query  222  LQT---------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            L T         SD  +++IK GF+HFK EKY+   ALYGELAKGQ+P FMVFAC+DSRV
Sbjct  108  LGTTASADGVPTSDQASERIKTGFLHFKKEKYDTKPALYGELAKGQAPPFMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+ANMV
Sbjct  168  CPSHVLDFQPGEAFVVRNVANMV  190



>gb|AAD27876.2|AF139464_1 carbonic anhydrase [Vigna radiata]
 gb|AFC34139.2| carbonic anhydrase [Vigna unguiculata]
Length=328

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    REDM K +Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  49   LIQDKPVFAAPSHIITPTVREDMAK-DYEQAIEELQKLLREKTELKATAAEKVEQITASL  107

Query  219  QTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             TS +        + +IK+GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  108  GTSSSDSIPSSEASDRIKSGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  167

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  168  HVLDFQPGEAFVVRNVANIV  187



>ref|XP_010251255.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nelumbo nucifera]
Length=337

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 109/139 (78%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LIRN PV+AAP  +    LRE+M K +Y EAI  L+++L EK +  A+AAA I +ITAEL
Sbjct  47   LIRNEPVFAAPAPIITPILREEMGKDSYEEAIAGLQQLLREKGDLEAVAAAKIEQITAEL  106

Query  219  QTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            Q +        P +++K+GFVHFKTEK++K+ AL+GELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  107  QGAVVDGKVFDPVERMKHGFVHFKTEKFQKSPALFGELAKGQSPKFMVFACSDSRVCPSH  166

Query  57   VLDFQPGEAFVVRNIANMV  1
            +L+ QPGEAF+VRNIANMV
Sbjct  167  ILNLQPGEAFMVRNIANMV  185



>emb|CDY37516.1| BnaA05g33810D [Brassica napus]
Length=345

 Score =   162 bits (409),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + + T
Sbjct  51   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQAT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  111  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  171  CPSHVLNFQPGEAFVVRNIANMV  193



>sp|P17067.1|CAHC_PEA RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate 
dehydratase; Contains: RecName: Full=Carbonic anhydrase, 
27 kDa isoform; Contains: RecName: Full=Carbonic anhydrase, 
25 kDa isoform; Flags: Precursor [Pisum sativum]
 emb|CAA36792.1| unnamed protein product [Pisum sativum]
Length=328

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 107/141 (76%), Gaps = 13/141 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+A+   +    LRE+M KG Y EAIEEL+K+L EK E  A AA  + +ITA+L
Sbjct  48   LIQDKPVFASSSPIITPVLREEMGKG-YDEAIEELQKLLREKTELKATAAEKVEQITAQL  106

Query  219  QTSDAP--------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCP  64
             T+ +         +++IK GF+HFK EKY+KN ALYGELAKGQSP FMVFAC+DSRVCP
Sbjct  107  GTTSSSDGIPKSEASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCP  166

Query  63   SHVLDFQPGEAFVVRNIANMV  1
            SHVLDFQPGEAFVVRN+AN+V
Sbjct  167  SHVLDFQPGEAFVVRNVANLV  187



>ref|XP_008348025.1| PREDICTED: LOW QUALITY PROTEIN: carbonic anhydrase, chloroplastic-like 
[Malus domestica]
Length=233

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E    AAA + ++TAEL T
Sbjct  43   PNLIQNKPVTSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRVEAAAKVEQVTAELAT  101

Query  213  SDAP--------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++A          +++K+GF+HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  102  AEASGATKPYDAAERLKSGFIHFKKEKYDKNPALYGELAKGQWPKFMMFACSDSRVCPSH  161

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  162  VLDMQPGEAFVVRTVANLV  180



>ref|XP_007151036.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151037.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151038.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 ref|XP_007151039.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ACZ74707.1| carbonic anhydrase [Phaseolus vulgaris]
 gb|ESW23030.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23031.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23032.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23033.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
Length=330

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    R DM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  51   LIQDRPVFAAPSPIITPTVRGDMAK-EYEQAIEELQKLLREKSELKATAAEKVEQITASL  109

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       S   +++IK GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  110  GTTSSDGIPSSEASERIKTGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  169

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  170  HVLDFQPGEAFVVRNVANIV  189



>gb|AJA06259.1| beta-type carbonic anhydrase 1-like protein [Brassica napus]
Length=334

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 102/143 (71%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + + T
Sbjct  51   VPTLIRNEPVVAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQAT  110

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  111  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  170

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  171  CPSHVLNFQPGEAFVVRNIANMV  193



>ref|XP_007151035.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
 gb|ESW23029.1| hypothetical protein PHAVU_004G013500g [Phaseolus vulgaris]
Length=341

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL  220
            LI++ PV+AAP  ++    R DM K  Y +AIEEL+K+L EK E  A AA  + +ITA L
Sbjct  51   LIQDRPVFAAPSPIITPTVRGDMAK-EYEQAIEELQKLLREKSELKATAAEKVEQITASL  109

Query  219  QT-------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
             T       S   +++IK GF++FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPS
Sbjct  110  GTTSSDGIPSSEASERIKTGFLYFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPS  169

Query  60   HVLDFQPGEAFVVRNIANMV  1
            HVLDFQPGEAFVVRN+AN+V
Sbjct  170  HVLDFQPGEAFVVRNVANIV  189



>ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula]
Length=342

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 106/143 (74%), Gaps = 15/143 (10%)
 Frame = -1

Query  387  LIRNHPVYAAPPT-----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            LI++ PV+A+  +     +LRE+M KG Y EAIEEL+K+L EK E  A AA  + +ITA+
Sbjct  49   LIQDKPVFASSSSPIITPVLREEMGKG-YDEAIEELQKLLREKTELKATAAEKVEQITAQ  107

Query  222  LQT---------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            L T         SD  +++IK GF+HFK EKY+   ALYGELAKGQ+P FMVFAC+DSRV
Sbjct  108  LGTTASADGVPTSDQASERIKTGFLHFKKEKYDTKPALYGELAKGQAPPFMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+ANMV
Sbjct  168  CPSHVLDFQPGEAFVVRNVANMV  190



>ref|XP_009801271.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=269

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M   +Y +AI  L K+LSEK E G IAAA +++ITAELQ+SD      P + +K GF+HF
Sbjct  1    MANESYEQAIAALEKLLSEKGELGPIAAARVDQITAELQSSDGSKPFDPVEHMKAGFIHF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KTEKYEKN ALYGEL+KGQSPK+MVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   KTEKYEKNPALYGELSKGQSPKYMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  116



>emb|CDY49059.1| BnaC05g48870D [Brassica napus]
Length=381

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            +P LIRN PV+AAP  ++     E+M    Y EAIE L+K++ EK E   +AAA + + T
Sbjct  50   VPTLIRNEPVFAAPAPIITPYWSEEMGSEAYEEAIEALKKLIIEKEELKTVAAAKVEQAT  109

Query  228  AELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            A LQT  +       P + IK GF+ FK EKYE N ALYGELAKGQSPK+MVFAC+DSRV
Sbjct  110  AALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYMVFACSDSRV  169

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVL+FQPGEAFVVRNIANMV
Sbjct  170  CPSHVLNFQPGEAFVVRNIANMV  192



>ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES74499.1| carbonic anhydrase family protein [Medicago truncatula]
Length=331

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 106/143 (74%), Gaps = 15/143 (10%)
 Frame = -1

Query  387  LIRNHPVYAAPPT-----LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            LI++ PV+A+  +     +LRE+M KG Y EAIEEL+K+L EK E  A AA  + +ITA+
Sbjct  49   LIQDKPVFASSSSPIITPVLREEMGKG-YDEAIEELQKLLREKTELKATAAEKVEQITAQ  107

Query  222  LQT---------SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRV  70
            L T         SD  +++IK GF+HFK EKY+   ALYGELAKGQ+P FMVFAC+DSRV
Sbjct  108  LGTTASADGVPTSDQASERIKTGFLHFKKEKYDTKPALYGELAKGQAPPFMVFACSDSRV  167

Query  69   CPSHVLDFQPGEAFVVRNIANMV  1
            CPSHVLDFQPGEAFVVRN+ANMV
Sbjct  168  CPSHVLDFQPGEAFVVRNVANMV  190



>sp|P46511.1|CAHX_FLABR RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria brownii]
 gb|AAA86942.1| carbonic anhydrase [Flaveria brownii]
Length=330

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTK-GN--YGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  ++  + T+ GN  Y EAI+ L+K+L EK E   +AAA I++ITA+
Sbjct  51   PSLIRNEPVFAAPAPIITPNWTEDGNESYEEAIDALKKMLIEKGELEPVAAARIDQITAQ  110

Query  222  LQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
                D      P ++IK+GFV FKTEK+  N ALY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  111  AAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSH  170

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  171  VLDFQPGEAFVVRNVANMV  189



>sp|P46510.2|CAHX_FLABI RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria bidentis]
 gb|AAA86939.2| carbonic anhydrase [Flaveria bidentis]
Length=330

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTK-GN--YGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  ++  + T+ GN  Y EAI+ L+K L EK E   +AA  I++ITA+
Sbjct  51   PSLIRNEPVFAAPAPIITPNWTEDGNESYEEAIDALKKTLIEKGELEPVAATRIDQITAQ  110

Query  222  LQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
                D      P ++IK+GFV FKTEK+  N ALY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  111  AAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSH  170

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  171  VLDFQPGEAFVVRNVANMV  189



>sp|P46512.1|CAH1_FLALI RecName: Full=Carbonic anhydrase 1; AltName: Full=Carbonate dehydratase 
1 [Flaveria linearis]
 gb|AAA86993.1| carbonic anhydrase 1 [Flaveria linearis]
Length=330

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTK-GN--YGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  ++  + T+ GN  Y EAI+ L+K+L EK E   +AAA I++ITA+
Sbjct  51   PSLIRNEPVFAAPAPIITPNWTEDGNESYEEAIDALKKMLIEKGELEPVAAARIDQITAQ  110

Query  222  LQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
                D      P ++IK+GFV FKTEK+  N ALY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  111  AAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSH  170

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  171  VLDFQPGEAFVVRNVANMV  189



>gb|ADZ97027.1| carbonic anhydrase 3 [Flaveria brownii]
Length=334

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 101/137 (74%), Gaps = 9/137 (7%)
 Frame = -1

Query  384  IRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ  217
            IRN PV+ AP  ++    R DM   +Y EAI  L+K+LSE+ +   +AAA I+EITA+LQ
Sbjct  57   IRNQPVFDAPTPIITPTVRGDMGSESYDEAIAALKKLLSEREDLAPVAAAKIDEITAQLQ  116

