BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13961_g1_i1 len=367 path=[345:0-366]

Length=367
                                                                      Score     E

ref|XP_002512112.1|  serine-threonine protein kinase, plant-type,...    247   3e-79   Ricinus communis
ref|XP_009763903.1|  PREDICTED: probable leucine-rich repeat rece...    246   2e-78   
ref|XP_009607072.1|  PREDICTED: probable leucine-rich repeat rece...    246   2e-78   
ref|XP_006359580.1|  PREDICTED: probable leucine-rich repeat rece...    245   5e-78   
gb|AEA86320.1|  leucine-rich repeat receptor protein kinase             240   6e-78   
ref|XP_002269214.1|  PREDICTED: probable leucine-rich repeat rece...    244   1e-77   Vitis vinifera
ref|XP_004228366.1|  PREDICTED: probable leucine-rich repeat rece...    244   1e-77   
ref|XP_010096578.1|  hypothetical protein L484_004254                   243   2e-77   
gb|KDP41277.1|  hypothetical protein JCGZ_15684                         243   2e-77   
ref|XP_010546181.1|  PREDICTED: probable leucine-rich repeat rece...    243   3e-77   
gb|KFK27889.1|  hypothetical protein AALP_AA8G442600                    242   5e-77   
ref|XP_010443939.1|  PREDICTED: probable leucine-rich repeat rece...    242   5e-77   
emb|CDY16817.1|  BnaA09g05650D                                          242   5e-77   
gb|KCW86527.1|  hypothetical protein EUGRSUZ_B03173                     240   5e-77   
gb|AGJ70091.1|  LRR-like disease resistance protein                     242   5e-77   
ref|XP_009111984.1|  PREDICTED: leucine-rich repeat receptor-like...    242   5e-77   
ref|XP_004297259.1|  PREDICTED: probable leucine-rich repeat rece...    242   6e-77   
ref|XP_010483790.1|  PREDICTED: probable leucine-rich repeat rece...    242   6e-77   
ref|NP_200932.2|  leucine-rich repeat-containing protein                242   6e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457081.1|  PREDICTED: LRR receptor-like serine/threonin...    242   7e-77   
ref|XP_006394525.1|  hypothetical protein EUTSA_v10004587mg             242   7e-77   
ref|XP_002864726.1|  protein binding protein                            242   7e-77   
ref|XP_009136457.1|  PREDICTED: probable leucine-rich repeat rece...    242   8e-77   
ref|XP_008221531.1|  PREDICTED: probable leucine-rich repeat rece...    241   9e-77   
ref|XP_007225691.1|  hypothetical protein PRUPE_ppa008519mg             241   1e-76   
ref|XP_009356367.1|  PREDICTED: probable leucine-rich repeat rece...    241   1e-76   
ref|XP_008361775.1|  PREDICTED: probable leucine-rich repeat rece...    241   2e-76   
ref|XP_010044430.1|  PREDICTED: probable leucine-rich repeat rece...    241   2e-76   
ref|XP_008350908.1|  PREDICTED: probable leucine-rich repeat rece...    241   2e-76   
gb|AFK44352.1|  unknown                                                 235   2e-76   
ref|XP_010522880.1|  PREDICTED: probable leucine-rich repeat rece...    240   3e-76   
ref|XP_006280810.1|  hypothetical protein CARUB_v10026779mg             240   4e-76   
ref|XP_010904953.1|  PREDICTED: probable leucine-rich repeat rece...    239   6e-76   
emb|CDX87206.1|  BnaC09g05210D                                          239   6e-76   
ref|XP_008390046.1|  PREDICTED: probable leucine-rich repeat rece...    241   6e-76   
ref|XP_006378575.1|  hypothetical protein POPTR_0010s16810g             238   7e-76   
ref|XP_008805099.1|  PREDICTED: probable leucine-rich repeat rece...    239   7e-76   
ref|XP_003518760.1|  PREDICTED: probable leucine-rich repeat rece...    239   9e-76   
gb|ABZ85667.1|  LRR-like disease resistance protein                     239   1e-75   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_007157582.1|  hypothetical protein PHAVU_002G081300g             239   1e-75   
ref|XP_006477621.1|  PREDICTED: probable leucine-rich repeat rece...    238   2e-75   
ref|XP_006440692.1|  hypothetical protein CICLE_v10021138mg             238   2e-75   
ref|XP_004490152.1|  PREDICTED: probable leucine-rich repeat rece...    238   2e-75   
gb|AFK44024.1|  unknown                                                 238   2e-75   
ref|XP_006837045.1|  hypothetical protein AMTR_s00110p00050600          238   2e-75   
gb|KDO54585.1|  hypothetical protein CISIN_1g0203982mg                  237   3e-75   
ref|XP_011012324.1|  PREDICTED: probable leucine-rich repeat rece...    238   3e-75   
ref|XP_002315009.2|  leucine-rich repeat family protein                 238   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011012317.1|  PREDICTED: probable leucine-rich repeat rece...    238   4e-75   
ref|XP_008446420.1|  PREDICTED: probable leucine-rich repeat rece...    237   4e-75   
ref|XP_010936342.1|  PREDICTED: probable leucine-rich repeat rece...    237   6e-75   
ref|XP_004135152.1|  PREDICTED: probable leucine-rich repeat rece...    237   7e-75   
ref|XP_004155299.1|  PREDICTED: probable leucine-rich repeat rece...    237   7e-75   
ref|NP_001239691.1|  probable leucine-rich repeat receptor-like p...    236   9e-75   
ref|XP_011018203.1|  PREDICTED: probable leucine-rich repeat rece...    236   1e-74   
ref|XP_009406000.1|  PREDICTED: probable leucine-rich repeat rece...    236   1e-74   
ref|XP_009395633.1|  PREDICTED: probable leucine-rich repeat rece...    236   2e-74   
ref|XP_003614019.1|  Leucine-rich repeat receptor protein kinase EXS    235   3e-74   
ref|XP_007045927.1|  Leucine-rich repeat (LRR) family protein iso...    232   4e-74   
ref|XP_007045926.1|  Leucine-rich repeat (LRR) family protein iso...    233   7e-74   
ref|XP_002312277.2|  leucine-rich repeat family protein                 234   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_007045925.1|  Leucine-rich repeat (LRR) family protein iso...    233   1e-73   
ref|XP_010258135.1|  PREDICTED: probable leucine-rich repeat rece...    233   2e-73   
ref|XP_009396426.1|  PREDICTED: probable leucine-rich repeat rece...    233   2e-73   
ref|XP_004143790.1|  PREDICTED: probable leucine-rich repeat rece...    233   3e-73   
ref|NP_001190586.1|  leucine-rich repeat-containing protein             233   3e-73   
ref|XP_006649619.1|  PREDICTED: probable leucine-rich repeat rece...    233   3e-73   
emb|CDP00407.1|  unnamed protein product                                233   3e-73   
ref|XP_010680733.1|  PREDICTED: probable leucine-rich repeat rece...    232   5e-73   
ref|XP_010259148.1|  PREDICTED: probable leucine-rich repeat rece...    232   5e-73   
ref|NP_001049352.1|  Os03g0211900                                       232   5e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011075577.1|  PREDICTED: probable leucine-rich repeat rece...    231   1e-72   
ref|XP_008465704.1|  PREDICTED: probable leucine-rich repeat rece...    230   4e-72   
ref|XP_011070958.1|  PREDICTED: probable leucine-rich repeat rece...    226   1e-70   
ref|XP_010936344.1|  PREDICTED: probable leucine-rich repeat rece...    220   4e-69   
gb|EPS67923.1|  hypothetical protein M569_06848                         221   6e-69   
gb|KHG13981.1|  LRR receptor-like serine/threonine-protein kinase...    218   1e-67   
tpg|DAA44040.1|  TPA: hypothetical protein ZEAMMB73_778718              216   5e-67   
ref|XP_003558509.1|  PREDICTED: probable leucine-rich repeat rece...    216   6e-67   
ref|XP_010554295.1|  PREDICTED: probable leucine-rich repeat rece...    216   6e-67   
ref|XP_002465654.1|  hypothetical protein SORBIDRAFT_01g043160          216   7e-67   Sorghum bicolor [broomcorn]
gb|ACN31699.1|  unknown                                                 216   8e-67   Zea mays [maize]
ref|NP_001132758.1|  uncharacterized protein LOC100194245 precursor     216   8e-67   Zea mays [maize]
ref|XP_010554293.1|  PREDICTED: probable leucine-rich repeat rece...    216   9e-67   
ref|XP_010554294.1|  PREDICTED: probable leucine-rich repeat rece...    216   9e-67   
ref|XP_007037490.1|  Leucine-rich repeat (LRR) family protein iso...    215   2e-66   
gb|AAK70805.1|  leucine-rich repeat resistance protein-like protein     214   4e-66   Gossypium hirsutum [American cotton]
ref|XP_004985227.1|  PREDICTED: probable leucine-rich repeat rece...    214   5e-66   
gb|KHG30687.1|  hypothetical protein F383_06797                         214   5e-66   
gb|EPS71094.1|  hypothetical protein M569_03661                         207   1e-63   
ref|XP_006417079.1|  hypothetical protein EUTSA_v10008166mg             206   5e-63   
ref|XP_010476421.1|  PREDICTED: probable leucine-rich repeat rece...    204   3e-62   
ref|XP_002890027.1|  leucine-rich repeat family protein                 203   9e-62   
ref|XP_010495663.1|  PREDICTED: LRR receptor-like serine/threonin...    202   2e-61   
ref|NP_172844.1|  leucine-rich repeat (LRR) family protein              201   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458859.1|  PREDICTED: LRR receptor-like serine/threonin...    201   8e-61   
gb|AAF79397.1|AC068197_7  F16A14.12                                     202   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305321.1|  hypothetical protein CARUB_v10009699mg             199   3e-60   
gb|KHG02754.1|  Receptor-like protein kinase HSL1                       187   4e-56   
gb|EYU22380.1|  hypothetical protein MIMGU_mgv1a022828mg                174   2e-52   
ref|XP_002986028.1|  hypothetical protein SELMODRAFT_123489             171   1e-49   
ref|XP_010458858.1|  PREDICTED: receptor-like protein 12 isoform X1     170   3e-49   
ref|XP_002989597.1|  hypothetical protein SELMODRAFT_160301             161   5e-46   
ref|XP_007037491.1|  Leucine-rich repeat family protein isoform 2       159   4e-45   
ref|XP_002989593.1|  hypothetical protein SELMODRAFT_130127             160   6e-45   
emb|CDY47028.1|  BnaC02g42130D                                          154   1e-44   
gb|AAT38740.1|  Putative leucine-rich repeat resistance protein, ...    150   7e-41   Solanum demissum
ref|XP_002982017.1|  hypothetical protein SELMODRAFT_421427             141   6e-37   
dbj|BAJ09394.1|  TuMV resistance-like protein                           140   5e-36   
ref|XP_004169857.1|  PREDICTED: probable leucine-rich repeat rece...    128   2e-35   
gb|KFK43641.1|  hypothetical protein AALP_AA1G153400                    122   2e-31   
gb|AFW89246.1|  hypothetical protein ZEAMMB73_044267                    108   1e-27   
ref|XP_004157333.1|  PREDICTED: probable leucine-rich repeat rece...    107   8e-26   
gb|KHG00184.1|  Receptor-like protein kinase HSL1                     81.3    1e-17   
ref|XP_002982025.1|  hypothetical protein SELMODRAFT_421442           87.4    2e-17   
emb|CDM84720.1|  unnamed protein product                              85.1    2e-16   
gb|EEE50765.1|  hypothetical protein OsJ_31119                        84.0    7e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AAM00988.1|AC090482_17  Putative receptor protein kinase           84.0    7e-16   Oryza sativa [red rice]
ref|NP_001064374.2|  Os10g0337400                                     83.6    9e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78081.1|  hypothetical protein OsI_33125                        82.8    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...  82.0    3e-15   
ref|XP_002448532.1|  hypothetical protein SORBIDRAFT_06g028570        80.9    6e-15   Sorghum bicolor [broomcorn]
gb|AHG54199.1|  LRR receptor-like protein kinase 1                    80.9    7e-15   
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    8e-15   
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    8e-15   
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase       80.5    9e-15   
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase       80.5    1e-14   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                   80.1    1e-14   
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg           80.1    2e-14   
ref|XP_004308369.1|  PREDICTED: probable LRR receptor-like serine...  79.7    2e-14   
gb|KDO39482.1|  hypothetical protein CISIN_1g041034mg                 79.3    2e-14   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...  79.3    3e-14   
emb|CBI35487.3|  unnamed protein product                              79.3    3e-14   
emb|CDY42863.1|  BnaAnng06880D                                        76.3    3e-14   
gb|AGT17059.1|  receptor kinase-like protein                          77.4    4e-14   
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g           79.0    4e-14   
gb|KDO43356.1|  hypothetical protein CISIN_1g038615mg                 75.9    4e-14   
ref|XP_011091154.1|  PREDICTED: polygalacturonase inhibitor-like      77.0    4e-14   
ref|XP_003055698.1|  predicted protein                                75.9    5e-14   
ref|XP_008801288.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    5e-14   
gb|KCW71354.1|  hypothetical protein EUGRSUZ_F04434                   78.2    6e-14   
gb|KCW71353.1|  hypothetical protein EUGRSUZ_F04434                   78.2    6e-14   
ref|XP_006428847.1|  hypothetical protein CICLE_v10013366mg           75.5    6e-14   
emb|CAN66410.1|  hypothetical protein VITISV_020977                   77.8    6e-14   Vitis vinifera
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...  77.8    7e-14   
emb|CDP15606.1|  unnamed protein product                              77.8    7e-14   
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    8e-14   
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    9e-14   
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...  77.8    9e-14   
gb|KFK43514.1|  hypothetical protein AALP_AA1G135400                  77.4    1e-13   
ref|XP_002526114.1|  receptor-kinase, putative                        77.4    1e-13   Ricinus communis
emb|CDY68959.1|  BnaCnng61190D                                        75.5    1e-13   
ref|XP_006480685.1|  PREDICTED: probable leucine-rich repeat rece...  76.6    1e-13   
dbj|BAP56049.1|  NHL repeat-containing protein                        77.4    1e-13   
ref|XP_002515504.1|  ATP binding protein, putative                    77.0    1e-13   Ricinus communis
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...  77.0    1e-13   
gb|EMT06735.1|  Putative LRR receptor-like serine/threonine-prote...  77.0    1e-13   
ref|XP_004292981.1|  PREDICTED: probable LRR receptor-like serine...  77.0    2e-13   
emb|CDY61244.1|  BnaCnng37500D                                        77.0    2e-13   
emb|CAN79070.1|  hypothetical protein VITISV_031965                   76.6    2e-13   Vitis vinifera
ref|XP_010064054.1|  PREDICTED: probable LRR receptor-like serine...  77.0    2e-13   
ref|XP_004967218.1|  PREDICTED: probable LRR receptor-like serine...  77.0    2e-13   
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...  76.6    2e-13   
dbj|BAF79953.1|  receptor-like kinase                                 76.3    2e-13   Marchantia polymorpha
gb|AFW76467.1|  putative leucine-rich repeat receptor-like protei...  76.6    2e-13   
ref|XP_001773846.1|  predicted protein                                75.5    2e-13   
ref|XP_011091153.1|  PREDICTED: polygalacturonase inhibitor-like      74.3    2e-13   
ref|XP_008650458.1|  PREDICTED: probable LRR receptor-like serine...  76.3    3e-13   
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg           76.3    3e-13   
ref|XP_010064052.1|  PREDICTED: probable LRR receptor-like serine...  73.9    3e-13   
ref|XP_010026004.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-13   
ref|XP_004976816.1|  PREDICTED: probable LRR receptor-like serine...  76.3    3e-13   
gb|EMS68409.1|  LRR receptor-like serine/threonine-protein kinase...  76.3    3e-13   
gb|KEH19860.1|  LRR receptor-like kinase family protein               72.8    3e-13   
emb|CDX83185.1|  BnaA03g23210D                                        73.2    3e-13   
ref|XP_010064058.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-13   
gb|AHG54200.1|  LRR receptor-like protein kinase 2                    75.9    4e-13   
ref|XP_008680604.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    4e-13   
gb|EEC80874.1|  hypothetical protein OsI_23501                        75.9    4e-13   Oryza sativa Indica Group [Indian rice]
emb|CDP20793.1|  unnamed protein product                              75.5    4e-13   
gb|KEH19878.1|  LRR receptor-like kinase                              72.4    5e-13   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  75.1    5e-13   
ref|XP_010905353.1|  PREDICTED: probable LRR receptor-like serine...  75.5    5e-13   
ref|XP_006436572.1|  hypothetical protein CICLE_v10033583mg           74.7    5e-13   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  75.1    5e-13   
ref|XP_009417199.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    6e-13   
gb|KCW45345.1|  hypothetical protein EUGRSUZ_L00983                   75.1    6e-13   
ref|NP_001238448.1|  NSP-interacting kinase precursor                 74.7    6e-13   
ref|XP_010026000.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    6e-13   
gb|KEH19906.1|  LRR receptor-like kinase family protein               71.6    6e-13   
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    6e-13   
ref|XP_004976815.1|  PREDICTED: probable LRR receptor-like serine...  75.5    6e-13   
ref|XP_002265946.1|  PREDICTED: receptor-like protein kinase 2        75.1    6e-13   Vitis vinifera
ref|XP_010656659.1|  PREDICTED: probable leucine-rich repeat rece...  75.5    6e-13   
ref|XP_010069675.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    7e-13   
ref|XP_010943538.1|  PREDICTED: polygalacturonase inhibitor-like      73.2    7e-13   
ref|XP_010523517.1|  PREDICTED: leucine-rich repeat receptor prot...  75.1    7e-13   
ref|XP_010441110.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    7e-13   
ref|XP_006303147.1|  hypothetical protein CARUB_v10008271mg           75.1    8e-13   
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...  75.1    8e-13   
ref|XP_008234273.1|  PREDICTED: leucine-rich repeat receptor prot...  75.1    8e-13   
ref|XP_009589616.1|  PREDICTED: receptor-like protein kinase          73.2    8e-13   
ref|XP_010690203.1|  PREDICTED: probable leucine-rich repeat rece...  74.7    8e-13   
emb|CBI22182.3|  unnamed protein product                              74.7    8e-13   
emb|CBN74819.1|  Hypothetical leucine rich repeat protein             72.4    8e-13   
gb|AAK43424.1|  polygalacturonase inhibitor protein                   72.0    9e-13   Physocarpus capitatus
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...  74.7    9e-13   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                   74.7    9e-13   
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg           74.7    9e-13   
emb|CBN79779.1|  Hypothetical leucine rich repeat protein             72.0    9e-13   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...  73.6    1e-12   
ref|XP_010030336.1|  PREDICTED: probable leucine-rich repeat rece...  74.7    1e-12   
emb|CDP20736.1|  unnamed protein product                              74.7    1e-12   
ref|XP_003516680.1|  PREDICTED: probable LRR receptor-like serine...  74.3    1e-12   
ref|XP_011072437.1|  PREDICTED: probable LRR receptor-like serine...  74.3    1e-12   
ref|XP_011072429.1|  PREDICTED: probable LRR receptor-like serine...  74.3    1e-12   
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  73.9    1e-12   Populus trichocarpa [western balsam poplar]
emb|CAH67463.1|  OSIGBa0159I10.8                                      73.9    1e-12   Oryza sativa [red rice]
gb|EMT04510.1|  Polygalacturonase inhibitor                           72.4    1e-12   
gb|EMT21840.1|  Putative LRR receptor-like serine/threonine-prote...  74.3    1e-12   
gb|AAK43425.1|  polygalacturonase inhibitor protein                   71.6    1e-12   Physocarpus opulifolius [ninebark]
gb|KCW56526.1|  hypothetical protein EUGRSUZ_I02251                   74.3    1e-12   
ref|XP_010937489.1|  PREDICTED: nodulation receptor kinase-like       74.3    1e-12   
ref|XP_006353961.1|  PREDICTED: putative receptor-like protein ki...  74.3    1e-12   
gb|AAK43423.1|  polygalacturonase inhibitor protein                   71.2    1e-12   Physocarpus capitatus
ref|XP_006485280.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    1e-12   
gb|KEH21568.1|  LRR receptor-like kinase family protein               74.3    1e-12   
emb|CAD41514.3|  OSJNBb0020O11.17                                     73.9    1e-12   
ref|XP_009605193.1|  PREDICTED: probable leucine-rich repeat rece...  74.3    1e-12   
emb|CDY21455.1|  BnaC03g27420D                                        74.3    1e-12   
ref|XP_010025444.1|  PREDICTED: probable LRR receptor-like serine...  73.9    1e-12   
gb|AAK43460.1|  polygalacturonase inhibitor protein                   71.2    1e-12   Neillia hanceana
gb|AAK43462.1|  polygalacturonase inhibitor protein                   71.2    1e-12   Neillia hanceana
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.9    1e-12   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        70.9    1e-12   Sorghum bicolor [broomcorn]
gb|EYU33236.1|  hypothetical protein MIMGU_mgv1a021943mg              74.3    1e-12   
ref|XP_010941603.1|  PREDICTED: probable LRR receptor-like serine...  74.3    1e-12   
gb|EPS67674.1|  hypothetical protein M569_07098                       73.9    1e-12   
ref|XP_003596118.1|  Receptor protein kinase-like protein             73.9    2e-12   
ref|XP_007224199.1|  hypothetical protein PRUPE_ppa017326mg           73.6    2e-12   
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1     73.6    2e-12   
ref|XP_002277606.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   Vitis vinifera