Query  216  TSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            T D        ++IK GF  FKTEKY  N ALY EL+KGQSPKFMVFAC+DSRVCPSHVL
Sbjct  117  TLDTKPAFDAVKRIKTGFAKFKTEKYLTNPALYDELSKGQSPKFMVFACSDSRVCPSHVL  176

Query  51   DFQPGEAFVVRNIANMV  1
            DFQPGEAFVVRN+AN+V
Sbjct  177  DFQPGEAFVVRNVANIV  193



>gb|AGS78351.1| chloroplast beta-carbonic anhydrase [Leucaena leucocephala]
Length=326

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 7/136 (5%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT--  214
            LI+N PV+AAP  L+   + + +  EAI EL+K+L  K +  A A A ++++TA+L T  
Sbjct  49   LIQNRPVFAAPTPLITPTLNEDSIEEAIVELQKLLRAKGDLTATAEARVDQVTAQLSTPT  108

Query  213  -----SDAPTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLD  49
                 S    ++IK GF+HFK EKYEKN ALYGELAKGQSP +MVFAC+DSRVCPSHVLD
Sbjct  109  SESIASSESVERIKAGFIHFKKEKYEKNPALYGELAKGQSPTYMVFACSDSRVCPSHVLD  168

Query  48   FQPGEAFVVRNIANMV  1
            FQPGEAFVVRN+AN+V
Sbjct  169  FQPGEAFVVRNVANLV  184



>sp|P46281.1|CAHX_FLAPR RecName: Full=Carbonic anhydrase; AltName: Full=Carbonate dehydratase 
[Flaveria pringlei]
 gb|AAA86992.1| carbonic anhydrase [Flaveria pringlei]
Length=329

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 104/139 (75%), Gaps = 8/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTK-GN--YGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN PV+AAP  ++  + T+ GN  Y EAI+ L+K+L EK E   +AAA I++ITA+
Sbjct  50   PSLIRNEPVFAAPAPIITPNWTEDGNESYEEAIDALKKMLIEKGELEPVAAARIDQITAQ  109

Query  222  LQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
                D      P ++IK+GFV FKTEK+  N  LY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  110  AAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPVLYDELAKGQSPKFMVFACSDSRVCPSH  169

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  170  VLDFQPGEAFVVRNVANMV  188



>gb|ABK96336.1| unknown [Populus trichocarpa x Populus deltoides]
Length=258

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = -1

Query  321  NYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKT  163
            +Y EAIE L+K+LSEK E   +AAA + +ITAELQT+ +       P ++IK+GF+HFK 
Sbjct  4    DYNEAIESLKKLLSEKDELKTVAAAKVEQITAELQTTSSSDPKAFDPVEKIKSGFIHFKK  63

Query  162  EKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            EKY+KN  LY ELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFV+RN+ANMV
Sbjct  64   EKYDKNPGLYSELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVLRNVANMV  117



>ref|XP_008357742.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Malus domestica]
Length=323

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E    AAA + ++TAEL T
Sbjct  43   PNLIQNKPVTSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRVEAAAKVEQVTAELAT  101

Query  213  SDAP--------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++A          +++K+GF+HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  102  AEASGATKPYDAAERLKSGFIHFKKEKYDKNPALYGELAKGQWPKFMMFACSDSRVCPSH  161

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  162  VLDMQPGEAFVVRTVANLV  180



>ref|XP_006446505.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59745.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
Length=284

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = -1

Query  348  LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-SDA----PTQQIKN  184
             LREDM   +Y EAIE L+K+L EK +   +AAA + +ITA+LQT SD       ++IK 
Sbjct  23   FLREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKAFDSVERIKE  82

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+
Sbjct  83   GFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANI  142

Query  3    V  1
            V
Sbjct  143  V  143



>ref|XP_008357741.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Malus domestica]
Length=334

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E    AAA + ++TAEL T
Sbjct  43   PNLIQNKPVTSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRVEAAAKVEQVTAELAT  101

Query  213  SDAP--------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++A          +++K+GF+HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  102  AEASGATKPYDAAERLKSGFIHFKKEKYDKNPALYGELAKGQWPKFMMFACSDSRVCPSH  161

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  162  VLDMQPGEAFVVRTVANLV  180



>gb|KDO66161.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=284

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = -1

Query  348  LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-SDA----PTQQIKN  184
             LREDM   +Y EAIE L+K+L EK +   +AAA + +ITA+LQT SD       ++IK 
Sbjct  23   FLREDMANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKAFDSVERIKE  82

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF+HFK EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+
Sbjct  83   GFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANI  142

Query  3    V  1
            V
Sbjct  143  V  143



>ref|XP_006369918.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66487.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=258

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = -1

Query  321  NYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKT  163
            +Y EAIE L+K+LS+K E   +AAA + +ITAELQT+ +       P ++IK+GF+HFK 
Sbjct  4    DYNEAIESLKKLLSDKEELKTVAAAKVEQITAELQTASSSDPKAFDPVEKIKSGFIHFKK  63

Query  162  EKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            EKY+KN  LY ELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFV+RN+ANMV
Sbjct  64   EKYDKNPGLYSELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVLRNVANMV  117



>ref|XP_009377228.1| PREDICTED: carbonic anhydrase, chloroplastic-like, partial [Pyrus 
x bretschneideri]
Length=206

 Score =   153 bits (387),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSD  208
            LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E  A AAA + ++TA+L T++
Sbjct  46   LIQNKPVTSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRAEAAAKVEQVTAQLATAE  104

Query  207  A--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            A          +++K+G++HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSHVL
Sbjct  105  ANGATKPYDAAERLKSGYIHFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSHVL  164

Query  51   DFQPGEAFVVRNIANMV  1
            D QPGEAFVVR +AN+V
Sbjct  165  DMQPGEAFVVRTVANLV  181



>ref|XP_003517730.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX1 [Glycine 
max]
 ref|XP_006573037.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Glycine max]
 ref|XP_006573038.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X4 
[Glycine max]
 gb|KHN12106.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=278

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +E+M   +Y EAI  L K+LSEK E G +AAA I E+TAEL  + +    P ++I+ GF+
Sbjct  20   KEEMAGESYEEAITSLTKLLSEKAELGGVAAAKIKELTAELDAAGSKPFNPEERIRTGFI  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EK+EKN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  80   HFKNEKFEKNPYLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  137



>prf||2018192A carbonic anhydrase
Length=331

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTK-GN--YGEAIEELRKVLSEKREYGaiaaaaINEITAE  223
            P LIRN  V+AAP  ++  + T+ GN  Y EAI+ L+K L EK E   +AA  I++ITA+
Sbjct  52   PSLIRNELVFAAPAPIITPNWTEDGNESYEEAIDALKKTLIEKGELEPVAATRIDQITAQ  111

Query  222  LQTSDA-----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
                D      P ++IK+GFV FKTEK+  N ALY ELAKGQSPKFMVFAC+DSRVCPSH
Sbjct  112  AAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSH  171

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLDFQPGEAFVVRN+ANMV
Sbjct  172  VLDFQPGEAFVVRNVANMV  190



>gb|AAO17574.1| carbonic anhydrase 3 [Flaveria bidentis]
Length=258

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVH  172
            M   +Y EAI  L+K+LSEK+E   +AAA I++ITA+LQT D+      P ++IK GF  
Sbjct  1    MGSKSYDEAIAALKKLLSEKKELAPMAAAKIDQITAQLQTLDSTKPGFDPVERIKTGFAK  60

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FKTEKY KN ALYGEL+KGQSPKFM FAC+DSRVCPSHVLDFQPGEAFVVRN+AN+V
Sbjct  61   FKTEKYLKNPALYGELSKGQSPKFMAFACSDSRVCPSHVLDFQPGEAFVVRNVANIV  117



>ref|XP_011009542.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Populus euphratica]
 ref|XP_011009543.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Populus euphratica]
Length=277

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVH  172
            EDM   +Y +AI  L K+LSEK + G++AAA I +ITAEL+   +    P ++IK GFVH
Sbjct  20   EDMANESYEDAIAGLSKLLSEKADLGSVAAAKIKQITAELEAVSSKGFDPVERIKTGFVH  79

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            F+TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  80   FRTEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  136



>ref|XP_011009544.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Populus euphratica]
Length=275

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVH  172
            EDM   +Y +AI  L K+LSEK + G++AAA I +ITAEL+   +    P ++IK GFVH
Sbjct  18   EDMANESYEDAIAGLSKLLSEKADLGSVAAAKIKQITAELEAVSSKGFDPVERIKTGFVH  77

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            F+TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  78   FRTEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  134



>gb|ADZ97029.1| carbonic anhydrase 3 [Flaveria vaginata]
Length=257

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M   +Y EAI  L+K+LSEK+E   +AAA I++ITA+LQT D      P Q+IK GF  F
Sbjct  1    MGSKSYDEAIAALKKLLSEKKELAPMAAAKIDQITAQLQTLDTKPAFDPVQRIKTGFAKF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KTEKY KN ALYGEL+KGQSPKFM FAC+DSRVCPSH LDFQPGEAFVVRN+AN+V
Sbjct  61   KTEKYLKNPALYGELSKGQSPKFMAFACSDSRVCPSHALDFQPGEAFVVRNVANIV  116



>emb|CDP02111.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 105/140 (75%), Gaps = 8/140 (6%)
 Frame = -1

Query  396  LPRLIRNHPVYAAPPTL----LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEIT  229
            LPRLIR+ PV+AAP  +    LRE M+K  Y +AI  L+K+LSEK  YG +AAA I +IT
Sbjct  46   LPRLIRDEPVFAAPAPVFTPNLREGMSKEEYEKAIVGLQKLLSEKGGYGPVAAAKIEQIT  105

Query  228  AELQTSDA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPS  61
            AELQT+D       +++K GF+ FK EKYE N AL+G+LAKGQSPK+M+ ACADSRV PS
Sbjct  106  AELQTTDTKAFDAVEKLKTGFIRFKREKYETNPALFGQLAKGQSPKYMIVACADSRVNPS  165

Query  60   HVLDFQPGEAFVVRNIANMV  1
             +L  QPG+AF+VR++AN+V
Sbjct  166  LILSLQPGDAFIVRSVANLV  185



>ref|XP_009334081.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Pyrus x bretschneideri]
Length=337

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E  A AAA + ++TAEL T
Sbjct  46   PNLIQNKPVNSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRAEAAAKVEQVTAELAT  104

Query  213  SDA--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++           +++K+G++HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  105  AEGGGAAKPYDAAERLKSGYIHFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSH  164

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  165  VLDMQPGEAFVVRTVANLV  183



>ref|XP_006585949.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Glycine max]
Length=259