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   
emb|CDX83184.1|  BnaA03g23220D                                        73.9    2e-12   
gb|KDP44797.1|  hypothetical protein JCGZ_01297                       73.9    2e-12   
ref|WP_007565775.1|  hypothetical protein                             73.6    2e-12   
ref|XP_004235483.1|  PREDICTED: putative receptor-like protein ki...  73.9    2e-12   
gb|KEH19363.1|  LRR receptor-like kinase family protein               73.9    2e-12   
ref|XP_011099069.1|  PREDICTED: putative receptor-like protein ki...  73.9    2e-12   
ref|XP_002277477.1|  PREDICTED: probable LRR receptor-like serine...  73.6    2e-12   Vitis vinifera
ref|WP_022125399.1|  leucine Rich Repeat protein                      73.6    2e-12   
ref|XP_010684703.1|  PREDICTED: probable LRR receptor-like serine...  73.9    2e-12   
gb|EDN70504.1|  conserved hypothetical protein                        73.9    2e-12   Beggiatoa sp. PS
ref|XP_010065134.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   
ref|XP_002273399.2|  PREDICTED: probable leucine-rich repeat rece...  73.6    2e-12   Vitis vinifera
ref|XP_008795782.1|  PREDICTED: LRR receptor-like serine/threonin...  73.9    2e-12   
ref|XP_010661041.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    2e-12   
emb|CBJ26403.1|  Putative Leucine Rich Repeat Protein                 71.2    2e-12   
ref|XP_007040033.1|  Leucine-rich repeat protein kinase family pr...  73.2    2e-12   
gb|KDO61621.1|  hypothetical protein CISIN_1g001658mg                 73.6    2e-12   
ref|XP_008669509.1|  PREDICTED: probable LRR receptor-like serine...  73.6    2e-12   
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    2e-12   
ref|XP_006465748.1|  PREDICTED: uncharacterized protein LOC102628178  73.9    2e-12   
gb|KEH19869.1|  LRR receptor-like kinase                              70.5    2e-12   
gb|KDO53732.1|  hypothetical protein CISIN_1g002688mg                 73.6    2e-12   
ref|XP_006436566.1|  hypothetical protein CICLE_v10030621mg           73.6    2e-12   
ref|XP_010064689.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    2e-12   
dbj|BAA98164.1|  receptor protein kinase-like                         73.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  73.2    2e-12   
gb|KEH19908.1|  LRR receptor-like kinase family protein               70.5    2e-12   
ref|XP_008652851.1|  PREDICTED: probable LRR receptor-like serine...  73.6    2e-12   
ref|XP_006426831.1|  hypothetical protein CICLE_v10026969mg           73.6    2e-12   
ref|XP_006422235.1|  hypothetical protein CICLE_v10007054mg           73.6    3e-12   
ref|XP_007040030.1|  Leucine-rich repeat protein kinase family pr...  73.6    3e-12   
ref|XP_004973785.1|  PREDICTED: probable LRR receptor-like serine...  73.6    3e-12   
gb|KHG18414.1|  hypothetical protein F383_21876                       73.2    3e-12   
ref|XP_010656643.1|  PREDICTED: uncharacterized protein LOC104880714  73.6    3e-12   
gb|AFK43911.1|  unknown                                               70.5    3e-12   
gb|EMT09183.1|  Putative LRR receptor-like serine/threonine-prote...  73.6    3e-12   
ref|XP_011080986.1|  PREDICTED: probable LRR receptor-like serine...  73.2    3e-12   
gb|EYU33237.1|  hypothetical protein MIMGU_mgv1a000884mg              73.6    3e-12   
ref|XP_008663599.1|  PREDICTED: probable LRR receptor-like serine...  73.6    3e-12   
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2     72.8    3e-12   
emb|CBN78645.1|  Hypothetical leucine rich repeat protein             69.7    3e-12   
gb|EAZ09499.1|  hypothetical protein OsI_31772                        72.8    3e-12   
ref|XP_010482266.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    3e-12   
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      72.8    3e-12   
gb|KCW68455.1|  hypothetical protein EUGRSUZ_F02114                   73.6    3e-12   
ref|XP_008231611.1|  PREDICTED: probable LRR receptor-like serine...  73.2    3e-12   
dbj|BAD34181.1|  putative protein kinase Xa21                         73.2    3e-12   
ref|XP_006415654.1|  hypothetical protein EUTSA_v10006677mg           73.2    3e-12   
gb|EMT04722.1|  Putative LRR receptor-like serine/threonine-prote...  73.2    3e-12   
ref|XP_007040031.1|  Leucine-rich repeat protein kinase family pr...  73.2    3e-12   
ref|XP_006415653.1|  hypothetical protein EUTSA_v10006677mg           73.2    3e-12   
dbj|BAJ98494.1|  predicted protein                                    73.2    3e-12   
ref|XP_006827421.1|  hypothetical protein AMTR_s00009p00076890        73.2    3e-12   
gb|EEE65939.1|  hypothetical protein OsJ_21813                        73.2    3e-12   
gb|KEH25224.1|  NSP-interacting kinase-like protein                   72.4    3e-12   
ref|XP_008775331.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    3e-12   
ref|XP_009417299.1|  PREDICTED: polygalacturonase inhibitor-like      71.2    3e-12   
ref|XP_010476218.1|  PREDICTED: probable LRR receptor-like serine...  73.2    3e-12   
ref|XP_006573744.1|  PREDICTED: probable LRR receptor-like serine...  73.2    3e-12   
gb|KHN42733.1|  Putative LRR receptor-like serine/threonine-prote...  73.2    3e-12   
emb|CDP19285.1|  unnamed protein product                              73.2    3e-12   
ref|XP_006657088.1|  PREDICTED: putative receptor-like protein ki...  73.2    3e-12   
dbj|BAD46328.1|  putative Receptor-like protein kinase precursor      73.2    3e-12   
gb|EAZ45126.1|  hypothetical protein OsJ_29763                        73.2    3e-12   
gb|KCW68823.1|  hypothetical protein EUGRSUZ_F02424                   71.2    4e-12   
ref|XP_003631327.1|  PREDICTED: LRR receptor-like serine/threonin...  73.2    4e-12   
dbj|BAK02741.1|  predicted protein                                    73.2    4e-12   
gb|EMS61225.1|  LRR receptor-like serine/threonine-protein kinase...  73.2    4e-12   
emb|CDX83183.1|  BnaA03g23230D                                        72.8    4e-12   
gb|AAF22250.1|AF159169_1  polygalacturonase-inhibiting protein        70.5    4e-12   
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...  72.8    4e-12   
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein     72.8    4e-12   
gb|KEH25223.1|  NSP-interacting kinase-like protein                   72.4    4e-12   
gb|KCW86417.1|  hypothetical protein EUGRSUZ_B03087                   72.4    4e-12   
ref|XP_009775020.1|  PREDICTED: probable LRR receptor-like serine...  72.8    4e-12   
ref|NP_001176123.1|  Os10g0375000                                     72.8    4e-12   
emb|CDP11288.1|  unnamed protein product                              72.8    4e-12   
gb|KCW54188.1|  hypothetical protein EUGRSUZ_I00176                   72.0    4e-12   
emb|CAN73893.1|  hypothetical protein VITISV_028202                   71.2    4e-12   
ref|XP_009344533.1|  PREDICTED: probable LRR receptor-like serine...  72.8    4e-12   
ref|XP_009344532.1|  PREDICTED: probable LRR receptor-like serine...  72.8    4e-12   
gb|AAM08659.1|AC113338_15  Putative receptor like protein kinase      72.8    4e-12   
emb|CDP11089.1|  unnamed protein product                              72.8    4e-12   
ref|XP_010041484.1|  PREDICTED: probable LRR receptor-like serine...  72.8    4e-12   
emb|CBJ29735.1|  Hypothetical leucine rich repeat protein             70.9    5e-12   
ref|XP_002515904.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  72.8    5e-12   
ref|XP_002439362.1|  hypothetical protein SORBIDRAFT_09g005150        72.8    5e-12   
gb|AAF22248.1|AF159167_1  polygalacturonase-inhibiting protein        70.5    5e-12   
ref|XP_009402861.1|  PREDICTED: probable LRR receptor-like serine...  72.4    5e-12   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...  72.8    5e-12   
ref|XP_002864015.1|  hypothetical protein ARALYDRAFT_495037           72.8    5e-12   
ref|XP_010939782.1|  PREDICTED: probable LRR receptor-like serine...  72.8    5e-12   
ref|XP_010920308.1|  PREDICTED: probable LRR receptor-like serine...  72.0    5e-12   
emb|CDY21452.1|  BnaC03g27450D                                        72.4    5e-12   
emb|CBN78644.1|  LRR-GTPase of the ROCO family                        72.8    5e-12   
ref|XP_010065069.1|  PREDICTED: probable LRR receptor-like serine...  72.8    5e-12   
ref|XP_008380732.1|  PREDICTED: probable LRR receptor-like serine...  72.4    5e-12   
gb|EEE50854.1|  hypothetical protein OsJ_31298                        72.8    5e-12   
ref|XP_006354067.1|  PREDICTED: probable leucine-rich repeat rece...  72.8    5e-12   
ref|XP_008392099.1|  PREDICTED: polygalacturonase inhibitor-like      70.9    5e-12   
ref|XP_010934390.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    5e-12   
gb|KCW57972.1|  hypothetical protein EUGRSUZ_H00707                   72.4    5e-12   
gb|EMS68150.1|  Receptor-like protein kinase HSL1                     72.4    5e-12   
gb|EAZ23070.1|  hypothetical protein OsJ_06763                        68.9    5e-12   
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg           72.8    5e-12   
gb|AAP92912.1|  polygalacturonase-inhibiting protein                  70.5    5e-12   
emb|CDX79713.1|  BnaC03g20490D                                        72.4    5e-12   
gb|AAK43418.1|  polygalacturonase inhibitor protein                   69.7    5e-12   
ref|XP_010546091.1|  PREDICTED: leucine-rich repeat receptor prot...  72.8    5e-12   
gb|AFC95832.1|  pgip protein                                          70.5    5e-12   
gb|AES94162.2|  LRR receptor-like kinase family protein               72.4    6e-12   
gb|AAB19212.1|  polygalacturonase-inhibiting protein                  70.5    6e-12   
emb|CAN76220.1|  hypothetical protein VITISV_020133                   72.4    6e-12   
emb|CAN83365.1|  hypothetical protein VITISV_032776                   69.3    6e-12   
ref|XP_003611204.1|  Protein kinase like protein                      72.4    6e-12   
ref|XP_009341206.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-12   
gb|EEC66835.1|  hypothetical protein OsI_33296                        72.4    6e-12   
ref|XP_006580595.1|  PREDICTED: probable LRR receptor-like serine...  72.0    6e-12   
gb|AAK43420.1|  polygalacturonase inhibitor protein                   69.3    6e-12   
gb|AAF22252.1|AF159171_1  polygalacturonase-inhibiting protein        70.1    6e-12   
emb|CAJ26360.1|  clavata-like kinase                                  72.4    6e-12   
gb|KHN23658.1|  Putative LRR receptor-like serine/threonine-prote...  72.0    6e-12   
ref|XP_006433996.1|  hypothetical protein CICLE_v10003409mg           72.4    6e-12   
dbj|BAD82283.1|  putative receptor-like protein kinase 2              72.4    6e-12   
ref|XP_004976817.1|  PREDICTED: probable LRR receptor-like serine...  72.4    6e-12   
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    6e-12   
ref|XP_010240425.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  72.4    6e-12   
gb|EMT03007.1|  Putative LRR receptor-like serine/threonine-prote...  72.4    6e-12   
gb|EMT18590.1|  Putative LRR receptor-like serine/threonine-prote...  72.4    6e-12   
gb|AAK43426.1|  polygalacturonase inhibitor protein                   69.3    6e-12   
gb|KDO64791.1|  hypothetical protein CISIN_1g011005mg                 71.6    6e-12   
ref|XP_009412457.1|  PREDICTED: LRR receptor-like serine/threonin...  72.4    6e-12   
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    6e-12   
ref|XP_002985696.1|  hypothetical protein SELMODRAFT_122589           71.6    6e-12   
ref|XP_006306677.1|  hypothetical protein CARUB_v10008195mg           72.4    7e-12   
gb|AFL47812.1|  SYMRK                                                 72.0    7e-12   
ref|XP_006659920.1|  PREDICTED: probable LRR receptor-like serine...  72.4    7e-12   
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    7e-12   
gb|KCW57971.1|  hypothetical protein EUGRSUZ_H00707                   72.0    7e-12   
ref|XP_008219685.1|  PREDICTED: probable LRR receptor-like serine...  72.0    7e-12   
ref|XP_009121824.1|  PREDICTED: DNA-damage-repair/toleration prot...  70.9    7e-12   
ref|XP_010064059.1|  PREDICTED: probable LRR receptor-like serine...  72.0    7e-12   
ref|XP_009363708.1|  PREDICTED: probable LRR receptor-like serine...  72.0    7e-12   
gb|AAK43441.1|  polygalacturonase inhibitor protein                   69.3    7e-12   
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    7e-12   
gb|AAK43439.1|  polygalacturonase inhibitor protein                   69.3    7e-12   
gb|EMT06652.1|  Putative LRR receptor-like serine/threonine-prote...  72.0    7e-12   
ref|XP_010026002.1|  PREDICTED: probable LRR receptor-like serine...  72.0    7e-12   
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    7e-12   
emb|CDP12430.1|  unnamed protein product                              72.0    8e-12   
ref|XP_004955901.1|  PREDICTED: probable LRR receptor-like serine...  72.0    8e-12   
ref|XP_001698760.1|  hypothetical protein CHLREDRAFT_151874           70.5    8e-12   
ref|XP_007018791.1|  Receptor protein kinase, putative                72.0    8e-12   
ref|XP_002890776.1|  hypothetical protein ARALYDRAFT_473063           72.0    8e-12   
gb|KDO62284.1|  hypothetical protein CISIN_1g042568mg                 72.0    8e-12   
ref|XP_002974221.1|  hypothetical protein SELMODRAFT_101476           71.2    8e-12   
ref|XP_002976019.1|  hypothetical protein SELMODRAFT_415912           72.0    8e-12   
ref|XP_003578296.1|  PREDICTED: probable LRR receptor-like serine...  72.0    8e-12   
ref|XP_002965420.1|  hypothetical protein SELMODRAFT_406781           72.0    8e-12   
ref|XP_006850089.1|  hypothetical protein AMTR_s00022p00219620        70.1    8e-12   
ref|XP_010648218.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    8e-12   
ref|XP_010053898.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    8e-12   
ref|XP_009772535.1|  PREDICTED: probable LRR receptor-like serine...  71.2    8e-12   
ref|XP_006584713.1|  PREDICTED: probable LRR receptor-like serine...  71.6    8e-12   
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  71.6    8e-12   
ref|XP_004156406.1|  PREDICTED: probable LRR receptor-like serine...  72.0    8e-12   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010        71.6    8e-12   
gb|AAK43391.1|  polygalacturonase inhibitor protein                   68.9    8e-12   
ref|XP_008368372.1|  PREDICTED: probable LRR receptor-like serine...  68.9    8e-12   
gb|KCW57970.1|  hypothetical protein EUGRSUZ_H00707                   72.0    8e-12   
ref|XP_003635790.1|  Receptor-like kinase                             72.4    8e-12   
ref|XP_008366930.1|  PREDICTED: probable leucine-rich repeat rece...  68.9    8e-12   
ref|XP_006282197.1|  hypothetical protein CARUB_v10028463mg           71.6    9e-12   
gb|EYU28102.1|  hypothetical protein MIMGU_mgv1a000498mg              72.0    9e-12   
ref|XP_010065125.1|  PREDICTED: probable LRR receptor-like serine...  71.6    9e-12   
emb|CBI29785.3|  unnamed protein product                              72.0    9e-12   
ref|XP_008237205.1|  PREDICTED: probable LRR receptor-like serine...  72.0    9e-12   
ref|XP_010265745.1|  PREDICTED: probable LRR receptor-like serine...  72.0    9e-12   
ref|NP_199788.1|  putative leucine-rich repeat receptor-like prot...  72.0    9e-12   
gb|EAZ01471.1|  hypothetical protein OsI_23505                        71.2    9e-12   
ref|XP_004979262.1|  PREDICTED: probable LRR receptor-like serine...  72.0    9e-12   
gb|KEH16905.1|  LRR receptor-like kinase family protein               68.6    9e-12   
gb|AAK43399.1|  polygalacturonase inhibitor protein                   68.9    9e-12   
ref|XP_010042217.1|  PREDICTED: probable LRR receptor-like serine...  72.0    9e-12   
ref|XP_010928757.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    9e-12   
ref|XP_010546137.1|  PREDICTED: probable LRR receptor-like serine...  71.6    9e-12   
gb|AAK43422.1|  polygalacturonase inhibitor protein                   68.9    9e-12   
ref|XP_002271860.1|  PREDICTED: probable LRR receptor-like serine...  71.6    9e-12   
ref|XP_001783836.1|  predicted protein                                71.6    9e-12   
gb|EAZ13939.1|  hypothetical protein OsJ_03866                        71.6    9e-12   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  71.2    9e-12   
gb|AAK43409.1|  polygalacturonase inhibitor protein                   68.9    1e-11   
gb|KHG11536.1|  hypothetical protein F383_12106                       71.6    1e-11   
ref|XP_004301322.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    1e-11   
ref|XP_006282247.1|  hypothetical protein CARUB_v10028521mg           71.2    1e-11   
ref|XP_006453569.1|  hypothetical protein CICLE_v10010652mg           71.6    1e-11   
gb|AAX96206.1|  Similar to receptor-like protein kinase 3             71.6    1e-11   
ref|XP_006656186.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_010655871.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_003568840.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    1e-11   
gb|KCW82134.1|  hypothetical protein EUGRSUZ_C035232                  70.5    1e-11   
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690        71.6    1e-11   
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...  71.6    1e-11   
ref|XP_010494199.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_004143018.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_010321823.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    1e-11   
gb|AAP92911.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
gb|AFA46527.1|  polygalacturonase inhibitor protein                   69.7    1e-11   
ref|XP_004154463.1|  PREDICTED: receptor-like protein kinase 2-like   71.6    1e-11   
ref|XP_010040263.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_010462668.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
gb|ABU88861.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
dbj|BAA98166.1|  receptor protein kinase-like                         71.6    1e-11   
ref|WP_014021274.1|  RHS repeat-associated core domain-containing...  72.0    1e-11   
gb|KCW56528.1|  hypothetical protein EUGRSUZ_I02256                   70.9    1e-11   
gb|EMS62309.1|  LRR receptor-like serine/threonine-protein kinase...  71.6    1e-11   
gb|EAY76270.1|  hypothetical protein OsI_04206                        71.6    1e-11   
emb|CBN75997.1|  LRR-GTPase of the ROCO family                        71.6    1e-11   
gb|AEO36938.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
gb|AAR15145.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
ref|WP_029596657.1|  hypothetical protein                             68.9    1e-11   
ref|XP_002969057.1|  hypothetical protein SELMODRAFT_90370            71.6    1e-11   
ref|XP_002992868.1|  hypothetical protein SELMODRAFT_136102           71.6    1e-11   
ref|WP_021970251.1|  leucine Rich Repeat protein                      71.6    1e-11   
gb|ACJ65215.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
ref|XP_004139742.1|  PREDICTED: receptor-like protein kinase 2-like   71.6    1e-11   
emb|CAJ19346.1|  CLAVATA-like kinase                                  71.6    1e-11   
gb|KGN44495.1|  hypothetical protein Csa_7G318950                     71.6    1e-11   
gb|ACY56891.1|  polygalacturonase-inhibiting protein                  69.7    1e-11   
ref|XP_010040869.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-11   
ref|XP_006485260.1|  PREDICTED: probable LRR receptor-like serine...  71.2    1e-11   
sp|Q05091.1|PGIP_PYRCO  RecName: Full=Polygalacturonase inhibitor...  69.7    1e-11   
ref|XP_010655109.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    1e-11   
dbj|BAH20406.1|  AT1G12460                                            70.9    1e-11   
ref|XP_006390688.1|  hypothetical protein EUTSA_v10018075mg           71.2    1e-11   
gb|KGN62470.1|  hypothetical protein Csa_2G354960                     71.2    1e-11   
ref|XP_009356992.1|  PREDICTED: polygalacturonase inhibitor-like      69.7    1e-11   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   70.9    1e-11   
ref|XP_010655653.1|  PREDICTED: receptor-like protein 12              71.2    1e-11   
ref|NP_176483.1|  putative leucine-rich repeat transmembrane prot...  71.2    1e-11   
gb|AAF22249.1|AF159168_1  polygalacturonase-inhibiting protein        69.3    1e-11   
ref|NP_174166.1|  receptor-like protein kinase HSL1                   71.2    1e-11   
ref|XP_009617369.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-11   
ref|XP_010556795.1|  PREDICTED: probably inactive leucine-rich re...  70.1    1e-11   
ref|XP_006436485.1|  hypothetical protein CICLE_v10033508mg           71.2    1e-11   
ref|XP_010518150.1|  PREDICTED: probable LRR receptor-like serine...  70.9    1e-11   
gb|ABL85038.1|  polygalacturonase inhibitor                           69.7    1e-11   
gb|EMT27524.1|  Somatic embryogenesis receptor kinase 2               68.2    1e-11   
gb|EMT23073.1|  Putative LRR receptor-like serine/threonine-prote...  71.2    1e-11   
gb|EMT28000.1|  Putative LRR receptor-like serine/threonine-prote...  71.2    1e-11   
gb|KDP33585.1|  hypothetical protein JCGZ_07156                       70.9    1e-11   
gb|KDO48785.1|  hypothetical protein CISIN_1g039533mg                 71.2    1e-11   
gb|AAP92913.1|  polygalacturonase-inhibiting protein                  69.3    2e-11   
ref|XP_010271504.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    2e-11   
gb|EMT10242.1|  Putative LRR receptor-like serine/threonine-prote...  70.9    2e-11   