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFV  175
            M  G+Y EAI  L K+LSEK + G +AAA I ++TAEL T+ A       P ++I+ GF 
Sbjct  1    MAGGSYEEAIAALTKLLSEKADLGGVAAAKIKQLTAELDTATANGSTPFNPDERIRTGFA  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDF PGEAFVVRNIANMV
Sbjct  61   HFKNEKYQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEAFVVRNIANMV  118



>ref|XP_009334082.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Pyrus x bretschneideri]
Length=326

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E  A AAA + ++TAEL T
Sbjct  46   PNLIQNKPVNSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRAEAAAKVEQVTAELAT  104

Query  213  SDA--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++           +++K+G++HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  105  AEGGGAAKPYDAAERLKSGYIHFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSH  164

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  165  VLDMQPGEAFVVRTVANLV  183



>ref|XP_007044647.1| Carbonic anhydrase 2, CA2 isoform 1 [Theobroma cacao]
 gb|EOY00479.1| Carbonic anhydrase 2, CA2 isoform 1 [Theobroma cacao]
Length=279

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDAPTQ-----QIKNGF  178
             EDM  G+Y EAI  L K+LS+K +  ++AAA I +ITAEL+ +  P Q     +I+ GF
Sbjct  20   EEDMGSGSYEEAIAALSKLLSDKADLQSVAAAKIMQITAELEAAADPNQFDPVKRIETGF  79

Query  177  VHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +HFK EKYEKN  LYGELAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  80   LHFKKEKYEKNPDLYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  138



>gb|KHN26874.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=240

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFV  175
            M  G+Y EAI  L K+LSEK +   +AAA I ++TAEL+T+ A       P ++I+ GF 
Sbjct  1    MAGGSYEEAIAALTKLLSEKADLSGVAAAKIKQLTAELETATANGSTPFNPDERIRTGFA  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDF PGEAFVVRNIANMV
Sbjct  61   HFKNEKYQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEAFVVRNIANMV  118



>ref|XP_009375105.1| PREDICTED: carbonic anhydrase 2-like [Pyrus x bretschneideri]
Length=324

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSD  208
            LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E  A AAA + ++TA+L T++
Sbjct  46   LIQNKPVTSVPAITRKEEMAK-EYEEAIASLQKLLSEKEELRAEAAAKVEQVTAQLATAE  104

Query  207  A--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            A          +++K+G++HFK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSHVL
Sbjct  105  ANGATKPYDAAERLKSGYIHFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSHVL  164

Query  51   DFQPGEAFVVRNIANMV  1
            D QPGEAFVVR +AN+V
Sbjct  165  DMQPGEAFVVRTVANLV  181



>ref|XP_006602381.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Glycine max]
Length=170

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFV  175
            M  G+Y EAI  L K++SEK +   +AAA I ++TAEL+T+ A       P ++I+ GF 
Sbjct  1    MAGGSYEEAIAALTKLISEKADLSGVAAAKIKQLTAELETATANGSTPFNPDERIRTGFA  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EK++KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDF PGEAFVVRNIANMV
Sbjct  61   HFKNEKFQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEAFVVRNIANMV  118



>ref|XP_003517731.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoformX2 [Glycine 
max]
Length=256

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK E G +AAA I E+TAEL  + +    P ++I+ GF+HFK
Sbjct  1    MAGESYEEAITSLTKLLSEKAELGGVAAAKIKELTAELDAAGSKPFNPEERIRTGFIHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EK+EKN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   NEKFEKNPYLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  115



>ref|XP_010029174.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Eucalyptus grandis]
Length=268

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 90/113 (80%), Gaps = 6/113 (5%)
 Frame = -1

Query  321  NYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSD------APTQQIKNGFVHFKTE  160
            +Y EAIE L+K+LSEK +  A AAA + +ITAELQT+       +   +IK GF  FK E
Sbjct  4    DYDEAIEALKKLLSEKGDLKATAAAKVEQITAELQTASPDIKPSSSVDRIKTGFTFFKKE  63

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KY+KN ALYGELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  64   KYDKNPALYGELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMV  116



>ref|XP_008389648.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Malus domestica]
Length=275

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT--SDAPTQQIKNGFVHF  169
            +EDMTK +Y +AI  L K+LSEK +   +AAA I EITAEL +  S  P Q+IK GF+ F
Sbjct  19   KEDMTKDSYEDAIAGLSKLLSEKADLEGVAAAKIREITAELASAGSSDPVQRIKTGFIQF  78

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EK+EK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  79   KKEKFEKDVDLYNKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  134



>gb|ACU18641.1| unknown [Glycine max]
Length=204

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK E G +AAA I E+TAEL  + +    P ++I+ GF+HFK
Sbjct  1    MAGESYEEAITSLTKLLSEKAELGGVAAAKIKELTAELDAAGSKPFNPEERIRTGFIHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EK+ KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   NEKFGKNPYLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  115



>ref|XP_010660912.1| PREDICTED: beta carbonic anhydrase 1, chloroplastic isoform X2 
[Vitis vinifera]
Length=269

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVH  172
            M  G+Y EA+E LRK+L EK     +AAA I++ITA+L++SD       P +++K GF++
Sbjct  1    MGNGSYDEAVEGLRKLLREKANLEPVAAAKIDQITAQLKSSDGSSSPFDPVERMKTGFIY  60

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FK EKY+KN AL+ ELAKGQSPKFMVFAC+DSRVCPSHVLDFQPG+AFVVRN+ANMV
Sbjct  61   FKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCPSHVLDFQPGDAFVVRNVANMV  117



>ref|XP_004489276.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Cicer arietinum]
Length=270

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 9/119 (8%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL---QTSDA-PT----QQIKNGF  178
            M KG Y EAIEEL+K+L EK E  A AA  + +ITA+L    TSD  PT    ++IK+GF
Sbjct  1    MGKG-YEEAIEELQKLLREKNELKATAAEKVEQITAQLGTTSTSDGVPTSEASERIKSGF  59

Query  177  VHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +HFK EKY+KN ALYGELAKGQSP FMVFAC+DSRVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  60   LHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMV  118



>ref|XP_011009545.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009546.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009547.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009548.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
 ref|XP_011009549.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Populus euphratica]
Length=256

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+LSEK + G++AAA I +ITAEL+   +    P ++IK GFVHF+
Sbjct  1    MANESYEDAIAGLSKLLSEKADLGSVAAAKIKQITAELEAVSSKGFDPVERIKTGFVHFR  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  115



>ref|XP_006378218.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 gb|ERP56015.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
Length=183

 Score =   147 bits (370),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+LSEK + G++AAA I +ITAEL+ + +    P ++IK GFV F+
Sbjct  1    MANESYEDAIAGLSKLLSEKADLGSVAAAKIKQITAELEAASSKGFDPVERIKTGFVQFR  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  115



>gb|ACU19610.1| unknown [Glycine max]
Length=259

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 90/118 (76%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFV  175
            M  G+Y EAI  L K+LSEK + G +AAA I ++TAEL T+ A       P ++I+ GF 
Sbjct  1    MAGGSYEEAIAALTKLLSEKADLGGVAAAKIKQLTAELDTATANGSTPFNPDERIRTGFA  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EKY+KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDF PGEA VVRNIANMV
Sbjct  61   HFKNEKYQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEASVVRNIANMV  118



>gb|KHN00357.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=280

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +E+M   +Y EAI  L K+LSEK + G +AAA I ++TAEL  + +    P ++I+ GF+
Sbjct  20   KEEMAGESYEEAIASLTKLLSEKADLGGVAAAKIKDLTAELDAAGSKPFNPEERIRTGFI  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EK+EKN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  80   QFKNEKFEKNPDLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  137



>ref|XP_003519759.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Glycine max]
Length=278

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +E+M   +Y EAI  L K+LSEK + G +AAA I ++TAEL  + +    P ++I+ GF+
Sbjct  20   KEEMAGESYEEAIASLTKLLSEKADLGGVAAAKIKDLTAELDAAGSKPFNPEERIRTGFI  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EK+EKN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  80   QFKNEKFEKNPDLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  137



>ref|XP_006603811.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X4 
[Glycine max]
Length=269

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y +AIEEL+K+L EK E  A AA  + +ITA L TS +        + +IK GF+HFK E
Sbjct  5    YEQAIEELQKLLREKSELKATAAEKVEQITASLGTSSSDGIPSSEASDRIKAGFIHFKKE  64

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KY+KN ALYGELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+V
Sbjct  65   KYDKNPALYGELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIV  117



>gb|KCW56026.1| hypothetical protein EUGRSUZ_I01790 [Eucalyptus grandis]
Length=379

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 94/119 (79%), Gaps = 7/119 (6%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSD------APTQQIKNGF  178
            E+M K +Y EAIE L+K+LSEK +  A AAA + +ITAELQT+       +   +IK GF
Sbjct  121  EEMGK-DYDEAIEALKKLLSEKGDLKATAAAKVEQITAELQTASPDIKPSSSVDRIKTGF  179

Query  177  VHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
              FK EKY+KN ALYGELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  180  TFFKKEKYDKNPALYGELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMV  238



>gb|ACJ85468.1| unknown [Medicago truncatula]
Length=278

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +EDM    + ++I  L ++L EK E G IAA  I E+TAEL+ + +    P ++I++GFV
Sbjct  20   KEDMAGETFEDSIATLTRLLKEKAELGDIAAVKIKELTAELEANGSKPFNPDERIRSGFV  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FKTEKY KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  80   SFKTEKYLKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  137



>gb|AGS78352.1| cytoplasmic beta carbonic anhydrase [Leucaena leucocephala]
Length=253

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI EL+K++SEK + G +AAA I ++TAEL  +D+    P ++I+ GF HFK
Sbjct  1    MAGQSYEEAIAELKKLISEKADLGGVAAAKIKQLTAELSAADSKPIKPDERIRTGFTHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EK+EKN  L+G+LA GQSPKF+VFAC+DSRVCPSHVLDFQPGEAFVVRNIANM+
Sbjct  61   KEKFEKNPDLFGKLATGQSPKFLVFACSDSRVCPSHVLDFQPGEAFVVRNIANMI  115



>ref|XP_007215653.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
 gb|EMJ16852.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
Length=338

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+  PV + P    +E+M K  Y EAI  L+K+LSEK E  A AA+ + +ITA+LQT
Sbjct  49   PNLIQKKPVSSVPALTRKEEMGK-EYEEAIASLQKLLSEKAELKAEAASKVEQITAQLQT  107

Query  213  SDAP-------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            +D          +++K+GF+HFK EKY+ N AL+ ELA GQ PKFM+FAC+DSRVCPSHV
Sbjct  108  ADGSGTKTYDAVERLKSGFIHFKKEKYDTNPALFNELATGQWPKFMLFACSDSRVCPSHV  167

Query  54   LDFQPGEAFVVRNIANMV  1
            LD QPGEAFVVR +AN+V
Sbjct  168  LDIQPGEAFVVRTVANLV  185



>dbj|BAM15482.1| carbonic anhydrase, partial [Solanum tuberosum]
Length=268

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    AA  I ++TAEL+ +D     P ++I++GF HFK
Sbjct  13   MAEDSYEDAIAGLKKLLSEKNELEDTAAVKIRQLTAELEGADGKKSDPDEKIRSGFAHFK  72

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  LYG+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  73   AEKYEKNPELYGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  127



>ref|XP_006579757.1| PREDICTED: carbonic anhydrase, chloroplastic isoform X3 [Glycine 
max]
Length=269

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y +AIEEL+K+L EK E  A AA  + +ITA L TS +        + +IK GF+HFK E
Sbjct  5    YEKAIEELQKLLREKSELKATAAEKVEQITASLGTSSSDGIPSSEASDRIKAGFIHFKKE  64

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KY+KN ALYGELAKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+V
Sbjct  65   KYDKNPALYGELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIV  117



>gb|KHN27017.1| Carbonic anhydrase, chloroplastic [Glycine soja]
Length=260

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFV  175
            M  G+Y EAI  L K++SEK +   +AAA I ++TAEL+T+ A       P ++I+ GF 
Sbjct  1    MAGGSYEEAIAALTKLISEKADLSGVAAAKIKQLTAELETATANGSTPFNPDERIRTGFA  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EK++KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDF PGEAFVVRNIANMV
Sbjct  61   HFKNEKFQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEAFVVRNIANMV  118



>ref|XP_006470328.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Citrus sinensis]
Length=269

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 93/116 (80%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-SDA----PTQQIKNGFVHF  169
            M   +Y EAIE L+K+L EK +   +AAA + +ITA+LQT SD       ++IK+GF+HF
Sbjct  1    MANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKAFDSVERIKDGFIHF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+V
Sbjct  61   KREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIV  116



>ref|XP_007044648.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 ref|XP_007044649.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 gb|EOY00480.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
 gb|EOY00481.1| Carbonic anhydrase 2, CA2 isoform 2 [Theobroma cacao]
Length=257

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 92/116 (79%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDAPTQ-----QIKNGFVHF  169
            M  G+Y EAI  L K+LS+K +  ++AAA I +ITAEL+ +  P Q     +I+ GF+HF
Sbjct  1    MGSGSYEEAIAALSKLLSDKADLQSVAAAKIMQITAELEAAADPNQFDPVKRIETGFLHF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EKYEKN  LYGELAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   KKEKYEKNPDLYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  116



>ref|XP_007215654.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
 gb|EMJ16853.1| hypothetical protein PRUPE_ppa008289mg [Prunus persica]
Length=327

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+  PV + P    +E+M K  Y EAI  L+K+LSEK E  A AA+ + +ITA+LQT
Sbjct  49   PNLIQKKPVSSVPALTRKEEMGK-EYEEAIASLQKLLSEKAELKAEAASKVEQITAQLQT  107

Query  213  SDAP-------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
            +D          +++K+GF+HFK EKY+ N AL+ ELA GQ PKFM+FAC+DSRVCPSHV
Sbjct  108  ADGSGTKTYDAVERLKSGFIHFKKEKYDTNPALFNELATGQWPKFMLFACSDSRVCPSHV  167

Query  54   LDFQPGEAFVVRNIANMV  1
            LD QPGEAFVVR +AN+V
Sbjct  168  LDIQPGEAFVVRTVANLV  185



>ref|XP_006408512.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
 gb|ESQ49965.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum]
Length=259

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y EAIE L+K+L EK E   +AAA + +ITAELQT  +       P + IK GF+ FK E
Sbjct  6    YQEAIEALKKLLIEKEELKTVAAAKVEQITAELQTGTSSDKKAFDPVENIKQGFITFKKE  65

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVL+FQPGEAFVVRNIANMV
Sbjct  66   KYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMV  118



>ref|XP_002525377.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF37015.1| carbonic anhydrase, putative [Ricinus communis]
Length=280

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
             ++M   +Y EAI  L K+LSEK E G +AAA I +ITAEL+ + +      ++IK GF+
Sbjct  22   EKNMANDSYEEAIAGLSKLLSEKAELGEVAAAKIKQITAELEAAGSKDFDADERIKTGFI  81

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFKTEKYEK+  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIA+MV
Sbjct  82   HFKTEKYEKDPTLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIASMV  139



>ref|XP_006365235.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=268

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    AAA I ++TAEL  +D     P ++I++GF HFK
Sbjct  13   MAEDSYEDAIAGLKKLLSEKNELEDTAAAKIRQLTAELDGADGKKSDPDEKIRSGFAHFK  72

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  LYG+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  73   AEKYEKNPELYGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  127



>ref|XP_003613229.1| Carbonic anhydrase [Medicago truncatula]
Length=290

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = -1

Query  390  RLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTS  211
            +++  H      P   +EDM    + ++I  L ++L EK E G IAA  I E+TAEL+ +
Sbjct  16   KIVSYHTREKHTPKNKKEDMAGETFEDSIATLTRLLKEKAELGDIAAVKIKELTAELEAN  75

Query  210  DA----PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQ  43
             +    P ++I++GFV FKTEK+ KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQ
Sbjct  76   GSKPFNPDERIRSGFVSFKTEKFLKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFQ  135

Query  42   PGEAFVVRNIANMV  1
            PGEAFVVRNIANMV
Sbjct  136  PGEAFVVRNIANMV  149



>ref|XP_006365234.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=271

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    AAA I ++TAEL  +D     P ++I++GF HFK
Sbjct  16   MAEDSYEDAIAGLKKLLSEKNELEDTAAAKIRQLTAELDGADGKKSDPDEKIRSGFAHFK  75

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  LYG+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  76   AEKYEKNPELYGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  130



>ref|XP_003613228.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES96186.1| carbonic anhydrase family protein [Medicago truncatula]
Length=278

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +EDM    + ++I  L ++L EK E G IAA  I E+TAEL+ + +    P ++I++GFV
Sbjct  20   KEDMAGETFEDSIATLTRLLKEKAELGDIAAVKIKELTAELEANGSKPFNPDERIRSGFV  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FKTEK+ KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  80   SFKTEKFLKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  137



>ref|XP_006446499.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 ref|XP_006446504.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59739.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|ESR59744.1| hypothetical protein CICLE_v10015874mg [Citrus clementina]
 gb|KDO66181.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66182.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
 gb|KDO66183.1| hypothetical protein CISIN_1g019915mg [Citrus sinensis]
Length=257

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-SDA----PTQQIKNGFVHF  169
            M   +Y EAIE L+K+L EK +   +AAA + +ITA+LQT SD       ++IK GF+HF
Sbjct  1    MANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EKYEKN ALY ELAKGQSPK+MVFAC+DSRVCPSHVLDFQPGEAFVVRN+AN+V
Sbjct  61   KREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIV  116



>ref|NP_850490.1| carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AAM13886.1| putative carbonic anhydrase, chloroplast precursor [Arabidopsis 
thaliana]
 gb|AEE73676.1| carbonic anhydrase 1 [Arabidopsis thaliana]
Length=270

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y EAIE L+K+L EK E   +AAA + +ITA LQT  +       P + IK GF+ FK E
Sbjct  6    YDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKE  65

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDFQPG+AFVVRNIANMV
Sbjct  66   KYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMV  118



>dbj|BAD93915.1| carbonic anhydrase, chloroplast precursor [Arabidopsis thaliana]
Length=259

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y EAIE L+K+L EK E   +AAA + +ITA LQT  +       P + IK GF+ FK E
Sbjct  6    YDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKE  65

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDFQPG+AFVVRNIANMV
Sbjct  66   KYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMV  118



>gb|KHG08930.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=253

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-SDAPTQQIKNGFVHFKTEK  157
            M   +Y EAIE L+K+LSEK E  A+AAA ++++TAEL+T SD   +++K GFV+FK++K
Sbjct  1    MGDKSYEEAIEALKKLLSEKGELKAVAAAKVDQVTAELKTTSDDSVERLKQGFVYFKSQK  60

Query  156  YEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            YEKN ALY ELAKGQSPK+M+ AC+DSRVCPSHVLD QPGEAFVVRN+AN+V
Sbjct  61   YEKNPALYAELAKGQSPKYMIVACSDSRVCPSHVLDMQPGEAFVVRNVANIV  112



>ref|XP_002314617.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 ref|XP_006378217.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 gb|ABK94740.1| unknown [Populus trichocarpa]
 gb|EEF00788.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
 gb|ERP56014.1| hypothetical protein POPTR_0010s05080g [Populus trichocarpa]
Length=256

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+LSEK + G++AAA I +ITAEL+ + +    P ++IK GFV F+
Sbjct  1    MANESYEDAIAGLSKLLSEKADLGSVAAAKIKQITAELEAASSKGFDPVERIKTGFVQFR  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  115



>ref|XP_006483853.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=280

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = -1

Query  354  PTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIK  187
            P   REDM    Y +AI  L K+LSEK +   +AAA I +ITA+L+ + +    P +++K
Sbjct  18   PVAQREDMANDAYEDAIAGLTKLLSEKSDLEGVAAAKIKQITADLEAAGSRDIDPVERMK  77

Query  186  NGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIAN  7
             GF+ FKTEKYEKN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIAN
Sbjct  78   TGFIQFKTEKYEKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIAN  137

Query  6    MV  1
            MV
Sbjct  138  MV  139



>ref|XP_008230599.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform X1 
[Prunus mume]
Length=338

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P    +E+M K  Y EAI  L+K+LSEK E  A AA+ + +ITA+LQT
Sbjct  49   PSLIQNKPVSSVPALTRKEEMGK-EYEEAIASLQKLLSEKAELKAEAASKVEQITAQLQT  107

Query  213  SDAP-------TQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHV  55
             D          +++K+GF+HFK EKY+ N AL+ ELA GQ PKFM+FAC+DSRVCPSHV
Sbjct  108  VDGSGTKTYDAVERLKSGFIHFKKEKYDTNPALFNELATGQWPKFMLFACSDSRVCPSHV  167

Query  54   LDFQPGEAFVVRNIANMV  1
            L+ QPGEAFVVR +AN+V
Sbjct  168  LNIQPGEAFVVRTVANLV  185



>ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula]
 gb|AES74502.1| carbonic anhydrase family protein [Medicago truncatula]
Length=260

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 10/120 (8%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---------SDAPTQQIKNG  181
            M KG Y EAIEEL+K+L EK E  A AA  + +ITA+L T         SD  +++IK G
Sbjct  1    MGKG-YDEAIEELQKLLREKTELKATAAEKVEQITAQLGTTASADGVPTSDQASERIKTG  59