>ref|XP_002512112.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF50781.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=300

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFNN
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNN  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L ++     G  P  +  L +L    ++NN LTG +P Q+  L  L+IL++ +NK+  +I
Sbjct  175  LYLHENRFSGRIPAELGTLQNLRHFYLNNNYLTGGVPAQLSNLTNLEILHLSYNKMSGII  234

Query  305  PPEIGELKQLTHLYLSFNNFK  367
            P  I  + +LTHLYL  N F 
Sbjct  235  PAAIAHIPKLTHLYLDHNQFS  255



>ref|XP_009763903.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nicotiana sylvestris]
Length=331

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  42   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  101

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLT+LD+HNNKLTGP+PPQIGRLKRLKILN+RWNKLQDVIPPEIGELKQLTHLYLSFNN
Sbjct  102  LDLTKLDLHNNKLTGPLPPQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNN  161

Query  362  FK  367
            FK
Sbjct  162  FK  163


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+  VIP  I  + +LT+LYL  N F 
Sbjct  227  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMTGVIPYSIAHIPKLTYLYLDHNQFS  286



>ref|XP_009607072.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nicotiana tomentosiformis]
Length=331

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  42   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  101

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLT+LD+HNNKLTGP+PPQIGRLKRLKILN+RWNKLQDVIPPEIGELKQLTHLYLSFNN
Sbjct  102  LDLTKLDLHNNKLTGPLPPQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNN  161

Query  362  FK  367
            FK
Sbjct  162  FK  163


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+  VIP  I  + +LT+LYL  N F 
Sbjct  227  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMTGVIPYSIAHIPKLTYLYLDHNQFS  286



>ref|XP_006359580.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=331

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  42   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  101

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGP+P QIGRLKRLKILN+RWNKLQDVIPPEIGELKQLTHLYLSFNN
Sbjct  102  LDLTRLDLHNNKLTGPLPSQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNN  161

Query  362  FK  367
            FK
Sbjct  162  FK  163


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+  VIP  I  + +LT+LYL  N F 
Sbjct  227  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMTGVIPYSIAHIPKLTYLYLDHNQFS  286



>gb|AEA86320.1| leucine-rich repeat receptor protein kinase [Solanum nigrum]
Length=208

 Score =   240 bits (613),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
             SLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  56   TSLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  115