Query  180  FVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            F+HFK EKY+   ALYGELAKGQ+P FMVFAC+DSRVCPSHVLDFQPGEAFVVRN+ANMV
Sbjct  60   FLHFKKEKYDTKPALYGELAKGQAPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMV  119



>ref|XP_004238665.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Solanum lycopersicum]
 emb|CAH60890.1| carbonic anhydrase [Solanum lycopersicum]
Length=268

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    AAA I ++TAEL+ +D     P ++I++GF HFK
Sbjct  13   MAEDSYEDAIAGLKKLLSEKNELEDTAAAKIRQLTAELEGADGKKSDPDEKIRSGFAHFK  72

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  L+G+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  73   AEKYEKNPELFGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  127



>ref|XP_004304624.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 6/113 (5%)
 Frame = -1

Query  321  NYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVHFKTE  160
            NY EAI  L+K+LSEK +   +AA+ + +ITA+L T+DA      P ++IK GF+ FK E
Sbjct  4    NYEEAIAALQKLLSEKDDLKTVAASKVEQITAQLATADAGSNPFDPVERIKTGFIKFKKE  63

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KY+ N ALYGELAKGQ+PKFM+FAC+DSRVCPSH+LD QPGEAFVVRN+ANMV
Sbjct  64   KYDTNPALYGELAKGQAPKFMLFACSDSRVCPSHILDMQPGEAFVVRNVANMV  116



>gb|KDP26586.1| hypothetical protein JCGZ_17744 [Jatropha curcas]
Length=256

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDAPT----QQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK + G++AAA I +ITAEL+ + +      Q++K GFVHFK
Sbjct  1    MANDSYEEAIAGLSKLLSEKADLGSVAAAKIKQITAELEAAGSAEFNAEQRMKAGFVHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEK+  LYGELAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIA+MV
Sbjct  61   TEKYEKDPTLYGELAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIASMV  115



>ref|XP_004238664.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Solanum lycopersicum]
Length=279

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    AAA I ++TAEL+ +D     P ++I++GF HFK
Sbjct  24   MAEDSYEDAIAGLKKLLSEKNELEDTAAAKIRQLTAELEGADGKKSDPDEKIRSGFAHFK  83

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  L+G+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  84   AEKYEKNPELFGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  138



>ref|XP_007157457.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
 gb|ESW29451.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
Length=278

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            +E+M   +Y EAI  L K+LSEK E G +A A I ++TAEL  + +    P ++I+ GF+
Sbjct  20   KEEMAGESYEEAIASLTKLLSEKAELGEVATAKIKDLTAELDAAGSKPFNPEERIRTGFI  79

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EK+ KN  LYGELA+GQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  80   SFKNEKFAKNPDLYGELAQGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  137



>ref|XP_010492290.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X2 
[Camelina sativa]
Length=238

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK E   +AAA + +ITAELQT   SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIESLKKLLIEKDELKDLAAAKVKKITAELQTVSSSDSKTFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSH+LDF PG+AF+VRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHILDFHPGDAFMVRNIANMV  118



>ref|XP_006574621.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Glycine max]
Length=256

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK + G +AAA I ++TAEL  + +    P ++I+ GF+ FK
Sbjct  1    MAGESYEEAIASLTKLLSEKADLGGVAAAKIKDLTAELDAAGSKPFNPEERIRTGFIQFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EK+EKN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   NEKFEKNPDLYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  115



>gb|ABK94941.1| unknown [Populus trichocarpa]
Length=256

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+L+EK + G++AAA I +ITAEL+ + +    P ++IK GFV F+
Sbjct  1    MANESYEDAIAGLSKLLNEKADLGSVAAAKIKQITAELEAASSKGFDPVERIKTGFVQFR  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF++RNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMIRNIANMV  115



>ref|XP_010251257.1| PREDICTED: carbonic anhydrase 2-like isoform X3 [Nelumbo nucifera]
Length=277

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 6/120 (5%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNG  181
            RE+M K +Y EAI  L+++L EK +  A+AAA I +ITAELQ +        P +++K+G
Sbjct  6    REEMGKDSYEEAIAGLQQLLREKGDLEAVAAAKIEQITAELQGAVVDGKVFDPVERMKHG  65

Query  180  FVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FVHFKTEK++K+ AL+GELAKGQSPKFMVFAC+DSRVCPSH+L+ QPGEAF+VRNIANMV
Sbjct  66   FVHFKTEKFQKSPALFGELAKGQSPKFMVFACSDSRVCPSHILNLQPGEAFMVRNIANMV  125



>gb|AAA34026.1| carbonic anhydrase precursor [Spinacia oleracea]
Length=254

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-----TSDAPTQQIKNGFVHFKTEKY  154
            Y EAI  L+K+LSEK E    AA+ + +IT+EL      ++  P Q+IK GF+ FK EKY
Sbjct  3    YEEAIAALKKLLSEKGELENEAASKVAQITSELADGGTPSASYPVQRIKEGFIKFKKEKY  62

Query  153  EKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            EKN ALYGEL+KGQ+PKFMVFAC+DSRVCPSHVLDFQPGEAF+VRNIANMV
Sbjct  63   EKNPALYGELSKGQAPKFMVFACSDSRVCPSHVLDFQPGEAFMVRNIANMV  113



>gb|KCW86712.1| hypothetical protein EUGRSUZ_B03320 [Eucalyptus grandis]
Length=385

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL-QTSDA----PTQQIKNGFV  175
            EDM    Y EAI EL K+LS+K E    AAA I +ITAEL  TS+     P ++IK+GFV
Sbjct  127  EDMANDKYEEAIAELSKILSDKCELQGPAAAKIKQITAELVATSNGNGFDPLERIKSGFV  186

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EK+EKN ALYG LAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  187  RFKKEKFEKNPALYGTLAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  244



>prf||1707317A carbonic anhydrase
Length=254

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-----TSDAPTQQIKNGFVHFKTEKY  154
            Y EAI  L+K+LSEK E    AA+ + +IT+EL      ++  P Q+IK GF+ FK EKY
Sbjct  3    YEEAIAALKKLLSEKGELENEAASKVAQITSELADGGTPSASYPVQRIKEGFIKFKKEKY  62

Query  153  EKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            EKN ALYGEL+KGQ+PKFMVFAC+DSRVCPSHVLDFQPGEAF+VRNIANMV
Sbjct  63   EKNPALYGELSKGQAPKFMVFACSDSRVCPSHVLDFQPGEAFMVRNIANMV  113



>ref|XP_009363559.1| PREDICTED: carbonic anhydrase 2 [Pyrus x bretschneideri]
Length=254

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT--SDAPTQQIKNGFVHFKTE  160
            MTK +Y +AI  L K+LSEK +   +AAA I EITAEL +  S  P Q+IK GF+ FK E
Sbjct  1    MTKDSYEDAIAGLSKLLSEKADLEGVAAAKIREITAELASAGSSDPVQRIKTGFIQFKKE  60

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K+EK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   KFEKDVDLYSKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  113



>ref|XP_008389649.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
 ref|XP_008389650.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
 ref|XP_008389651.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Malus domestica]
Length=254

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT--SDAPTQQIKNGFVHFKTE  160
            MTK +Y +AI  L K+LSEK +   +AAA I EITAEL +  S  P Q+IK GF+ FK E
Sbjct  1    MTKDSYEDAIAGLSKLLSEKADLEGVAAAKIREITAELASAGSSDPVQRIKTGFIQFKKE  60

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K+EK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   KFEKDVDLYNKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  113



>gb|KFK23338.1| hypothetical protein AALP_AAs64867U000100 [Arabis alpina]
Length=181

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTE  160
            Y EAIE L+K+L EK E   +AAA + +ITAELQT  +       P + IK GF+ FK E
Sbjct  6    YEEAIEALKKLLIEKEELKTVAAAKVEQITAELQTRTSSGKKAFDPVETIKQGFITFKEE  65

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KYE N ALYGELAKGQSPKF+VFAC+DSRVCPSHVL+FQPG+AFVVRNI +MV
Sbjct  66   KYETNPALYGELAKGQSPKFLVFACSDSRVCPSHVLNFQPGDAFVVRNIGSMV  118



>ref|XP_010492287.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
 ref|XP_010492288.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
 ref|XP_010492289.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic isoform X1 
[Camelina sativa]
Length=259

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK E   +AAA + +ITAELQT   SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIESLKKLLIEKDELKDLAAAKVKKITAELQTVSSSDSKTFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSH+LDF PG+AF+VRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHILDFHPGDAFMVRNIANMV  118



>gb|KDO82415.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
Length=260

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            REDM    Y +AI  L K+LSEK +   IAAA I +ITA+L+ + +    P +++K GF+
Sbjct  2    REDMANDAYEDAIAGLTKLLSEKSDLEGIAAAKIKQITADLEAAGSRDIDPAERMKTGFI  61

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             F+TEKYEKN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  62   QFRTEKYEKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  119



>gb|KDO82416.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
 gb|KDO82417.1| hypothetical protein CISIN_1g0235891mg, partial [Citrus sinensis]
Length=259

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
            REDM    Y +AI  L K+LSEK +   IAAA I +ITA+L+ + +    P +++K GF+
Sbjct  1    REDMANDAYEDAIAGLTKLLSEKSDLEGIAAAKIKQITADLEAAGSRDIDPAERMKTGFI  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             F+TEKYEKN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   QFRTEKYEKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  118



>ref|XP_010044623.1| PREDICTED: carbonic anhydrase 2 [Eucalyptus grandis]
Length=257

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL-QTSDA----PTQQIKNGFVHF  169
            M    Y EAI EL K+LS+K E    AAA I +ITAEL  TS+     P ++IK+GFV F
Sbjct  1    MANDKYEEAIAELSKILSDKCELQGPAAAKIKQITAELVATSNGNGFDPLERIKSGFVRF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EK+EKN ALYG LAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   KKEKFEKNPALYGTLAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  116



>ref|NP_974782.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAG40063.1|AF324712_1 AT5g14740 [Arabidopsis thaliana]
 gb|AAG41445.1|AF326863_1 putative carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAK00368.1|AF339686_1 putative carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AAL16197.1|AF428428_1 AT5g14740/T9L3_40 [Arabidopsis thaliana]
 gb|AAN31799.1| putative carbonic anhydrase [Arabidopsis thaliana]
 gb|AAN31810.1| putative carbonic anhydrase [Arabidopsis thaliana]
 gb|AED92069.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=259

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  118



>ref|XP_011071084.1| PREDICTED: carbonic anhydrase 2-like [Sesamum indicum]
Length=286