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGP+P QIGRLKRLKILN+RWNKLQDVIPPEIGELKQLTHLYLSFNN
Sbjct  116  LDLTRLDLHNNKLTGPLPSQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNN  175

Query  362  FK  367
            FK
Sbjct  176  FK  177



>ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
 emb|CBI27275.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIPPEIGELK+LTHLYLSFNN
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPPEIGELKRLTHLYLSFNN  159

Query  362  FK  367
            FK
Sbjct  160  FK  161



>ref|XP_004228366.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Solanum lycopersicum]
Length=331

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  42   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  101

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGP+P QIGRLKRLKILN+RWNKLQDVIPPEIGELKQLTHLYLSFNN
Sbjct  102  LDLTRLDLHNNKLTGPLPSQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNN  161

Query  362  FK  367
            FK
Sbjct  162  FK  163


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+  VIP  I  + +LT+LYL  N F 
Sbjct  227  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMTGVIPYSIAHIPKLTYLYLDHNQFS  286



>ref|XP_010096578.1| hypothetical protein L484_004254 [Morus notabilis]
 gb|EXB65078.1| hypothetical protein L484_004254 [Morus notabilis]
Length=329

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL+RLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGEL+ LTHLYLSFNN
Sbjct  100  LDLSRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELRSLTHLYLSFNN  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (53%), Gaps = 7/75 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN  TG IP Q+  L  L+I  +  NK+  +IP EI 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYFTGGIPSQLSNLTNLEIFYLSHNKMSGIIPSEIA  268

Query  320  ELKQLTHLYLSFNNF  364
             + +LT+LYL  N F
Sbjct  269  HIPKLTYLYLDHNQF  283


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +   +  G  P  + NL +L  L +H N+LTG IPP++G L++L+ L++ 
Sbjct  145  GELRSLTHLYLSFNNFKGEIPKELANLPELRYLYLHENRLTGRIPPELGTLQKLQHLDVG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPALRNLYLNNNYF  235



>gb|KDP41277.1| hypothetical protein JCGZ_15684 [Jatropha curcas]
Length=327

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVT+LEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTDLEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFNN
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNN  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG +P Q+  L  L+IL++ +NK+  +IP  +  + +LTH YL  N F 
Sbjct  223  LRNLYLNNNYLTGGVPAQLANLTNLEILHLSYNKMSGIIPAGVAHIPRLTHFYLDHNQFS  282



>ref|XP_010546181.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Tarenaya hassleriana]
Length=326

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>gb|KFK27889.1| hypothetical protein AALP_AA8G442600 [Arabis alpina]
Length=327

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  157

Query  362  FK  367
            FK
Sbjct  158  FK  159



>ref|XP_010443939.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Camelina sativa]
Length=326

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKKLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>emb|CDY16817.1| BnaA09g05650D [Brassica napus]
Length=327

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  157

Query  362  FK  367
            FK
Sbjct  158  FK  159



>gb|KCW86527.1| hypothetical protein EUGRSUZ_B03173 [Eucalyptus grandis]
Length=275

 Score =   240 bits (613),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCS+QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSSQGDYRVVTELEVYAVSIVGPFPTAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLT LD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFNN
Sbjct  99   LDLTSLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNN  158

Query  362  FK  367
            FK
Sbjct  159  FK  160



>gb|AGJ70091.1| LRR-like disease resistance protein [Brassica oleracea var. italica]
 emb|CDY23076.1| BnaC07g31110D [Brassica napus]
Length=326

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_009111984.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=327

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  157

Query  362  FK  367
            FK
Sbjct  158  FK  159



>ref|XP_004297259.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIPPEIGELK LTHLYLSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPPEIGELKSLTHLYLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L  L+IL + +NK+  ++P  I 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMSGIVPLAIS  268

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  269  HIPRLTYLYLDHNQFS  284



>ref|XP_010483790.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Camelina sativa]
Length=326

 Score =   242 bits (617),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|NP_200932.2| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB08479.1| leucine-rich repeat disease resistance protein-like [Arabidopsis 
thaliana]
 gb|AAM91553.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana]
 gb|AAN15323.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana]
 gb|AED97440.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=326

 Score =   242 bits (617),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_010457081.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=326

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_006394525.1| hypothetical protein EUTSA_v10004587mg [Eutrema salsugineum]
 gb|ESQ31811.1| hypothetical protein EUTSA_v10004587mg [Eutrema salsugineum]
Length=326

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_002864726.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40985.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_009136457.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Brassica rapa]
 emb|CDY02162.1| BnaA03g40050D [Brassica napus]
Length=326

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_008221531.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=328

 Score =   241 bits (616),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  99   LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  158

Query  362  FK  367
            FK
Sbjct  159  FK  160


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  215  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLS  267

Query  320  ELKQLTHLYLSFNNFK  367
            ++ +LT+LYL  N F 
Sbjct  268  QIPRLTYLYLDHNQFS  283



>ref|XP_007225691.1| hypothetical protein PRUPE_ppa008519mg [Prunus persica]
 gb|EMJ26890.1| hypothetical protein PRUPE_ppa008519mg [Prunus persica]
Length=328

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  99   LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  158

Query  362  FK  367
            FK
Sbjct  159  FK  160


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  215  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLS  267

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  268  HIPRLTYLYLDHNQFS  283



>ref|XP_009356367.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=333

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  44   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  103

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  104  LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  163

Query  362  FK  367
            FK
Sbjct  164  FK  165


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  220  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLS  272

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  273  HIPRLTYLYLDHNQFS  288



>ref|XP_008361775.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
 ref|XP_008361776.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=329

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLASLSKLEILYLSYNKMSGIVPLGLS  268

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  269  HIPRLTYLYLDHNQFS  284



>ref|XP_010044430.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
 ref|XP_010044431.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
 gb|KCW86526.1| hypothetical protein EUGRSUZ_B03173 [Eucalyptus grandis]
Length=328

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCS+QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSSQGDYRVVTELEVYAVSIVGPFPTAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLT LD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFNN
Sbjct  99   LDLTSLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNN  158

Query  362  FK  367
            FK
Sbjct  159  FK  160


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L    ++NN  TG IP Q+  +  L+IL + +NK+  +IP EI  + +LT LYL  N F 
Sbjct  224  LRNFYLNNNYFTGGIPAQLANVTNLEILYLSYNKMSGIIPTEIARIPKLTFLYLDHNQFS  283



>ref|XP_008350908.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=333

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  44   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  103

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  104  LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  163

Query  362  FK  367
            FK
Sbjct  164  FK  165


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  220  IRIEGCFP-------ALRNLYLNNNYLTGGIPTQLANLTKLEILYLSYNKMSGIVPLGLS  272

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  273  HIPRLTYLYLDHNQFS  288



>gb|AFK44352.1| unknown [Medicago truncatula]
Length=162

 Score =   235 bits (599),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLP W+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161



>ref|XP_010522880.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Tarenaya hassleriana]
Length=326

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+W+GDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   SSLGWRVVYSWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPVAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQD+IPPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDLIPPEIGELKRLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_006280810.1| hypothetical protein CARUB_v10026779mg [Capsella rubella]
 gb|EOA13708.1| hypothetical protein CARUB_v10026779mg [Capsella rubella]
Length=326

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIP EIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPAEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_010904953.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Elaeis guineensis]
Length=326

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLK LKILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKHLKILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>emb|CDX87206.1| BnaC09g05210D [Brassica napus]
Length=327

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQG YRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGGYRVVTELEVYAVSIVGPFPIAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNS  157

Query  362  FK  367
            FK
Sbjct  158  FK  159



>ref|XP_008390046.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=365

 Score =   241 bits (614),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  76   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNL  135

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+LN+RWNKLQDVIPPEIGELK LTHL+LSFN+
Sbjct  136  LDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNS  195

Query  362  FK  367
            FK
Sbjct  196  FK  197


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L +L+IL + +NK+  ++P  + 
Sbjct  252  IRIEGCFP-------ALRNLYLNNNYLTGGIPTQLANLTKLEILYLSYNKMSGIVPLGLS  304

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  305  HIPRLTYLYLDHNQFS  320



>ref|XP_006378575.1| hypothetical protein POPTR_0010s16810g [Populus trichocarpa]
 gb|ERP56372.1| hypothetical protein POPTR_0010s16810g [Populus trichocarpa]
Length=274

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFN 
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNA  157

Query  362  FK  367
            FK
Sbjct  158  FK  159



>ref|XP_008805099.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Phoenix dactylifera]
Length=326

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLK LKILN+RWNKLQD++PPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKHLKILNLRWNKLQDILPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            G+ + +  L+V    + G   + + N      L  L ++NN L+G +P Q+  L  L+IL
Sbjct  190  GNLKNLRHLDVGNNHLTGTLRDLIRNGDCFPSLRNLYLNNNHLSGGLPDQLANLTNLEIL  249

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             + +NK+   + P++ ++ +LT+LYL  N F
Sbjct  250  YLSYNKMTGPVTPKLADIPRLTYLYLDHNAF  280



>ref|XP_003518760.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like isoform 1 [Glycine max]
 gb|KHN30006.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=329

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFNN
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNN  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN  TG IP Q+  L  L+IL + +NK+  VIP  + 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYFTGGIPAQLANLTSLEILYLSYNKMSGVIPSTVA  268

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  269  HIPKLTYLYLDHNQFS  284


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   +  G  P  + NL DL  L +H N+L G IPP++G L+ L+ L+  
Sbjct  145  GELKSLTHLYLSFNNFKGEIPKELANLPDLRYLYLHENRLAGRIPPELGTLQNLRHLDAG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPALRNLYLNNNYF  235



>gb|ABZ85667.1| LRR-like disease resistance protein [Brassica rapa subsp. pekinensis]
Length=327

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+L +RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_007157582.1| hypothetical protein PHAVU_002G081300g [Phaseolus vulgaris]
 gb|ESW29576.1| hypothetical protein PHAVU_002G081300g [Phaseolus vulgaris]
Length=356

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  70   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  129

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFNN
Sbjct  130  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNN  189

Query  362  FK  367
            FK
Sbjct  190  FK  191



>ref|XP_006477621.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Citrus sinensis]
Length=326

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIP EIGELK+LTHL LSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG +P Q+  L  L+IL +  NK+   IP  +  + +LT+LYL  N F 
Sbjct  222  LRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFS  281



>ref|XP_006440692.1| hypothetical protein CICLE_v10021138mg [Citrus clementina]
 gb|ESR53932.1| hypothetical protein CICLE_v10021138mg [Citrus clementina]
Length=326

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIP EIGELK+LTHL LSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG +P Q+  L  L+IL +  NK+   IP  +  + +LT+LYL  N F 
Sbjct  222  LRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFS  281



>ref|XP_004490152.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cicer arietinum]
Length=329

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 7/75 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN  TG IP Q+  L  L+IL + +NK+  ++P  + 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYFTGGIPAQLANLSSLEILYLSYNKMSGILPSTVA  268

Query  320  ELKQLTHLYLSFNNF  364
             + +LT+LYL  N F
Sbjct  269  HIPKLTYLYLDHNQF  283


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   S  G  P  + NL DL  L +H N+L G +PP++G L+ L+ L++ 
Sbjct  145  GELKSLTHLYLSFNSFKGEIPKELANLPDLRYLYLHENRLMGRLPPELGTLQNLRHLDVG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPALRNLYLNNNYF  235



>gb|AFK44024.1| unknown [Lotus japonicus]
Length=329

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN  TG +P Q+  L  L+IL + +NK+  VIP  + 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYFTGGMPAQLANLSSLEILYLSYNKMSGVIPSSLA  268

Query  320  ELKQLTHLYLSFNNFK  367
               +LT+LYL  N F 
Sbjct  269  HTPKLTYLYLDHNQFS  284


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   S  G  P  + NL DL  L +H N+L G IPP++G L+ L+ L+  
Sbjct  145  GELKSLTHLYLSFNSFKGEIPKELANLPDLRYLYLHENRLIGRIPPELGTLQNLRHLDAG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPALRNLYLNNNYF  235



>ref|XP_006837045.1| hypothetical protein AMTR_s00110p00050600 [Amborella trichopoda]
 gb|ERM99898.1| hypothetical protein AMTR_s00110p00050600 [Amborella trichopoda]
Length=327

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS+QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSSQGDYRVVTELEVYAVSIVGPFPIAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELKQLT LYLSFNN
Sbjct  98   LDLTRLDFHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKQLTSLYLSFNN  157

Query  362  FK  367
             K
Sbjct  158  LK  159



>gb|KDO54585.1| hypothetical protein CISIN_1g0203982mg, partial [Citrus sinensis]
Length=297

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  8    ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  67

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIP EIGELK+LTHL LSFNN
Sbjct  68   LDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNN  127

Query  362  FK  367
            FK
Sbjct  128  FK  129


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG +P Q+  L  L+IL +  NK+   IP  +  + +LT+LYL  N F 
Sbjct  193  LRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFS  252



>ref|XP_011012324.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X2 [Populus euphratica]
 ref|XP_011012332.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X2 [Populus euphratica]
Length=327

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFN 
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNA  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L +++N LTG +P Q+  L  L+IL++  N++  +IP  +  + +LT+LYL  NNF
Sbjct  223  LRNLYLNDNYLTGGVPAQLSNLTSLEILHLSHNRMTGIIPVGLAHMPRLTYLYLDHNNF  281



>ref|XP_002315009.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF01180.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=327

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFN 
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNA  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L +++N LTG +P Q+  L  L+IL++  N++  +IP  +  + +LT+LYL  NNF
Sbjct  223  LRNLYLNDNYLTGGVPAQLSNLTSLEILHLSHNRMTGIIPVGLAHMPRLTYLYLDHNNF  281



>ref|XP_011012317.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Populus euphratica]
Length=343

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  54   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTNL  113

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFN 
Sbjct  114  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNA  173

Query  362  FK  367
            FK
Sbjct  174  FK  175


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L +++N LTG +P Q+  L  L+IL++  N++  +IP  +  + +LT+LYL  NNF
Sbjct  239  LRNLYLNDNYLTGGVPAQLSNLTSLEILHLSHNRMTGIIPVGLAHMPRLTYLYLDHNNF  297



>ref|XP_008446420.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Cucumis melo]
Length=330

 Score =   237 bits (605),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTC+TQGDYRVVT+LEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCTTQGDYRVVTKLEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD HNNKLTGPIPPQIGRLKRL+ILN+RWNKLQDVIP EIGELK LTHLYLSFNN
Sbjct  101  LDLTRLDFHNNKLTGPIPPQIGRLKRLQILNLRWNKLQDVIPSEIGELKSLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L +++N  TG +P Q+  L  L+IL +  NK+  +IP E+  + +LT+L+L +N F
Sbjct  225  SLRNLYLNDNYFTGGVPAQLANLSNLEILYLSHNKMSGIIPAELARIPRLTYLFLDYNQF  284

Query  365  K  367
             
Sbjct  285  S  285



>ref|XP_010936342.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Elaeis guineensis]
 ref|XP_010936343.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X2 [Elaeis guineensis]
Length=326

 Score =   237 bits (604),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLK LKILN+RWNKL+DV+PPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKHLKILNLRWNKLRDVLPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            F+
Sbjct  157  FR  158



>ref|XP_004135152.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
 gb|KGN51966.1| hypothetical protein Csa_5G606570 [Cucumis sativus]
Length=330

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTC+TQGDYRVVT+LEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCTTQGDYRVVTKLEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD HNNKLTGP+PPQIGRLKRL+ILN+RWNKLQDVIP EIGELK LTHLYLSFNN
Sbjct  101  LDLTRLDFHNNKLTGPVPPQIGRLKRLQILNLRWNKLQDVIPSEIGELKSLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L +++N  TG +P Q+  L  L+IL +  NK+  +IP E+  + +LT+L+L +N F
Sbjct  225  SLRNLYLNDNYFTGGVPAQLANLSNLEILYLSHNKMSGIIPAELARIPRLTYLFLGYNQF  284

Query  365  K  367
             
Sbjct  285  S  285



>ref|XP_004155299.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
Length=330

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTC+TQGDYRVVT+LEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCTTQGDYRVVTKLEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD HNNKLTGP+PPQIGRLKRL+ILN+RWNKLQDVIP EIGELK LTHLYLSFNN
Sbjct  101  LDLTRLDFHNNKLTGPVPPQIGRLKRLQILNLRWNKLQDVIPSEIGELKSLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L +++N  TG +P Q+  L  L+IL +  NK+  +IP E+  + +LT+L+L +N F
Sbjct  225  SLRNLYLNDNYFTGGVPAQLANLSNLEILYLSHNKMSGIIPAELARIPRLTYLFLGYNQF  284

Query  365  K  367
             
Sbjct  285  S  285



>ref|NP_001239691.1| probable leucine-rich repeat receptor-like protein kinase At1g35710-like 
precursor [Glycine max]
 gb|ACM89605.1| leucine-rich repeat resistance protein-like protein [Glycine 
max]
 gb|KHN03630.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=329

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWV DDPCGD DLPPW+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWVDDDPCGDGDLPPWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFNN
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNN  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN  TG +P Q+  L  L+IL + +NK+  VIP  + 
Sbjct  216  IRIEGCFP-------ALRNLYLNNNYFTGGMPAQLANLTSLEILYLSYNKMSGVIPSSVA  268

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  269  RIPKLTYLYLDHNQFS  284


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   +  G  P  + NL DL  L +H N+LTG IPP++G L+ L+ L+  
Sbjct  145  GELKSLTHLYLSFNNFKGEIPKELANLQDLRYLYLHENRLTGRIPPELGTLQNLRHLDAG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPALRNLYLNNNYF  235



>ref|XP_011018203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Populus euphratica]
Length=327

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCS  GDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSIAGDYRVVTELEVYAVSIVGPFPTAVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDVIPPEIGELK LTHLYLSFN 
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKSLTHLYLSFNA  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L +++N LTG +P Q+  L  L+IL++  NK+  +IP  +  + +LT+LYL  NNF
Sbjct  223  LRNLYLNDNYLTGGVPAQLANLTSLEILHLSHNKMTGIIPVGLAHMPRLTYLYLDHNNF  281



>ref|XP_009406000.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIG+LK LKILN+RWNKLQ+ IPPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGQLKHLKILNLRWNKLQEAIPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158



>ref|XP_009395633.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Musa acuminata subsp. malaccensis]
Length=325

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLT+LD+HNNKLTG IPPQIGRLK LK LN+RWNKLQD+IPPEIGELK+LTHLYLSFNN
Sbjct  97   LDLTKLDLHNNKLTGAIPPQIGRLKHLKTLNLRWNKLQDIIPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQI  244
            ++G      G  R +  L+V    + G     + N      L  L ++NN+L+G +P QI
Sbjct  181  FSGKIPPELGILRNLRHLDVSNNHLTGTLSKFIRNGDGFPSLRNLYLNNNQLSGTLPDQI  240

Query  245  GRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              L  L+IL + +NK+   + P++ E+ +LT+LYL  N F
Sbjct  241  SNLTNLEILYLSYNKMSGQLTPKLVEIPRLTYLYLDHNAF  280



>ref|XP_003614019.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula]
 gb|AES96977.1| LRR receptor-like kinase [Medicago truncatula]
Length=329

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLP W+GVTCST GDYRVVTELEVYAVSIVGPFP AVT+L
Sbjct  40   ASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTVGDYRVVTELEVYAVSIVGPFPTAVTSL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD IPPEIGELK LTHLYLSFN+
Sbjct  100  LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDAIPPEIGELKSLTHLYLSFNS  159

Query  362  FK  367
            FK
Sbjct  160  FK  161


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP+       L  L ++NN  TG IP Q+  L  L+IL + +NK+  VIP  + 
Sbjct  216  IRIEGCFPS-------LRNLYLNNNYFTGGIPAQLANLSSLEILYLSYNKMSGVIPSSVA  268

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  269  HIPKLTYLYLDHNQFS  284


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   S  G  P  + +L DL  L +H N+LTG IPP++G L+ L+ L+  
Sbjct  145  GELKSLTHLYLSFNSFKGEIPRELADLPDLRYLYLHENRLTGRIPPELGTLQNLRHLDAG  204

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N F
Sbjct  205  NNHLVGTIRELIRIEGCFPSLRNLYLNNNYF  235



>ref|XP_007045927.1| Leucine-rich repeat (LRR) family protein isoform 3 [Theobroma 
cacao]
 gb|EOY01759.1| Leucine-rich repeat (LRR) family protein isoform 3 [Theobroma 
cacao]
Length=247

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD +LPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  35   ASLGWRVVYAWVGDDPCGDGNLPPWSGVTCSLQGDYRVVTELEVYAVSIVGPFPIAVTNL  94

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDV+P EIGELK LTHLYLSFN+
Sbjct  95   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVLPAEIGELKSLTHLYLSFNS  154

Query  362  FK  367
             K
Sbjct  155  LK  156



>ref|XP_007045926.1| Leucine-rich repeat (LRR) family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY01758.1| Leucine-rich repeat (LRR) family protein isoform 2, partial [Theobroma 
cacao]
Length=275

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD +LPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  35   ASLGWRVVYAWVGDDPCGDGNLPPWSGVTCSLQGDYRVVTELEVYAVSIVGPFPIAVTNL  94

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDV+P EIGELK LTHLYLSFN+
Sbjct  95   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVLPAEIGELKSLTHLYLSFNS  154

Query  362  FK  367
             K
Sbjct  155  LK  156



>ref|XP_002312277.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE89644.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=327

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD D PPW+GVTCS  GDYRVVTELEVYAVSIVGPFP +VTNL
Sbjct  38   ASLGWRVVYAWVGDDPCGDGDHPPWSGVTCSIAGDYRVVTELEVYAVSIVGPFPTSVTNL  97

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDV+PPEIGELK LTHLYLSFN 
Sbjct  98   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVLPPEIGELKSLTHLYLSFNA  157

Query  362  FK  367
            FK
Sbjct  158  FK  159


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L +++N LTG +P Q+  L  L+IL++  NK+  +IP  +  + +LT+LYL  NNF
Sbjct  223  LRNLYLNDNYLTGGVPAQLANLTSLEILHLSHNKMTGIIPVGLAHMPRLTYLYLDHNNF  281



>ref|XP_007045925.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01757.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma 
cacao]
Length=324

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD +LPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  35   ASLGWRVVYAWVGDDPCGDGNLPPWSGVTCSLQGDYRVVTELEVYAVSIVGPFPIAVTNL  94

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQDV+P EIGELK LTHLYLSFN+
Sbjct  95   LDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVLPAEIGELKSLTHLYLSFNS  154

Query  362  FK  367
             K
Sbjct  155  LK  156


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP+       L  L +++N LTG +P ++  L  L+IL +  NKL  VIP E+ 
Sbjct  211  IRIDGCFPS-------LRNLYLNDNYLTGGVPAELASLTNLEILYLSNNKLSGVIPSEVA  263

Query  320  ELKQLTHLYLSFNNF  364
             L +LT LYL  N F
Sbjct  264  HLPRLTSLYLDHNQF  278



>ref|XP_010258135.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nelumbo nucifera]
 ref|XP_010258136.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nelumbo nucifera]
 ref|XP_010258137.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nelumbo nucifera]
Length=326

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVYAW+GDDPCGD DLPPW+G+TCSTQG YRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   SSLGWRVVYAWIGDDPCGDGDLPPWSGITCSTQGGYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            L+LTRLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDVIPPEIGELK+LTHL+LSFN+
Sbjct  97   LELTRLDLHNNKLTGPIPPQIGRLKNLRILNLRWNKLQDVIPPEIGELKKLTHLHLSFNS  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L I+NN LTG IP Q+  L  L+IL + +NK+   IP  +  + +LT+LYL  N F 
Sbjct  222  LRNLYINNNFLTGGIPAQLANLTNLEILYLSYNKMSGTIPSGVAHIPRLTYLYLDHNQFS  281


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   S  G  P  + NL +L  L +H N  TG IPP++G L+ L+ L++ 
Sbjct  142  GELKKLTHLHLSFNSFKGEIPKELANLPELRYLYLHENHFTGRIPPELGTLQNLRHLDVG  201

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LY++ NNF
Sbjct  202  NNHLVGTIRELIRFEGSFPALRNLYIN-NNF  231



>ref|XP_009396426.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=325

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD +LPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  36   ASLGWRVVYAWVGDDPCGDGNLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPIAVTNL  95

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L ILN+RWNKLQDVIPPEIGELK+LTHLYLSFN+
Sbjct  96   LDLKRLDLHNNKLTGPIPPQIGRLKHLTILNLRWNKLQDVIPPEIGELKKLTHLYLSFNH  155

Query  362  FK  367
            FK
Sbjct  156  FK  157


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            G  + +  L+V    + G   + + N      L  L +++N+L+G +P QI  L  L+IL
Sbjct  189  GKLKNLRHLDVSGNHLTGTLADFIQNGDGFPSLRNLYLNDNQLSGELPDQISNLTNLEIL  248

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             + +NKL   I P++ E+ +LT LYL  N F
Sbjct  249  YLSYNKLSGQITPKLMEIPRLTCLYLDHNAF  279


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 51/115 (44%), Gaps = 27/115 (23%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +      G  P  + NL +L  L +H N+LTG IPP++G+LK L+ L++ 
Sbjct  141  GELKKLTHLYLSFNHFKGEIPVELANLPELRYLYLHENRLTGKIPPELGKLKNLRHLDVS  200

Query  281  W---------------------------NKLQDVIPPEIGELKQLTHLYLSFNNF  364
                                        N+L   +P +I  L  L  LYLS+N  
Sbjct  201  GNHLTGTLADFIQNGDGFPSLRNLYLNDNQLSGELPDQISNLTNLEILYLSYNKL  255



>ref|XP_004143790.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
 gb|KGN51189.1| hypothetical protein Csa_5G485190 [Cucumis sativus]
Length=330

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCG + LPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGASHLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPVAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRL+RLKILN+RWNKLQDVIPPEIG LK LTHLYL FNN
Sbjct  101  LDLTRLDLHNNKLTGPIPPQIGRLRRLKILNLRWNKLQDVIPPEIGALKGLTHLYLGFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L I+NN  TG +P Q+  L  L+IL + +NK+  +IPP +  + +LT+LYL  N F
Sbjct  225  SLRNLYINNNYFTGGVPSQLANLTNLEILYLSYNKMSGIIPPGVAHIPKLTYLYLDHNQF  284

Query  365  K  367
             
Sbjct  285  S  285



>ref|NP_001190586.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AED97441.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=339

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 120/135 (89%), Gaps = 13/135 (10%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKIL-------------NIRWNKLQDVIPPEIGE  322
            LDLTRLD+HNNKLTGPIPPQIGRLKRLK+L             N+RWNKLQDVIPPEIGE
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYDPILFRVNLALTNLRWNKLQDVIPPEIGE  156

Query  323  LKQLTHLYLSFNNFK  367
            LK+LTHLYLSFN+FK
Sbjct  157  LKRLTHLYLSFNSFK  171



>ref|XP_006649619.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Oryza brachyantha]
Length=332

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  43   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  102

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  103  LDLKRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  162

Query  362  FK  367
            FK
Sbjct  163  FK  164


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            G  + +  L+V    ++G   + + N      L  L ++NN LTG +P QI  L  L+IL
Sbjct  196  GTLKNLRHLDVGNNHLIGTLRDFIGNANGFPSLRNLYLNNNDLTGVVPDQIANLTNLEIL  255

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            ++  N+L   I P++  + +LT+LYL  NNF
Sbjct  256  HLSNNRLIGSISPKLVHIPRLTYLYLDNNNF  286



>emb|CDP00407.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCS--TQGDYRVVTELEVYAVSIVGPFPNAVT  175
            ASLGWRVVYAWVG+DPCGD DLPPW+GVTCS  T GDY+VVTELEVYAVSIVGPFP AVT
Sbjct  40   ASLGWRVVYAWVGEDPCGDGDLPPWSGVTCSRSTVGDYKVVTELEVYAVSIVGPFPTAVT  99

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NLLDLTRLD+HNNKLTGPIPPQI RLKRLKILN+RWNKLQDVIPPEIGEL+QLTHLYLSF
Sbjct  100  NLLDLTRLDLHNNKLTGPIPPQIERLKRLKILNLRWNKLQDVIPPEIGELRQLTHLYLSF  159

Query  356  NNFK  367
            NNFK
Sbjct  160  NNFK  163


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L  L+IL + +NK+  +IP  + 
Sbjct  218  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMSGIIPSSLA  270

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  271  HIPKLTYLYLDHNQFS  286


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +   +  G  P  + NL +L  L +H N+ TG IPP++G L+ L+ L++ 
Sbjct  147  GELRQLTHLYLSFNNFKGEIPKELANLPELRYLQLHENRFTGRIPPELGTLQNLRHLDVG  206

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFN  358
             N L   I   I   G    L +LYL+ N
Sbjct  207  NNHLVGTIRELIRIEGCFPALRNLYLNNN  235



>ref|XP_010680733.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Beta vulgaris subsp. vulgaris]
Length=328

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCGD DLPPW+GVTCS QGDYRVVT LEVYAVSIVGPFP AVTNL
Sbjct  39   SSLGWRVVYSWVGDDPCGDGDLPPWSGVTCSVQGDYRVVTGLEVYAVSIVGPFPIAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLKRLKILN+RWNKLQD++PPEIGELK LTHLYLSFN+
Sbjct  99   LDLQRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDILPPEIGELKSLTHLYLSFNS  158

Query  362  FK  367
            FK
Sbjct  159  FK  160


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L  L+IL++  NK+  +IP  + 
Sbjct  215  IRIEGCFP-------ALRNLYLNNNYLTGGIPAQLSNLTNLEILHLSHNKMTGIIPSAVA  267

Query  320  ELKQLTHLYLSFNNFK  367
             L +LT+LYL  N F 
Sbjct  268  RLSRLTYLYLDHNQFS  283



>ref|XP_010259148.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nelumbo nucifera]
Length=326

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+W+G+DPCGD DLPPW+GVTCSTQG YRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYSWIGEDPCGDGDLPPWSGVTCSTQGGYRVVTELEVYAVSIVGPFPVAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            L+LTRLD+HNNKLTGPI PQIGRLK L+ILN+RWNKLQDVIPPEIGELK+LTHLYLSFNN
Sbjct  97   LELTRLDLHNNKLTGPISPQIGRLKNLRILNLRWNKLQDVIPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG IP Q+  L  L+IL + +NK+   IP  + 
Sbjct  213  IHIEGSFP-------ALRNLYLNNNFLTGGIPAQLANLTNLEILYLSYNKMSGPIPSGLA  265