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 10/125 (8%)
 Frame = -1

Query  345  LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAEL----------QTSDAPTQ  196
            ++E+M K  Y EAI  L+K+LSEK E  A AAA I ++TAEL          + +  P +
Sbjct  18   VKEEMVKDTYEEAIAGLKKLLSEKGELEAAAAAKIRQLTAELGGATEKGAVEKPASDPDE  77

Query  195  QIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRN  16
            +I+ GF HFK EKY+KN ALYG+LAKGQ+PKF+VFAC+DSRVCPSHVL+FQPGEAF+VRN
Sbjct  78   RIRTGFDHFKKEKYDKNPALYGQLAKGQAPKFLVFACSDSRVCPSHVLNFQPGEAFMVRN  137

Query  15   IANMV  1
            IANMV
Sbjct  138  IANMV  142



>ref|XP_002871629.1| hypothetical protein ARALYDRAFT_488319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47888.1| hypothetical protein ARALYDRAFT_488319 [Arabidopsis lyrata subsp. 
lyrata]
Length=259

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK E   +AAA + +ITAELQT   SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIEALKKLLIEKDELKDVAAAKVKKITAELQTVSSSDSKSFDPIKRIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVL+F PG+AFVVRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLNFHPGDAFVVRNIANMV  118



>ref|XP_008340028.1| PREDICTED: carbonic anhydrase 2-like [Malus domestica]
Length=254

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA--PTQQIKNGFVHFKTE  160
            M K +Y +AI  L K+LSEK +   +AAA I +ITAEL ++D+    ++IK GF HFK E
Sbjct  1    MAKDSYEDAIAGLSKLLSEKADLEGVAAAKIKQITAELASADSTDAVERIKTGFTHFKKE  60

Query  159  KYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KYEK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   KYEKDVDLYAKLAAGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  113



>gb|AFK48090.1| unknown [Lotus japonicus]
Length=256

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK + GA+AAA I ++TAEL+ + +    P ++I+ GFV FK
Sbjct  1    MAGESYDEAIASLTKLLSEKADLGAVAAAKIKDLTAELEDAGSKPFNPDERIRTGFVQFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +EK+EKN  LYG+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   SEKFEKNPDLYGKLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  115



>ref|XP_007153731.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
 gb|ESW25725.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
Length=256

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 6/116 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M    Y EAI  L K++SEK + G +AAA I ++T EL TSDA     P ++I+ GF HF
Sbjct  1    MAGETYQEAIAALTKLISEKADLGDVAAAKIKKLTTEL-TSDASKPFNPDERIRIGFDHF  59

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EK++KN  LYGELAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  60   KNEKFQKNPELYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  115



>ref|XP_007153732.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
 gb|ESW25726.1| hypothetical protein PHAVU_003G060400g [Phaseolus vulgaris]
Length=256

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 6/116 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M    Y EAI  L K++SEK + G +AAA I ++T EL TSDA     P ++I+ GF HF
Sbjct  1    MAGETYQEAIAALTKLISEKADLGDVAAAKIKKLTTEL-TSDASKPFNPDERIRIGFDHF  59

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K EK++KN  LYGELAKGQSPKF+VFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  60   KNEKFQKNPELYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  115



>dbj|BAH20249.1| AT5G14740 [Arabidopsis thaliana]
Length=275

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  17   MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  76

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  77   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  134



>ref|XP_010100460.1| Carbonic anhydrase [Morus notabilis]
 gb|EXB82594.1| Carbonic anhydrase [Morus notabilis]
Length=256

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   ++ +AI  L K++SEK   G +AAA I +IT+EL+ + +    P ++I++GF +FK
Sbjct  1    MATDSFDDAIAGLSKLISEKGHLGDVAAAKIKQITSELKLASSGRFDPNERIQSGFNYFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEK+  LYG+LAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  61   TEKYEKDPELYGQLAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  115



>ref|NP_001078583.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AED92072.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=310

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  73   MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  132

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  133  TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  190



>ref|XP_007157458.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
 gb|ESW29452.1| hypothetical protein PHAVU_002G071200g [Phaseolus vulgaris]
Length=256

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 88/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y EAI  L K+LSEK E G +A A I ++TAEL  + +    P ++I+ GF+ FK
Sbjct  1    MAGESYEEAIASLTKLLSEKAELGEVATAKIKDLTAELDAAGSKPFNPEERIRTGFISFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EK+ KN  LYGELA+GQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIANMV
Sbjct  61   NEKFAKNPDLYGELAQGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMV  115



>ref|XP_010453603.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic-like [Camelina 
sativa]
Length=259

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK E   +A A + +ITAELQT   SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIESLKKLLIEKDELKDLAVAKVKKITAELQTVSSSDSKTFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSH+L+F PG+AF+VRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHILNFHPGDAFMVRNIANMV  118



>ref|XP_010420125.1| PREDICTED: beta carbonic anhydrase 2, chloroplastic-like [Camelina 
sativa]
Length=259

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT---SDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK E   +AAA + +ITAELQT   SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIESLKKLLIEKDELKDLAAAKVKKITAELQTVSSSDSKTFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSH+L+F PG+AF+VRNIANMV
Sbjct  61   TFKREKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHILNFHPGDAFMVRNIANMV  118



>ref|XP_009626669.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009804035.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Nicotiana sylvestris]
Length=269

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    A A I ++TAEL+ +      P ++I+ GF HFK
Sbjct  14   MAEDSYEDAIAGLKKLLSEKNELEDAAVAKIRQLTAELEGAGGKKSDPDEKIRTGFAHFK  73

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  L+G+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  74   AEKYEKNPELFGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  128



>ref|XP_009626667.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626668.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009804034.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Nicotiana sylvestris]
 gb|AIL30494.1| chloroplast carbonic anhydrase isoform 1 [Nicotiana tabacum]
Length=279

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M + +Y +AI  L+K+LSEK E    A A I ++TAEL+ +      P ++I+ GF HFK
Sbjct  24   MAEDSYEDAIAGLKKLLSEKNELEDAAVAKIRQLTAELEGAGGKKSDPDEKIRTGFAHFK  83

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             EKYEKN  L+G+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  84   AEKYEKNPELFGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  138



>ref|NP_001031884.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AED92071.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=330

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  73   MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  132

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  133  TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  190



>ref|NP_001031883.1| carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AED92070.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=330

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  73   MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  132

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  133  TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  190



>ref|NP_568303.2| carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|P42737.3|BCA2_ARATH RecName: Full=Beta carbonic anhydrase 2, chloroplastic; Short=AtbCA2; 
Short=AtbetaCA2; AltName: Full=Beta carbonate dehydratase 
2; Flags: Precursor [Arabidopsis thaliana]
 pir||T51419 CARBONIC ANHYDRASE 2 - Arabidopsis thaliana
 emb|CAC01873.1| CARBONIC ANHYDRASE 2 [Arabidopsis thaliana]
 gb|AED92068.1| carbonic anhydrase 2 [Arabidopsis thaliana]
Length=331

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITAELQ   +SD+    P ++IK GFV
Sbjct  73   MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFV  132

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  133  TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  190



>ref|XP_004155356.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Cucumis 
sativus]
Length=278

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = -1

Query  345  LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKN  184
            + EDM + +Y EAI  L K+LSEK +    AAA I +ITAEL  S A      P  +IK 
Sbjct  17   VSEDMAQESYEEAIAGLSKLLSEKADLQDAAAAKIRQITAELAGSSACSNGFDPVDRIKT  76

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF HFK  K+E N  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANM
Sbjct  77   GFTHFKKSKFETNPELYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANM  136

Query  3    V  1
            V
Sbjct  137  V  137



>gb|AES96187.2| carbonic anhydrase family protein [Medicago truncatula]
Length=256

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M    + ++I  L ++L EK E G IAA  I E+TAEL+ + +    P ++I++GFV FK
Sbjct  1    MAGETFEDSIATLTRLLKEKAELGDIAAVKIKELTAELEANGSKPFNPDERIRSGFVSFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEK+ KN  LYGELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAFVVRNIANMV
Sbjct  61   TEKFLKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFVVRNIANMV  115



>ref|XP_010533166.1| PREDICTED: beta carbonic anhydrase 4-like isoform X1 [Tarenaya 
hassleriana]
Length=280

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-----SDAPTQQIKNGFV  175
            +DM   +Y +AI  L ++LS+K + G +AAA I ++TAEL+      SDA  ++IK+GF+
Sbjct  22   DDMATDSYEDAIAGLEELLSKKSDLGNVAAAKIKQLTAELKEVGSSRSDA-VERIKSGFI  80

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FKT+KYEKN  L+G+LAKGQSPKFMVFAC+DSRVCPSHVL+FQPGEAFVVRNIANMV
Sbjct  81   LFKTQKYEKNPDLFGQLAKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMV  138



>ref|XP_008362142.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Malus domestica]
Length=328

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 102/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT  214
            P LI+N PV + P  + R++     Y EAI  L+K+LSEK E  A AAA + ++TA+L T
Sbjct  48   PNLIQNKPVTSVP-AITRKEEMXKEYEEAIASLQKLLSEKEELRAEAAAKVEQVTAQLAT  106

Query  213  SDA--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSH  58
            ++A          +++K+GF++FK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSH
Sbjct  107  AEANGATKPYDAAERLKSGFIYFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSH  166

Query  57   VLDFQPGEAFVVRNIANMV  1
            VLD QPGEAFVVR +AN+V
Sbjct  167  VLDMQPGEAFVVRTVANLV  185



>gb|AAA50156.1| carbonic anhydrase [Arabidopsis thaliana]
Length=259

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +AIE L+K+L EK +   +AAA + +ITA++Q   +SD+    P ++IK GFV
Sbjct  1    MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITADVQAASSSDSKSFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKYE N ALYGELAKGQSPK+MVFAC+DSRVCPSHVLDF PG+AFVVRNIANMV
Sbjct  61   TFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMV  118



>ref|XP_010251258.1| PREDICTED: carbonic anhydrase 2-like isoform X4 [Nelumbo nucifera]
Length=269

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVH  172
            M K +Y EAI  L+++L EK +  A+AAA I +ITAELQ +        P +++K+GFVH
Sbjct  1    MGKDSYEEAIAGLQQLLREKGDLEAVAAAKIEQITAELQGAVVDGKVFDPVERMKHGFVH  60

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FKTEK++K+ AL+GELAKGQSPKFMVFAC+DSRVCPSH+L+ QPGEAF+VRNIANMV
Sbjct  61   FKTEKFQKSPALFGELAKGQSPKFMVFACSDSRVCPSHILNLQPGEAFMVRNIANMV  117



>ref|XP_004135244.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Cucumis 
sativus]
Length=278