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  266  HIPRLTYLYLDHNLFS  281


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   +  G  P  + NL +L  L +H N+ TG +PP++G L+ L+ L++ 
Sbjct  142  GELKKLTHLYLSFNNFKGEIPKELANLPELRYLYLHENRFTGRVPPELGTLQNLRHLDVG  201

Query  281  WNKLQDVIPPEIGELKQLTHLYLSF  355
             N L       +G +++L H+  SF
Sbjct  202  NNHL-------VGTIRELIHIEGSF  219



>ref|NP_001049352.1| Os03g0211900 [Oryza sativa Japonica Group]
 gb|ABF94605.1| leucine-rich repeat resistance protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11266.1| Os03g0211900 [Oryza sativa Japonica Group]
 dbj|BAG86941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74745.1| hypothetical protein OsI_10498 [Oryza sativa Indica Group]
 gb|EEE58570.1| hypothetical protein OsJ_09888 [Oryza sativa Japonica Group]
Length=335

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  46   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  105

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  106  LDLKRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  165

Query  362  FK  367
            FK
Sbjct  166  FK  167


 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            G  + +  L+V    ++G   + + N      L  L ++NN LTG +P QI  L  L+IL
Sbjct  199  GTLKNLRHLDVGNNHLIGTLRDLIGNGNGFPSLRNLYLNNNDLTGVLPDQIANLTNLEIL  258

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            ++  N+L   I P++  + +LT+LYL  NNF
Sbjct  259  HLSNNRLIGSISPKLVHIPRLTYLYLDNNNF  289



>ref|XP_011075577.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Sesamum indicum]
Length=334

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 116/124 (94%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCST--QGDYRVVTELEVYAVSIVGPFPNAVT  175
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCST    DYRVVTELEVYAVSIVGPFP AVT
Sbjct  43   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTVSGSDYRVVTELEVYAVSIVGPFPLAVT  102

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NL+DLTRLD+HNNKLTGPIP QIGRLKRLKILN+RWNKLQD IPPEIGELKQLTHLYLSF
Sbjct  103  NLVDLTRLDLHNNKLTGPIPSQIGRLKRLKILNLRWNKLQDAIPPEIGELKQLTHLYLSF  162

Query  356  NNFK  367
            NNFK
Sbjct  163  NNFK  166


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            + I G FP        L  L ++NN LTG +P Q+  L  L+IL + +NK+  VIP  + 
Sbjct  221  IRIEGCFP-------ALRNLYLNNNYLTGGVPSQLANLTNLEILYLSYNKMTGVIPFGLA  273

Query  320  ELKQLTHLYLSFNNFK  367
             + +LT+LYL  N F 
Sbjct  274  HIPRLTYLYLDHNQFS  289



>ref|XP_008465704.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Cucumis melo]
Length=330

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCG + LPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGGSHLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPVAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRL+RLKILN+RWNKLQDVIPPEIG LK LTHL L FNN
Sbjct  101  LDLTRLDLHNNKLTGPIPPQIGRLRRLKILNLRWNKLQDVIPPEIGALKSLTHLNLGFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L I+NN  TG +P Q+  L  L+IL + +NK+  +IPP +  + +LT+LYL  N F
Sbjct  225  SLRNLYINNNYFTGGVPSQLANLTNLEILYLSYNKMSGIIPPGVAHIPKLTYLYLDHNQF  284

Query  365  K  367
             
Sbjct  285  S  285



>ref|XP_011070958.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Sesamum indicum]
Length=334

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCST--QGDYRVVTELEVYAVSIVGPFPNAVT  175
            ASLGWRVVYAW+GDDPCGD DLPPWAG+TCS   + DYRVVT LEVYAVSIVGPFP AV 
Sbjct  43   ASLGWRVVYAWIGDDPCGDGDLPPWAGITCSAANENDYRVVTGLEVYAVSIVGPFPLAVI  102

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NL+DLTRLD+HNNKLTGPIPPQIGRLK LKILN+RWNKLQD IPPEIGELKQLTHLYLSF
Sbjct  103  NLVDLTRLDLHNNKLTGPIPPQIGRLKHLKILNLRWNKLQDAIPPEIGELKQLTHLYLSF  162

Query  356  NNFK  367
            NNFK
Sbjct  163  NNFK  166


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L ++NN LTG +P Q+  L  L+IL + +NK+  +IP  +  + +LT+LYL  N F
Sbjct  229  SLRNLYLNNNYLTGGVPSQLANLTNLEILYLSYNKMAGIIPFGLAHIPRLTYLYLDHNQF  288



>ref|XP_010936344.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X3 [Elaeis guineensis]
Length=278

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRLK LKILN+RWNKL+DV+PPEIGELK+LTH  +  N+
Sbjct  97   LDLTRLDLHNNKLTGPIPPQIGRLKHLKILNLRWNKLRDVLPPEIGELKKLTHFDVGNNH  156

Query  362  F  364
             
Sbjct  157  L  157



>gb|EPS67923.1| hypothetical protein M569_06848, partial [Genlisea aurea]
Length=325

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCS--TQGDYRVVTELEVYAVSIVGPFPNAVT  175
            ASLGWRV+YAWVGDDPCGD DLPPW+GV CS  +  DYRVVTELEVYAVSIVGP P AVT
Sbjct  34   ASLGWRVLYAWVGDDPCGDGDLPPWSGVKCSPVSGTDYRVVTELEVYAVSIVGPIPVAVT  93

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NL+DLT+LD+HNNKLTGPIP QIGRLK LKILN+RWNKLQD+IPPEIGELKQLTHLYLSF
Sbjct  94   NLIDLTKLDLHNNKLTGPIPSQIGRLKHLKILNLRWNKLQDMIPPEIGELKQLTHLYLSF  153

Query  356  NNFK  367
            NNFK
Sbjct  154  NNFK  157


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +   +  G  P  + NL +L  L +H N+LTG IP ++G LK L+ L++ 
Sbjct  141  GELKQLTHLYLSFNNFKGEIPKELANLHELRYLQLHENRLTGRIPAELGNLKNLRHLDVG  200

Query  281  WNKLQDVIPPEI---GELKQLTHLYLSFNNF  364
             N L   I   I   G    L +LYL+ N+F
Sbjct  201  NNHLFGTIRELIRLDGCFPALRNLYLNDNHF  231



>gb|KHG13981.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Gossypium 
arboreum]
 gb|KHG22117.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Gossypium 
arboreum]
Length=304

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRL+RL++LN+RWNKLQDV+PPEIGELK+LTHL LSFNN
Sbjct  99   LDLTRLDLHNNKLTGPIPPQIGRLRRLRMLNLRWNKLQDVLPPEIGELKRLTHLSLSFNN  158

Query  362  FK  367
            FK
Sbjct  159  FK  160



>tpg|DAA44040.1| TPA: hypothetical protein ZEAMMB73_778718 [Zea mays]
Length=325

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  101  LDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162



>ref|XP_003558509.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Brachypodium distachyon]
Length=329

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  40   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  99

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL +LD+HNNKLTGPIPPQIGRL+ LKILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  100  LDLKKLDLHNNKLTGPIPPQIGRLRHLKILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  159

Query  362  FK  367
            FK
Sbjct  160  FK  161



>ref|XP_010554295.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X3 [Tarenaya hassleriana]
Length=311

 Score =   216 bits (549),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            LGWRVVY+WVGDDPCGD DLPPW+GVTCST GDYRV+T+LEVYAVSIVG FP AVTNLLD
Sbjct  35   LGWRVVYSWVGDDPCGDGDLPPWSGVTCSTVGDYRVITKLEVYAVSIVGTFPMAVTNLLD  94

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LT LD+HNNKL GPIP QIGRLK LKILN+RWNKLQ V+PPEIGELK+LTHLYLSFNNF
Sbjct  95   LTVLDLHNNKLNGPIPRQIGRLKNLKILNLRWNKLQGVLPPEIGELKRLTHLYLSFNNF  153


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (43%), Gaps = 40/135 (30%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK-  256
            GV     G+ + +T L +   + +G  P  ++NL +L  L +H N+LTG IPP++G L+ 
Sbjct  131  GVLPPEIGELKRLTHLYLSFNNFIGEIPKELSNLPELRYLHLHENRLTGRIPPELGNLQN  190

Query  257  ---------------------------------------RLKILNIRWNKLQDVIPPEIG  319
                                                    L+IL + +N++   IP E+ 
Sbjct  191  LHHLDAGNNHLVGTIKELVSYLNNNYLTGGISFKLVNLTNLEILYLSYNRMTGTIPWELA  250

Query  320  ELKQLTHLYLSFNNF  364
            ++ +LT+LYL  N  
Sbjct  251  QIPRLTYLYLDHNQL  265



>ref|XP_002465654.1| hypothetical protein SORBIDRAFT_01g043160 [Sorghum bicolor]
 gb|EER92652.1| hypothetical protein SORBIDRAFT_01g043160 [Sorghum bicolor]
Length=330

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  101  LDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162



>gb|ACN31699.1| unknown [Zea mays]
Length=330

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  101  LDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162



>ref|NP_001132758.1| uncharacterized protein LOC100194245 precursor [Zea mays]
 gb|ACF81744.1| unknown [Zea mays]
 gb|ACG38196.1| leucine-rich repeat resistance protein [Zea mays]
 tpg|DAA44041.1| TPA: leucine-rich repeat resistance protein [Zea mays]
Length=330

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG  DLPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   SSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  101  LDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162



>ref|XP_010554293.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Tarenaya hassleriana]
Length=322

 Score =   216 bits (549),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            LGWRVVY+WVGDDPCGD DLPPW+GVTCST GDYRV+T+LEVYAVSIVG FP AVTNLLD
Sbjct  35   LGWRVVYSWVGDDPCGDGDLPPWSGVTCSTVGDYRVITKLEVYAVSIVGTFPMAVTNLLD  94

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LT LD+HNNKL GPIP QIGRLK LKILN+RWNKLQ V+PPEIGELK+LTHLYLSFNNF
Sbjct  95   LTVLDLHNNKLNGPIPRQIGRLKNLKILNLRWNKLQGVLPPEIGELKRLTHLYLSFNNF  153


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV     G+ + +T L +   + +G  P  ++NL +L  L +H N+LTG IPP++G L+ 
Sbjct  131  GVLPPEIGELKRLTHLYLSFNNFIGEIPKELSNLPELRYLHLHENRLTGRIPPELGNLQN  190

Query  260  LKILNIRWNKLQDVIPPEI---GELKQLTHLYLSFN  358
            L  L+   N L   I   +   G    L +LYL+ N
Sbjct  191  LHHLDAGNNHLVGTIKELVRLEGCFSALRNLYLNNN  226



>ref|XP_010554294.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X2 [Tarenaya hassleriana]
Length=314

 Score =   216 bits (549),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            LGWRVVY+WVGDDPCGD DLPPW+GVTCST GDYRV+T+LEVYAVSIVG FP AVTNLLD
Sbjct  35   LGWRVVYSWVGDDPCGDGDLPPWSGVTCSTVGDYRVITKLEVYAVSIVGTFPMAVTNLLD  94

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LT LD+HNNKL GPIP QIGRLK LKILN+RWNKLQ V+PPEIGELK+LTHLYLSFNNF
Sbjct  95   LTVLDLHNNKLNGPIPRQIGRLKNLKILNLRWNKLQGVLPPEIGELKRLTHLYLSFNNF  153


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV     G+ + +T L +   + +G  P  ++NL +L  L +H N+LTG IPP++G L+ 
Sbjct  131  GVLPPEIGELKRLTHLYLSFNNFIGEIPKELSNLPELRYLHLHENRLTGRIPPELGNLQN  190

Query  260  LKILNIRWNKLQDVIPPEI---GELKQLTHLYLSFN  358
            L  L+   N L   I   +   G    L +LYL+ N
Sbjct  191  LHHLDAGNNHLVGTIKELVRLEGCFSALRNLYLNNN  226



>ref|XP_007037490.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY21991.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGP+PPQIGRL+RL++LN+RWNKLQDV+PPEIGELK+LTHL LSFNN
Sbjct  97   LDLTRLDLHNNKLTGPLPPQIGRLRRLRMLNLRWNKLQDVLPPEIGELKRLTHLSLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+   IP  +  + +LT+LYL  N F 
Sbjct  222  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMSGAIPSALAHIPKLTYLYLDHNQFS  281



>gb|AAK70805.1| leucine-rich repeat resistance protein-like protein [Gossypium 
hirsutum]
Length=328

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  39   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  98

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRL+RL++LN+RWNKLQDV+PPEI ELK+LTHL LSFNN
Sbjct  99   LDLTRLDLHNNKLTGPIPPQIGRLRRLRMLNLRWNKLQDVLPPEICELKRLTHLSLSFNN  158

Query  362  FK  367
            FK
Sbjct  159  FK  160


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+   IP  +  + +LT+LYL  N F 
Sbjct  224  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMSGAIPTALAHIPKLTYLYLDHNQFS  283



>ref|XP_004985227.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Setaria italica]
Length=326

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            +SLGWRVVY+WVGDDPCG   LPPW+GVTCS QGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  37   SSLGWRVVYSWVGDDPCGHGSLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNL  96

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDL RLD+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNN
Sbjct  97   LDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNN  156

Query  362  FK  367
            FK
Sbjct  157  FK  158


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTN---LLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            G  + +  L+V    + G   + ++N      L  L ++NN+LTG +P QI  L  L+IL
Sbjct  190  GTLKNLRHLDVGNNHLTGTLRDLISNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEIL  249

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            ++  NK+   I P++ ++ +L +LYL  NNF
Sbjct  250  HLSNNKMIGSISPKLVQIPRLIYLYLDNNNF  280



>gb|KHG30687.1| hypothetical protein F383_06797 [Gossypium arboreum]
Length=330

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNL  100

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            LDLTRLD+HNNKLTGPIPPQIGRL+RL++LN+RWNKLQDV+PPEIGELK+L HL LSFNN
Sbjct  101  LDLTRLDLHNNKLTGPIPPQIGRLRRLRMLNLRWNKLQDVLPPEIGELKKLAHLSLSFNN  160

Query  362  FK  367
            FK
Sbjct  161  FK  162


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG +P Q+  +  L+IL + +NK+  VIP  + ++ +LT+LYL  N F 
Sbjct  226  LRNLYLNNNYLTGGVPAQLANVTNLEILYLSYNKMSGVIPTAVADIPKLTYLYLDHNQFS  285



>gb|EPS71094.1| hypothetical protein M569_03661, partial [Genlisea aurea]
Length=314

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQG--DYRVVTELEVYAVSIVGPFPNAVT  175
            +SLGWRV+YAWVG+DPCGD D PPW+GV CS  G  DYRV+TELEVYAVS+VGP P AVT
Sbjct  23   SSLGWRVLYAWVGEDPCGDGDSPPWSGVKCSVVGESDYRVITELEVYAVSLVGPIPLAVT  82

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NLLDL++LD+HNNKLTGPIP +IGRLK LKILN+RWNKLQD IP EIG+LK+LT LYLSF
Sbjct  83   NLLDLSKLDLHNNKLTGPIPSEIGRLKHLKILNLRWNKLQDAIPSEIGQLKELTQLYLSF  142