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = -1

Query  345  LREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKN  184
            + EDM + +Y EAI  L K+LSEK +    AAA I +ITAEL  S A      P  +IK 
Sbjct  17   VSEDMAQESYEEAIAGLSKLLSEKADLQDAAAAKIRQITAELAGSSACSNGFDPVDRIKT  76

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF HFK  K+E N  +YG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANM
Sbjct  77   GFTHFKKSKFETNPEVYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANM  136

Query  3    V  1
            V
Sbjct  137  V  137



>ref|XP_010243030.1| PREDICTED: carbonic anhydrase 2-like [Nelumbo nucifera]
Length=257

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHF  169
            M   +  EAI  L+++LSEK E  A+A A I EITAEL+ S A     P +++K GF +F
Sbjct  1    MANDSIEEAIAGLKQLLSEKGELEAVAKAKIEEITAELRGSVADGSVCPVERMKQGFSYF  60

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KTEK+EKN  LYG+LAKGQSPKFMVFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   KTEKFEKNPELYGQLAKGQSPKFMVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  116



>ref|XP_011034133.1| PREDICTED: carbonic anhydrase 2-like isoform X2 [Populus euphratica]
Length=256

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+LSE+ + G++AA+ I ++ AEL+ + +    P ++I+ GF HFK
Sbjct  1    MGNDSYKDAIAGLSKLLSERADLGSVAASKIKQVAAELEAAGSKEFDPAERIRTGFFHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKY+K+  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   TEKYDKDPKLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  115



>ref|XP_004297629.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 7/118 (6%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFV  175
             EDM    Y +AI  L K+LSEK +   +AAA I ++TAEL+ + +    P +++K+GFV
Sbjct  20   EEDMA---YEDAIAGLSKLLSEKADLEGVAAAKIKQLTAELEEAGSNQFDPVEKLKSGFV  76

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HF+TEK+EK+  LYG+LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  77   HFRTEKFEKDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  134



>ref|XP_010682554.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=287

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 14/130 (11%)
 Frame = -1

Query  348  LLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------------  205
            L +E M    Y EAI  L K+LSEK     +AAA I +ITAELQ                
Sbjct  17   LPKEKMANKVYEEAIAGLTKLLSEKEGLDDVAAAKIKKITAELQGQTTQNGVANGKADLK  76

Query  204  --PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEA  31
              P ++IK+GF+ FKTEKYEKN ALYGELA+GQSPKF+VF+C+DSRVCPSH+LDFQPGEA
Sbjct  77   FDPHERIKSGFIRFKTEKYEKNPALYGELAQGQSPKFLVFSCSDSRVCPSHILDFQPGEA  136

Query  30   FVVRNIANMV  1
            F VRNIANMV
Sbjct  137  FSVRNIANMV  146



>ref|XP_003631257.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
 ref|XP_010651253.1| PREDICTED: carbonic anhydrase 2 isoform X1 [Vitis vinifera]
Length=277

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 7/123 (6%)
 Frame = -1

Query  357  PPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-TSDAP---TQQI  190
            PP+   +DM   +  +AI EL+K+LSEK     +AAA I +ITAEL+ T   P    ++I
Sbjct  17   PPS---KDMATDSCEDAIAELQKLLSEKCGLETVAAAKIKQITAELEKTGSEPFDAVERI  73

Query  189  KNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIA  10
            K GF  FKTEKYEKN  LY ELAKGQSPKFMVFAC+DSRVCPSH+LDFQPGEAF+VRNIA
Sbjct  74   KTGFGRFKTEKYEKNPTLYDELAKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIA  133

Query  9    NMV  1
            NMV
Sbjct  134  NMV  136



>gb|KHG09974.1| Carbonic anhydrase, chloroplastic [Gossypium arboreum]
Length=279

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 5/119 (4%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-----TSDAPTQQIKNGF  178
             EDM   +Y EAI  L K+LS+K + G++AAA I +IT EL+     T   P ++++ GF
Sbjct  20   EEDMGSESYEEAIAALSKLLSDKADLGSVAAAKIKQITDELEAAAESTQFDPVKRLETGF  79

Query  177  VHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +HFK EK++KN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIA+MV
Sbjct  80   LHFKNEKFDKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFIVRNIASMV  138



>ref|XP_004297630.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=253

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFKTEKYE  151
            Y +AI  L K+LSEK +   +AAA I ++TAEL+ + +    P +++K+GFVHF+TEK+E
Sbjct  3    YEDAIAGLSKLLSEKADLEGVAAAKIKQLTAELEEAGSNQFDPVEKLKSGFVHFRTEKFE  62

Query  150  KNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            K+  LYG+LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  63   KDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  112



>ref|XP_006288492.1| hypothetical protein CARUB_v10001757mg [Capsella rubella]
 gb|EOA21390.1| hypothetical protein CARUB_v10001757mg [Capsella rubella]
Length=259

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y EAIE L+K+L EK E   +AAA + +ITAELQ   +SD+    P  +IK GFV
Sbjct  1    MGSESYEEAIESLKKLLIEKDELKDVAAAKVKKITAELQAVTSSDSKSFDPVGRIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKY+ N ALYGELAKGQSPK+MVFAC+DSRVCPSH+L+F PG+AF+VRNIANMV
Sbjct  61   TFKKEKYDTNPALYGELAKGQSPKYMVFACSDSRVCPSHILNFHPGDAFMVRNIANMV  118



>gb|AEV42277.1| beta carbonic anhydrase 2 [Mesembryanthemum nodiflorum]
Length=287

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 10/121 (8%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----------PTQQIKN  184
            M    Y +AI  L K+LSEK+    +AAA I ++TAELQ              P ++IK+
Sbjct  26   MGTNAYDDAIAGLSKLLSEKKGLDDVAAAKIKQLTAELQQGTKENGASENGFDPDERIKS  85

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF+ FKTEKYEKN ALYGELAKGQSPKF+VFAC+DSRVCPSH+LDF+PG+AF VRNIANM
Sbjct  86   GFIRFKTEKYEKNPALYGELAKGQSPKFLVFACSDSRVCPSHILDFKPGDAFSVRNIANM  145

Query  3    V  1
            V
Sbjct  146  V  146



>emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera]
Length=331

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 101/148 (68%), Gaps = 17/148 (11%)
 Frame = -1

Query  393  PRLIRNHPVYAAPPTLL----REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITA  226
            P LI+N PV+AAP  ++    REDM  G+Y EA+E LRK+L EK     +AAA I++ITA
Sbjct  43   PNLIQNKPVFAAPAPIITPTWREDMGNGSYDEAVEGLRKLLREKANLEPVAAAKIDQITA  102

Query  225  ELQTSDA------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPK-------FMVFAC  85
            +L++SD       P +++K GF++FK EKYE   +    L +  +P        FMVFAC
Sbjct  103  QLKSSDGSSSPFDPVERMKTGFIYFKKEKYEYEISFLSYLFQRHNPLSIGLYFLFMVFAC  162

Query  84   ADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +DSRVCPSHVLDFQPG+AFVVRN+ANMV
Sbjct  163  SDSRVCPSHVLDFQPGDAFVVRNVANMV  190



>ref|XP_011034132.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 
[Populus euphratica]
Length=272

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M   +Y +AI  L K+LSE+ + G++AA+ I ++ AEL+ + +    P ++I+ GF HFK
Sbjct  1    MGNDSYKDAIAGLSKLLSERADLGSVAASKIKQVAAELEAAGSKEFDPAERIRTGFFHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKY+K+  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   TEKYDKDPKLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  115



>ref|XP_004298398.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=257

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = -1

Query  318  YGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-----PTQQIKNGFVHFKTEKY  154
            Y EAI +L K+LSEK +   +A A I +ITAEL+ +       P ++I+ GFVHFKTEK+
Sbjct  3    YEEAIAQLSKLLSEKPDLKGMAGAKIKQITAELEKAAGSKQLDPVERIQTGFVHFKTEKF  62

Query  153  EKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            E++  LYG+LA GQ+PKFMVFAC+DSRVCPSH+L+FQPGEAFVVRN+ANMV
Sbjct  63   ERHVDLYGKLATGQTPKFMVFACSDSRVCPSHILNFQPGEAFVVRNVANMV  113



>gb|EYU22489.1| hypothetical protein MIMGU_mgv1a009030mg [Erythranthe guttata]
Length=283

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 7/120 (6%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-------TSDAPTQQIKNG  181
            ++M K  Y EAIE L K+LSEK E  +IAAA +  +TAEL            P ++I+ G
Sbjct  22   QEMKKDTYEEAIEGLEKLLSEKDELKSIAAAKVRRLTAELAGPAEIGAVESDPVKRIQTG  81

Query  180  FVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            F HFK EKYEK  ALY +LA+GQ+PKF+VFAC+DSRVCPSHVL+FQPGEAFVVRN+ANMV
Sbjct  82   FDHFKKEKYEKQIALYWKLAQGQTPKFLVFACSDSRVCPSHVLNFQPGEAFVVRNVANMV  141



>ref|XP_010533173.1| PREDICTED: beta carbonic anhydrase 4-like isoform X2 [Tarenaya 
hassleriana]
Length=257

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 93/116 (80%), Gaps = 6/116 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQT-----SDAPTQQIKNGFVHF  169
            M   +Y +AI  L ++LS+K + G +AAA I ++TAEL+      SDA  ++IK+GF+ F
Sbjct  1    MATDSYEDAIAGLEELLSKKSDLGNVAAAKIKQLTAELKEVGSSRSDA-VERIKSGFILF  59

Query  168  KTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            KT+KYEKN  L+G+LAKGQSPKFMVFAC+DSRVCPSHVL+FQPGEAFVVRNIANMV
Sbjct  60   KTQKYEKNPDLFGQLAKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMV  115



>ref|XP_006438385.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 ref|XP_006438386.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 ref|XP_006483854.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 
[Citrus sinensis]
 ref|XP_006483855.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 
[Citrus sinensis]
 gb|ESR51625.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
 gb|ESR51626.1| hypothetical protein CICLE_v10032517mg [Citrus clementina]
Length=256

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M    Y +AI  L K+LSEK +   +AAA I +ITA+L+ + +    P +++K GF+ FK
Sbjct  1    MANDAYEDAIAGLTKLLSEKSDLEGVAAAKIKQITADLEAAGSRDIDPVERMKTGFIQFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  115



>gb|EYU22490.1| hypothetical protein MIMGU_mgv1a009030mg [Erythranthe guttata]
Length=260

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-------TSDAPTQQIKNGFV  175
            M K  Y EAIE L K+LSEK E  +IAAA +  +TAEL            P ++I+ GF 
Sbjct  1    MKKDTYEEAIEGLEKLLSEKDELKSIAAAKVRRLTAELAGPAEIGAVESDPVKRIQTGFD  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            HFK EKYEK  ALY +LA+GQ+PKF+VFAC+DSRVCPSHVL+FQPGEAFVVRN+ANMV
Sbjct  61   HFKKEKYEKQIALYWKLAQGQTPKFLVFACSDSRVCPSHVLNFQPGEAFVVRNVANMV  118