Query  356  NNFK  367
            NNFK
Sbjct  143  NNFK  146



>ref|XP_006417079.1| hypothetical protein EUTSA_v10008166mg [Eutrema salsugineum]
 gb|ESQ35432.1| hypothetical protein EUTSA_v10008166mg [Eutrema salsugineum]
Length=330

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY WVGDDPCG+  LPPW GVTCST G+YRVVT+LEV+A+SI G FP AVTNLLD
Sbjct  43   VGWRVVYTWVGDDPCGNGVLPPWTGVTCSTVGNYRVVTKLEVFAMSIGGTFPTAVTNLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGPIPPQIGRLKRLK LN+RWNKLQ V+PPEIG+LK LT LYLSFNNFK
Sbjct  103  LTVLDLHNNKLTGPIPPQIGRLKRLKSLNLRWNKLQHVLPPEIGQLKILTFLYLSFNNFK  162



>ref|XP_010476421.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Camelina sativa]
Length=330

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY+WVGDDPCGD  LPPW+GVTCST G+YRVV +LEV+++SIVG FP AVT LLD
Sbjct  43   VGWRVVYSWVGDDPCGDKHLPPWSGVTCSTVGNYRVVVKLEVFSMSIVGKFPTAVTKLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGP+P +IGRLKRLK LN+RWNKLQ+ +PPEIG LK LT+LYLSFNNFK
Sbjct  103  LTVLDMHNNKLTGPVPSEIGRLKRLKTLNLRWNKLQNALPPEIGGLKSLTYLYLSFNNFK  162



>ref|XP_002890027.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66286.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWR+VY+WVGDDPCGD  LPPW+GVTCST GDYRVV +LEVY++SIVG FP AVT LLD
Sbjct  43   VGWRLVYSWVGDDPCGDGVLPPWSGVTCSTVGDYRVVIKLEVYSMSIVGNFPKAVTKLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGPIP +IGRLKRLK LN+RWNKLQ V+PPEIG LK LT+LYLSFNNF+
Sbjct  103  LTVLDLHNNKLTGPIPSEIGRLKRLKTLNLRWNKLQHVLPPEIGGLKSLTNLYLSFNNFR  162



>ref|XP_010495663.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=329

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY+WVGDDPCGD  LPPW+GVTCST G+YRVV +LEV++VSIVG FP AVT LLD
Sbjct  43   VGWRVVYSWVGDDPCGDKHLPPWSGVTCSTVGNYRVVVKLEVFSVSIVGKFPTAVTRLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGP+P +IGRLK LK LN+RWNKLQ  +PPEIG LK LT+LYLSFNNFK
Sbjct  103  LTVLDLHNNKLTGPVPSEIGRLKHLKTLNLRWNKLQHALPPEIGGLKSLTYLYLSFNNFK  162



>ref|NP_172844.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 dbj|BAC42228.1| putative disease resistance protein [Arabidopsis thaliana]
 gb|AAP04025.1| putative disease resistance protein [Arabidopsis thaliana]
 gb|AEE29082.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=330

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWR+VY+WVGDDPCGD  LPPW+GVTCS  GDYRVV +LEVY++SIVG FP A+T LLD
Sbjct  43   VGWRLVYSWVGDDPCGDGVLPPWSGVTCSKVGDYRVVVKLEVYSMSIVGNFPKAITKLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGPIPP+IGRLKRL  LN+RWNKLQ  +PPEIG LK LT+LYLSFNNFK
Sbjct  103  LTVLDMHNNKLTGPIPPEIGRLKRLITLNLRWNKLQQALPPEIGGLKSLTYLYLSFNNFK  162



>ref|XP_010458859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Camelina sativa]
Length=329

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY+WVGDDPCGD +LPPW+GVTCST G+YRVV +LEV+++SIVG FP AVT LLD
Sbjct  43   VGWRVVYSWVGDDPCGDKNLPPWSGVTCSTVGNYRVVVKLEVFSMSIVGKFPTAVTKLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGP+P +IGRLKRLK LN+RWNKLQ  +PPEIG LK LT+L LSFNNFK
Sbjct  103  LTVLDLHNNKLTGPVPSEIGRLKRLKTLNLRWNKLQHALPPEIGGLKSLTYLCLSFNNFK  162



>gb|AAF79397.1|AC068197_7 F16A14.12 [Arabidopsis thaliana]
Length=383

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWR+VY+WVGDDPCGD  LPPW+GVTCS  GDYRVV +LEVY++SIVG FP A+T LLD
Sbjct  96   VGWRLVYSWVGDDPCGDGVLPPWSGVTCSKVGDYRVVVKLEVYSMSIVGNFPKAITKLLD  155

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGPIPP+IGRLKRL  LN+RWNKLQ  +PPEIG LK LT+LYLSFNNFK
Sbjct  156  LTVLDMHNNKLTGPIPPEIGRLKRLITLNLRWNKLQQALPPEIGGLKSLTYLYLSFNNFK  215



>ref|XP_006305321.1| hypothetical protein CARUB_v10009699mg [Capsella rubella]
 gb|EOA38219.1| hypothetical protein CARUB_v10009699mg [Capsella rubella]
Length=331

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY+WVGDDPCGD  LPPW+GVTCS   +YRVV +LEVY++SIVG  P AVT LLD
Sbjct  44   VGWRVVYSWVGDDPCGDKHLPPWSGVTCSKVDNYRVVVKLEVYSMSIVGNLPTAVTRLLD  103

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LT LD+HNNKLTGPIPP+IGRLKRLK LN+RWNKLQ  +PPEIG LK LT+LYLSFNNFK
Sbjct  104  LTVLDLHNNKLTGPIPPEIGRLKRLKTLNLRWNKLQHALPPEIGGLKSLTYLYLSFNNFK  163



>gb|KHG02754.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=284

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD +LPPW+G+TC+  GDYRVVTELEVYAVSIVGPFP  VTNL
Sbjct  35   ASLGWRVVYAWVGDDPCGDGNLPPWSGITCTLMGDYRVVTELEVYAVSIVGPFPVPVTNL  94

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             DLTRLD+HNNKLTGPIPPQI RLKRLKIL + +N  +  IP E+  L +L +L+L  N 
Sbjct  95   FDLTRLDMHNNKLTGPIPPQIERLKRLKILYLSFNNFKGEIPKELASLPELRYLHLHQNR  154

Query  362  F  364
            F
Sbjct  155  F  155



>gb|EYU22380.1| hypothetical protein MIMGU_mgv1a022828mg, partial [Erythranthe 
guttata]
Length=175

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 93/124 (75%), Gaps = 26/124 (21%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCST--QGDYRVVTELEVYAVSIVGPFPNAVT  175
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCST   GDYRVVTEL                
Sbjct  13   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTVSDGDYRVVTEL----------------  56

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
                    D+HNNKLTGPIP QIGRLK LKILN+RWNKLQDVIP EIGELKQLTHLYLSF
Sbjct  57   --------DLHNNKLTGPIPSQIGRLKHLKILNLRWNKLQDVIPSEIGELKQLTHLYLSF  108

Query  356  NNFK  367
            NNFK
Sbjct  109  NNFK  112



>ref|XP_002986028.1| hypothetical protein SELMODRAFT_123489, partial [Selaginella 
moellendorffii]
 gb|EFJ12847.1| hypothetical protein SELMODRAFT_123489, partial [Selaginella 
moellendorffii]
Length=305

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGD--YRVVTELEVYAVSIVGPFPNAVT  175
            A+ GW+V+YAW G+DPCGD D   W G+TCS+  D  YRVVTELE++ VSI+G FP  VT
Sbjct  9    AAGGWKVMYAWNGEDPCGDGDAALWPGITCSSPNDNGYRVVTELELFQVSIIGTFPIGVT  68

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NLLDL +LD+H NKLTG IPPQIGRL++L  LN+RWNKLQD IP EIG+LK+L +L+LSF
Sbjct  69   NLLDLRKLDLHGNKLTGSIPPQIGRLQKLVTLNLRWNKLQDAIPVEIGQLKKLQNLFLSF  128

Query  356  NNFK  367
            N+ +
Sbjct  129  NSLR  132



>ref|XP_010458858.1| PREDICTED: receptor-like protein 12 isoform X1 [Camelina sativa]
Length=308

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = +2

Query  8    LGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            +GWRVVY+WVGDDPCGD +LPPW+GVTCST G+YRVV +LEV+++SIVG FP AVT LLD
Sbjct  43   VGWRVVYSWVGDDPCGDKNLPPWSGVTCSTVGNYRVVVKLEVFSMSIVGKFPTAVTRLLD  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRW---NKLQDVIPPEIGELKQLTHLYLSFN  358
            LT LD+HNNKLTGP+P +IGRLKRLK LN+R+   N  +  IP E+  L +L  L+L  N
Sbjct  103  LTVLDLHNNKLTGPVPSEIGRLKRLKTLNLRYLSFNNFKGDIPKELANLHELQDLHLQEN  162

Query  359  NF  364
             F
Sbjct  163  QF  164



>ref|XP_002989597.1| hypothetical protein SELMODRAFT_160301 [Selaginella moellendorffii]
 gb|EFJ09267.1| hypothetical protein SELMODRAFT_160301 [Selaginella moellendorffii]
Length=290

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  23   VYAWVGDDPCGDNDLPPWAGVTCSTQGD--YRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            +YAW G+DPCGD D   W G+TCS+  D  YRVVTELE++ VSI+G FP  VTNLLDL +
Sbjct  1    MYAWNGEDPCGDGDAALWPGITCSSPNDNGYRVVTELELFQVSIIGTFPIGVTNLLDLRK  60

Query  197  LDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LD+H NKLTG IPPQIGRL++L  LN+RWNKLQD IP EIG+LK+L +L+LSFN+ +
Sbjct  61   LDLHGNKLTGSIPPQIGRLEKLVTLNLRWNKLQDAIPVEIGQLKKLQNLFLSFNSLR  117



>ref|XP_007037491.1| Leucine-rich repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY21992.1| Leucine-rich repeat family protein isoform 2 [Theobroma cacao]
Length=302

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 24/122 (20%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAW+GDDPCGD DLPPW+GVTCSTQGDYRVVTEL                  
Sbjct  37   ASLGWRVVYAWIGDDPCGDGDLPPWSGVTCSTQGDYRVVTEL------------------  78

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
                  D+HNNKLTGP+PPQIGRL+RL++LN+RWNKLQDV+PPEIGELK+LTHL LSFNN
Sbjct  79   ------DLHNNKLTGPLPPQIGRLRRLRMLNLRWNKLQDVLPPEIGELKRLTHLSLSFNN  132

Query  362  FK  367
            FK
Sbjct  133  FK  134


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            L  L ++NN LTG IP Q+  L  L+IL + +NK+   IP  +  + +LT+LYL  N F 
Sbjct  198  LRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMSGAIPSALAHIPKLTYLYLDHNQFS  257



>ref|XP_002989593.1| hypothetical protein SELMODRAFT_130127 [Selaginella moellendorffii]
 gb|EFJ09263.1| hypothetical protein SELMODRAFT_130127 [Selaginella moellendorffii]
Length=343

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 6/124 (5%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGD--YRVVTELEVYAVSIVGPFPNAVT  175
            A+ GW+V+YAW G+DPCGD D   W G+TCS+  D  YRVVTELE++ VSI+G FP  VT
Sbjct  48   AAGGWKVMYAWNGEDPCGDGDAALWPGITCSSPNDDGYRVVTELELFQVSIIGTFPIGVT  107

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NLLDL +LD+H NKLTGPIPPQIGRL++L  LN+RW+KL    P EIG+LK+L +L+LSF
Sbjct  108  NLLDLRKLDLHGNKLTGPIPPQIGRLEKLVTLNLRWSKL----PVEIGQLKKLQNLFLSF  163

Query  356  NNFK  367
            N+ +
Sbjct  164  NSLR  167



>emb|CDY47028.1| BnaC02g42130D [Brassica napus]
Length=150

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 81/90 (90%), Gaps = 3/90 (3%)
 Frame = +2

Query  95   TQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILN  274
            +QGDYRVVTEL +YAVSIVGPFP AVTNLLDLTRLDIHNNKLTGP+P QIGRLKR   LN
Sbjct  47   SQGDYRVVTELSLYAVSIVGPFPIAVTNLLDLTRLDIHNNKLTGPMPSQIGRLKR---LN  103

Query  275  IRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +RWNKLQDVIPPE+GELK+LTHLYL  N F
Sbjct  104  LRWNKLQDVIPPEVGELKRLTHLYLDHNQF  133



>gb|AAT38740.1| Putative leucine-rich repeat resistance protein, identical [Solanum 
demissum]
Length=424

 Score =   150 bits (380),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 69/95 (73%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVYAWVGDDPCGD DLPPW+GVTCSTQGDYRVVTELEVYAVSIVG FP  VTNL
Sbjct  12   ASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGLFPTVVTNL  71

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
            LDLTRL +  N   G IP ++  L  L+ L++  N
Sbjct  72   LDLTRLYLSFNNFKGEIPKELANLPELRYLHLHEN  106



>ref|XP_002982017.1| hypothetical protein SELMODRAFT_421427 [Selaginella moellendorffii]
 gb|EFJ17110.1| hypothetical protein SELMODRAFT_421427 [Selaginella moellendorffii]
Length=490

 Score =   141 bits (355),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 9/105 (9%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGD--YRVVTELEVYAVSIVGPFPNAVTNLL  184
            GW+V+YAW G+DPCGD D   W G+TCS+  D  YRVVTELE++ VSI+G FP  VTNLL
Sbjct  371  GWKVMYAWNGEDPCGDGDAALWPGITCSSPNDERYRVVTELELFQVSIIGTFPIGVTNLL  430

Query  185  DLTRL-------DIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQD  298
            DL +L       D+H NKLTGPIPPQIGRL++L  LN RWNKLQD
Sbjct  431  DLRKLCADFSGRDLHGNKLTGPIPPQIGRLEKLVTLNSRWNKLQD  475



>dbj|BAJ09394.1| TuMV resistance-like protein [Brassica rapa subsp. chinensis]
Length=829

 Score =   140 bits (354),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 6/119 (5%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDL  190
            G+   ++ +GDDPCGD D   + G  CSTQGD RVVT+ E  A  IVGPFP AVTNLLDL
Sbjct  552  GFPAAFSMLGDDPCGDGDFLKFHGSHCSTQGDNRVVTDHEFQASKIVGPFPIAVTNLLDL  611

Query  191  TRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             RLD+H NKL G   P     K LK L++RWN ++DVIPPEIGEL++L HL L FN+FK
Sbjct  612  MRLDLH-NKLPGKFDP-----KELKDLSLRWNHIKDVIPPEIGELERLRHLDLGFNSFK  664



>ref|XP_004169857.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
Length=106

 Score =   128 bits (322),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            ASLGWRVVY+WVGDDPCG + LPPW+GVTCSTQGDYRVVTELEVYAVSIVGPFP AVTNL
Sbjct  41   ASLGWRVVYSWVGDDPCGASHLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPVAVTNL  100

Query  182  LDLTRL  199
            LDLTRL
Sbjct  101  LDLTRL  106



>gb|KFK43641.1| hypothetical protein AALP_AA1G153400 [Arabis alpina]
Length=244

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            +SIVG FP AVTNLLDL  LDIHNNKLTGP PPQIG+LKRLK LN+RWNKLQ  +PPEIG
Sbjct  1    MSIVGNFPKAVTNLLDLIVLDIHNNKLTGPTPPQIGKLKRLKSLNLRWNKLQHDLPPEIG  60