>ref|XP_008341456.1| PREDICTED: carbonic anhydrase 2-like isoform X1 [Malus domestica]
Length=324

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 9/137 (7%)
 Frame = -1

Query  387  LIRNHPVYAAPPTLLREDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSD  208
            LI+N PV + P  + R++     Y EAI  L+K+LSEK E  A AAA + ++TA+L T++
Sbjct  46   LIQNKPVTSVP-AITRKEEMXKEYEEAIASLQKLLSEKEELRAEAAAKVEQVTAQLATAE  104

Query  207  A--------PTQQIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVL  52
            A          +++K+GF++FK EKY+KN ALYGELAKGQ PKFM+FAC+DSRVCPSHVL
Sbjct  105  ANGATKPYDAAERLKSGFIYFKKEKYDKNPALYGELAKGQWPKFMLFACSDSRVCPSHVL  164

Query  51   DFQPGEAFVVRNIANMV  1
            D QPGEAFVVR +AN+V
Sbjct  165  DMQPGEAFVVRTVANLV  181



>ref|XP_010682555.1| PREDICTED: carbonic anhydrase 2 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=266

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 14/125 (11%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA--------------PTQ  196
            M    Y EAI  L K+LSEK     +AAA I +ITAELQ                  P +
Sbjct  1    MANKVYEEAIAGLTKLLSEKEGLDDVAAAKIKKITAELQGQTTQNGVANGKADLKFDPHE  60

Query  195  QIKNGFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRN  16
            +IK+GF+ FKTEKYEKN ALYGELA+GQSPKF+VF+C+DSRVCPSH+LDFQPGEAF VRN
Sbjct  61   RIKSGFIRFKTEKYEKNPALYGELAQGQSPKFLVFSCSDSRVCPSHILDFQPGEAFSVRN  120

Query  15   IANMV  1
            IANMV
Sbjct  121  IANMV  125



>ref|XP_006416059.1| hypothetical protein EUTSA_v10008530mg [Eutrema salsugineum]
 gb|ESQ34412.1| hypothetical protein EUTSA_v10008530mg [Eutrema salsugineum]
Length=258

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDAP----TQQIKNGFVHFK  166
            M+  +Y +A++ L ++LS+K + G +A   I ++T EL+  D+      ++IK+GF+HFK
Sbjct  1    MSTASYEDALKRLGELLSKKSDLGNVATTKIKQLTNELEELDSSKLDAVERIKSGFIHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            T  YEKN +LY ELAK QSPKF+VFACADSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   TNNYEKNPSLYNELAKSQSPKFLVFACADSRVCPSHILNFQPGEAFIVRNIANMV  115



>gb|AAO17573.1| carbonic anhydrase 2 [Flaveria bidentis]
Length=279

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -1

Query  312  EAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFKTEKYEKN  145
            + I+ L K+LSEK +    AA  I ++TAEL+ SDA      ++I+NGF  FK EKY+ N
Sbjct  31   DVIDRLNKLLSEKNDLQIFAAEKIKQLTAELEVSDAGEFKAVERIRNGFARFKKEKYDTN  90

Query  144  TALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
              LYGELAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  91   PTLYGELAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  138



>ref|XP_006399988.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
 gb|ESQ41441.1| hypothetical protein EUTSA_v10014232mg [Eutrema salsugineum]
Length=298

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 91/121 (75%), Gaps = 7/121 (6%)
 Frame = -1

Query  342  REDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-------PTQQIKN  184
            RE M   +Y +AIE L+K++ EK E   +AAA + ++TAELQT  +       P ++IK 
Sbjct  37   REGMGNESYEDAIEALKKLIIEKDELKTVAAAKVEKLTAELQTVSSSNSKYFDPVERIKQ  96

Query  183  GFVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANM  4
            GF+ FK EKY+ N  LYGELAKGQSPK+MVFAC+DSRVCPSHVL+F PG+AF+VRNIANM
Sbjct  97   GFITFKKEKYDTNPDLYGELAKGQSPKYMVFACSDSRVCPSHVLNFHPGDAFMVRNIANM  156

Query  3    V  1
            V
Sbjct  157  V  157



>emb|CDP00162.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M K  Y EAI  L+K+LSEK +   +AAA I ++TA+L+ +      P ++IK GF HFK
Sbjct  1    MGKDKYEEAIAGLQKLLSEKDQLEDVAAAKIRQLTADLEATAKKPFDPVERIKAGFGHFK  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             E YEKN  L+GELAKGQSPKFMVFACADSRVCPS +L+FQPGEAFVVRNIANMV
Sbjct  61   KEIYEKNPGLFGELAKGQSPKFMVFACADSRVCPSVILNFQPGEAFVVRNIANMV  115



>gb|EYU22488.1| hypothetical protein MIMGU_mgv1a009030mg [Erythranthe guttata]
Length=355

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 7/120 (6%)
 Frame = -1

Query  339  EDMTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ-------TSDAPTQQIKNG  181
            ++M K  Y EAIE L K+LSEK E  +IAAA +  +TAEL            P ++I+ G
Sbjct  94   QEMKKDTYEEAIEGLEKLLSEKDELKSIAAAKVRRLTAELAGPAEIGAVESDPVKRIQTG  153

Query  180  FVHFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            F HFK EKYEK  ALY +LA+GQ+PKF+VFAC+DSRVCPSHVL+FQPGEAFVVRN+ANMV
Sbjct  154  FDHFKKEKYEKQIALYWKLAQGQTPKFLVFACSDSRVCPSHVLNFQPGEAFVVRNVANMV  213



>ref|XP_008446208.1| PREDICTED: carbonic anhydrase 2-like [Cucumis melo]
 ref|XP_008446210.1| PREDICTED: carbonic anhydrase 2-like [Cucumis melo]
 gb|ADN33836.1| carbonic anhydrase [Cucumis melo subsp. melo]
Length=258

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 6/117 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVH  172
            M + +Y EAI  L K+LSEK +    AAA I +ITAEL  + A      P  +IK GF H
Sbjct  1    MAQESYEEAIAGLSKLLSEKADLQDAAAAKIRQITAELGGTTACSNGFDPVDRIKTGFTH  60

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FK  K+E N  LYG+LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   FKKSKFETNPDLYGQLAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  117



>gb|KDO82418.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82419.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82420.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
 gb|KDO82421.1| hypothetical protein CISIN_1g0235891mg [Citrus sinensis]
Length=256

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA----PTQQIKNGFVHFK  166
            M    Y +AI  L K+LSEK +   IAAA I +ITA+L+ + +    P +++K GF+ F+
Sbjct  1    MANDAYEDAIAGLTKLLSEKSDLEGIAAAKIKQITADLEAAGSRDIDPAERMKTGFIQFR  60

Query  165  TEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            TEKYEKN  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   TEKYEKNPDLYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  115



>emb|CDX85584.1| BnaA02g02290D [Brassica napus]
Length=259

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQ---TSDA----PTQQIKNGFV  175
            M   +Y +A+E L+K++ EK +   +AAA +++ITAEL+   +SD     P ++IK GFV
Sbjct  1    MGSQSYEDALEALKKLVIEKDDLKTVAAAKVDQITAELKKISSSDGKPFDPVERIKEGFV  60

Query  174  HFKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
             FK EKY+ N ALYGELAKGQSPK+MVFAC+DSRVCPSHVL+F PG+AFVVRNIANMV
Sbjct  61   TFKKEKYDTNPALYGELAKGQSPKYMVFACSDSRVCPSHVLNFHPGDAFVVRNIANMV  118



>ref|XP_007223694.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 ref|XP_007223695.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 gb|EMJ24893.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
 gb|EMJ24894.1| hypothetical protein PRUPE_ppa010344mg [Prunus persica]
Length=253

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-PTQQIKNGFVHFKTEK  157
            M K +Y +AI  L K+LSE  +   +AAA I +ITAEL++    P ++I+ GF+HFK EK
Sbjct  1    MAKDSYEDAIAGLSKLLSENADLEGVAAAKIKQITAELESGGLDPVEKIRTGFLHFKKEK  60

Query  156  YEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +EK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   FEKDADLYDKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  112



>ref|XP_006369920.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
 gb|ERP66489.1| hypothetical protein POPTR_0001s34950g [Populus trichocarpa]
Length=246

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 7/101 (7%)
 Frame = -1

Query  282  SEKREYGaiaaaaINEITAELQTSDA-------PTQQIKNGFVHFKTEKYEKNTALYGEL  124
            S+K E   +AAA + +ITAELQT+ +       P ++IK+GF+HFK EKY+KN  LY EL
Sbjct  5    SDKEELKTVAAAKVEQITAELQTASSSDPKAFDPVEKIKSGFIHFKKEKYDKNPGLYSEL  64

Query  123  AKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            AKGQSPKFMVFAC+DSRVCPSHVLDFQPGEAFV+RN+ANMV
Sbjct  65   AKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVLRNVANMV  105



>ref|XP_004155357.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform 2 [Cucumis 
sativus]
Length=258

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA------PTQQIKNGFVH  172
            M + +Y EAI  L K+LSEK +    AAA I +ITAEL  S A      P  +IK GF H
Sbjct  1    MAQESYEEAIAGLSKLLSEKADLQDAAAAKIRQITAELAGSSACSNGFDPVDRIKTGFTH  60

Query  171  FKTEKYEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            FK  K+E N  LYG LAKGQSPKF+VFAC+DSRVCPSH+L+FQPGEAF+VRNIANMV
Sbjct  61   FKKSKFETNPELYGALAKGQSPKFLVFACSDSRVCPSHILNFQPGEAFMVRNIANMV  117



>ref|XP_008221815.1| PREDICTED: carbonic anhydrase 2-like [Prunus mume]
Length=253

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  333  MTKGNYGEAIEELRKVLSEKREYGaiaaaaINEITAELQTSDA-PTQQIKNGFVHFKTEK  157
            M K +Y +AI  L K+LSEK +   +AAA I +IT EL++    P ++I+ GF+HFK EK
Sbjct  1    MAKDSYEDAIAGLSKLLSEKADLEGVAAAKIKQITEELESGGLDPVEKIRTGFLHFKKEK  60

Query  156  YEKNTALYGELAKGQSPKFMVFACADSRVCPSHVLDFQPGEAFVVRNIANMV  1
            +EK+  LY +LA GQSPKFMVFAC+DSRVCPSH+L+FQPGEAFVVRNIANMV
Sbjct  61   FEKDADLYDKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514890587360