Query  320  ELKQLTHLYLSFNNFK  367
             LK LT LYLSFNNFK
Sbjct  61   GLKSLTFLYLSFNNFK  76



>gb|AFW89246.1| hypothetical protein ZEAMMB73_044267 [Zea mays]
Length=115

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  200  DIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            D+HNNKLTGPIPPQIGRLK L+ILN+RWNKLQDV+PPEIGELK+LTHLYLSFNNFK
Sbjct  24   DLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFK  79



>ref|XP_004157333.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
Length=227

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  200  DIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            D+HNNKLTGPIPPQIGRL+RLKILN+RWNKLQDVIPPEIG LK LTHLYL FNNFK
Sbjct  4    DLHNNKLTGPIPPQIGRLRRLKILNLRWNKLQDVIPPEIGALKGLTHLYLGFNNFK  59


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L I+NN  TG +P Q+  L  L+IL + +NK+  +IPP +  + +LT+LYL  N F
Sbjct  122  SLRNLYINNNYFTGGVPSQLANLTNLEILYLSYNKMSGIIPPGVAHIPKLTYLYLDHNQF  181



>gb|KHG00184.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=55

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            D +LPPW GVTCSTQGDYRVV++LEVYAVSIVGPFP  VTNLLDLT
Sbjct  8    DGNLPPWFGVTCSTQGDYRVVSKLEVYAVSIVGPFPIVVTNLLDLT  53



>ref|XP_002982025.1| hypothetical protein SELMODRAFT_421442 [Selaginella moellendorffii]
 gb|EFJ17118.1| hypothetical protein SELMODRAFT_421442 [Selaginella moellendorffii]
Length=507

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGD--YRVVTELEVYAVSIVGPFPNAVTNLL  184
            GW+V+YAW G+DPCGD D   W G+T S+  D  YRVVTELE++ VSI+G FP  VTNLL
Sbjct  387  GWKVMYAWNGEDPCGDGDAALWPGITFSSPNDDGYRVVTELELFQVSIIGTFPIGVTNLL  446

Query  185  DLTRL  199
            DL +L
Sbjct  447  DLRKL  451



>emb|CDM84720.1| unnamed protein product [Triticum aestivum]
Length=924

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 10/113 (9%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIH  208
            +W G DPC      PW G++CS+      VTE+ + ++++ G   NA+  L  LT LD+ 
Sbjct  10   SWTGSDPC-----KPWDGISCSSGR----VTEMRLSSMNVAGTLSNAIDQLSALTYLDLS  60

Query  209  NN-KLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            NN  L G + P IG LK+L ILN+        IP EIG L+QLT L L+ N F
Sbjct  61   NNPSLGGSLTPNIGNLKQLTILNLLGCSFTGNIPQEIGNLRQLTFLALNMNQF  113


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query  146  IVGPFPNAVTNL-LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            + GP    + N  ++L  +   NNKL GPIPP +G +K L+I+ +  N+ + V+P  IG 
Sbjct  167  LTGPMDKRLFNANMNLVHVLFDNNKLDGPIPPSLGLVKTLQIIRLDHNQFKGVVPDSIGN  226

Query  323  LKQLTHLYLSFNNF  364
            L  L  L L+ N  
Sbjct  227  LTSLMELSLASNQL  240



>gb|EEE50765.1| hypothetical protein OsJ_31119 [Oryza sativa Japonica Group]
Length=1033

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  14   WRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            W VV     D   G N    W GVTCS+   +R V  L V  + +VG     V NL  L 
Sbjct  56   WSVVSNGTSD---GTNGFCSWRGVTCSSGARHRRVVSLRVQGLGLVGTISPLVGNLTGLR  112

Query  194  RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             LD+ +NKL G IPP + R   L+ LN+  N L  VIPP IG+L +L  L +  NN
Sbjct  113  ELDLSDNKLEGEIPPSLARCLALQRLNLSVNFLSGVIPPSIGQLSKLEVLNIRHNN  168


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR-LDIHNNKLTGPIPPQIGRLKRLKI  268
            +T G+   +T +++ +  + G  P  +  +  LT  L++ NN L+GPI P IG L  + I
Sbjct  471  ATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTEALNLSNNALSGPISPYIGNLVNVGI  530

Query  269  LNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +++  NKL   IP  +G    L  LYL  N
Sbjct  531  IDLSSNKLSGQIPSTLGNCLALQFLYLQAN  560


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ GP    + NL+++  +D+ +NKL+G IP  +G    L+ L ++ N L  +IP E+ +
Sbjct  513  ALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLALQFLYLQANLLHGLIPKELNK  572

Query  323  LKQLTHLYLSFNNF  364
            L+ L  L LS N F
Sbjct  573  LRGLEVLDLSNNKF  586



>gb|AAM00988.1|AC090482_17 Putative receptor protein kinase [Oryza sativa Japonica Group]
 gb|AAP53098.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
Length=1056

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  14   WRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            W VV     D   G N    W GVTCS+   +R V  L V  + +VG     V NL  L 
Sbjct  56   WSVVSNGTSD---GTNGFCSWRGVTCSSGARHRRVVSLRVQGLGLVGTISPLVGNLTGLR  112

Query  194  RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             LD+ +NKL G IPP + R   L+ LN+  N L  VIPP IG+L +L  L +  NN
Sbjct  113  ELDLSDNKLEGEIPPSLARCLALQRLNLSVNFLSGVIPPSIGQLSKLEVLNIRHNN  168


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR-LDIHNNKLTGPIPPQIGRLKRLKI  268
            +T G+   +T +++ +  + G  P  +  +  LT  L++ NN L+GPI P IG L  + I
Sbjct  471  ATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTEALNLSNNALSGPISPYIGNLVNVGI  530

Query  269  LNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +++  NKL   IP  +G    L  LYL  N
Sbjct  531  IDLSSNKLSGQIPSTLGNCLALQFLYLQAN  560


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ GP    + NL+++  +D+ +NKL+G IP  +G    L+ L ++ N L  +IP E+ +
Sbjct  513  ALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLALQFLYLQANLLHGLIPKELNK  572

Query  323  LKQLTHLYLSFNNF  364
            L+ L  L LS N F
Sbjct  573  LRGLEVLDLSNNKF  586



>ref|NP_001064374.2| Os10g0337400 [Oryza sativa Japonica Group]
 dbj|BAF26288.2| Os10g0337400 [Oryza sativa Japonica Group]
Length=913

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  14   WRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            W VV     D   G N    W GVTCS+   +R V  L V  + +VG     V NL  L 
Sbjct  56   WSVVSNGTSD---GTNGFCSWRGVTCSSGARHRRVVSLRVQGLGLVGTISPLVGNLTGLR  112

Query  194  RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             LD+ +NKL G IPP + R   L+ LN+  N L  VIPP IG+L +L  L +  NN
Sbjct  113  ELDLSDNKLEGEIPPSLARCLALQRLNLSVNFLSGVIPPSIGQLSKLEVLNIRHNN  168


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR-LDIHNNKLTGPIPPQIGRLKRLKI  268
            +T G+   +T +++ +  + G  P  +  +  LT  L++ NN L+GPI P IG L  + I
Sbjct  471  ATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTEALNLSNNALSGPISPYIGNLVNVGI  530

Query  269  LNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +++  NKL   IP  +G    L  LYL  N
Sbjct  531  IDLSSNKLSGQIPSTLGNCLALQFLYLQAN  560


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ GP    + NL+++  +D+ +NKL+G IP  +G    L+ L ++ N L  +IP E+ +
Sbjct  513  ALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLALQFLYLQANLLHGLIPKELNK  572

Query  323  LKQLTHLYLSFNNF  364
            L+ L  L LS N F
Sbjct  573  LRGLEVLDLSNNKF  586



>gb|EAY78081.1| hypothetical protein OsI_33125 [Oryza sativa Indica Group]
Length=1033

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/116 (41%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  14   WRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            W VV     D   G N    W GVTCS+   +R V  L V  + +VG     + NL  L 
Sbjct  56   WSVVSNGTSD---GTNGFCSWRGVTCSSGARHRRVVSLRVQGLGLVGTISPLLGNLTGLR  112

Query  194  RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             LD+ +NKL G IPP + R   L+ LN+  N L  VIPP IG+L +L  L +  NN
Sbjct  113  ELDLSDNKLEGEIPPSLARCLALQRLNLSVNFLSGVIPPSIGQLSKLEVLNIRHNN  168


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR-LDIHNNKLTGPIPPQIGRLKRLKI  268
            +T G+   +T +++ +  + G  P  +  +  LT  L++ NN L+GPI P IG L  + I
Sbjct  471  ATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTEALNLSNNALSGPISPYIGNLVNVGI  530

Query  269  LNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +++  NKL   IP  +G    L  LYL  N
Sbjct  531  IDLSSNKLSGQIPSTLGNCLALQFLYLQAN  560


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ GP    + NL+++  +D+ +NKL+G IP  +G    L+ L ++ N L  +IP E+ +
Sbjct  513  ALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLALQFLYLQANLLHGLIPKELNK  572

Query  323  LKQLTHLYLSFNNF  364
            L+ L  L LS N F
Sbjct  573  LRGLEVLDLSNNKF  586



>ref|XP_010044547.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=984

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-L  220
            DPCG     PW GVTC +      VT L + +++I GP P  +  L +LT LD+  NK L
Sbjct  74   DPCG----LPWVGVTCDSNSR---VTGLGLSSMNIKGPLPADIGGLTELTSLDLSLNKGL  126

Query  221  TGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            TGPIP Q+G L++L IL +        IP E+G L +LT L L+ NNF
Sbjct  127  TGPIPSQLGSLQKLNILILANCSFTSSIPDELGNLTELTFLALNSNNF  174



>ref|XP_002448532.1| hypothetical protein SORBIDRAFT_06g028570 [Sorghum bicolor]
 gb|EES12860.1| hypothetical protein SORBIDRAFT_06g028570 [Sorghum bicolor]
Length=886

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    ASLGWRVVYAW-VGDDPC-----------GDNDLPPWAGVTCSTQGDYRV--VTELEVYA  139
            A LG     AW +  DPC            +N+  P     CS Q +  V  VT+L++YA
Sbjct  16   AKLGQAASSAWNISGDPCTGTATDGTVIDDNNNFNPAIKCECSVQNNVTVCHVTKLKIYA  75

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            ++ VGP P  + NL  LT LD+  N LTGP+P  +G L  ++ +++  N L   +P E+G
Sbjct  76   LNAVGPIPQELQNLTRLTNLDLRQNYLTGPLPSFLGNLTAMQYMSLGINALSGSVPKELG  135

Query  320  ELKQLTHLYL  349
             L  L  LY+
Sbjct  136  NLANLVSLYI  145



>gb|AHG54199.1| LRR receptor-like protein kinase 1 [Triticum aestivum]
Length=1014

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 13/134 (10%)
 Frame = +2

Query  2    ASLGWRVVYAW-VGDDPCG---------DNDLPPWAGVTCS-TQGDYRV--VTELEVYAV  142
            A LG + + +W +  DPC          DN+ P    + C  T G+  V  VT L++YA+
Sbjct  40   AKLGQKALSSWNISGDPCTGAATDNTNIDNNPPFNPAIKCECTGGNASVCRVTRLKIYAL  99

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
              VGP P  + NL  LT LD+  N LTGP+P  IG L R++ ++   N L   +P E+  
Sbjct  100  DAVGPIPEELRNLTALTNLDLSQNYLTGPLPSFIGELTRMQYMSFGINALSGPLPKELRN  159

Query  323  LKQLTHLYLSFNNF  364
            L  L  L +S NNF
Sbjct  160  LTDLVSLSVSSNNF  173



>ref|XP_010044526.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Eucalyptus grandis]
Length=985

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 8/109 (7%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-  217
            +DPCG     PW G+TC++      VT L + +++I GP P  +  L +LT LD+  NK 
Sbjct  73   NDPCG----LPWDGLTCNSNSR---VTGLGLSSMNIKGPLPADIGGLTELTSLDLSLNKG  125

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGPIP Q+G L++L IL +        IP E+G L +LT L L+ NNF
Sbjct  126  LTGPIPSQLGSLQKLNILILAGCSFTGSIPDELGNLMELTFLALNSNNF  174



>ref|XP_010044534.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Eucalyptus grandis]
Length=969

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 8/109 (7%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-  217
            +DPCG     PW G+TC++      VT L + +++I GP P  +  L +LT LD+  NK 
Sbjct  73   NDPCG----LPWDGLTCNSNSR---VTGLGLSSMNIKGPLPADIGGLTELTSLDLSLNKG  125

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGPIP Q+G L++L IL +        IP E+G L +LT L L+ NNF
Sbjct  126  LTGPIPSQLGSLQKLNILILAGCSFTGSIPDELGNLMELTFLALNSNNF  174



>ref|XP_003593681.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
 gb|AES63932.1| LRR receptor-like kinase [Medicago truncatula]
Length=934

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            WVG DPCG N    WAG+ C    D   +TEL++  +S+ G   +A+ +L +L  LD+ +
Sbjct  47   WVGSDPCGSN----WAGIGC----DNSRITELKLLGLSLEGQLSSAIQSLSELETLDLSS  98

Query  212  NK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  +TG IP +IG LK L  L +        IP  IG LK+LT L L+ NNF
Sbjct  99   NTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSIGSLKKLTFLALNSNNF  150



>ref|XP_003593682.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=909

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            WVG DPCG N    WAG+ C    D   +TEL++  +S+ G   +A+ +L +L  LD+ +
Sbjct  22   WVGSDPCGSN----WAGIGC----DNSRITELKLLGLSLEGQLSSAIQSLSELETLDLSS  73

Query  212  NK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  +TG IP +IG LK L  L +        IP  IG LK+LT L L+ NNF
Sbjct  74   NTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSIGSLKKLTFLALNSNNF  125



>gb|KCW88501.1| hypothetical protein EUGRSUZ_A00887 [Eucalyptus grandis]
Length=904

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 8/109 (7%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-  217
            +DPCG     PW G+TC++      VT L + +++I GP P  +  L +LT LD+  NK 
Sbjct  47   NDPCG----LPWDGLTCNSNSR---VTGLGLSSMNIKGPLPADIGGLTELTSLDLSLNKG  99

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGPIP Q+G L++L IL +        IP E+G L +LT L L+ NNF
Sbjct  100  LTGPIPSQLGSLQKLNILILAGCSFTGSIPDELGNLMELTFLALNSNNF  148



>ref|XP_006402241.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
 gb|ESQ43694.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
Length=964

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 9/117 (8%)
 Frame = +2

Query  17   RVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            R   +W G DPCG N    W G+TCS     R+V+ + +  +++ G     ++ L +L  
Sbjct  42   RFPESWKGSDPCGTN----WVGITCSND---RIVS-ISLGNINLEGKLSADISALAELQI  93

Query  197  LDIHNN-KLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LD+ +N KL+GP+PP IG LK+L  LN+        IP  IG L+QLT L L+ N F
Sbjct  94   LDLTSNPKLSGPLPPNIGNLKKLNTLNLMGCGFSGQIPESIGSLEQLTTLSLNSNKF  150



>ref|XP_004308369.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1090

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GVTCS +   RV T+LE+ ++ +VG     + NL  L +LD+ NN  T  IPPQIG L
Sbjct  139  WHGVTCSRRHRQRV-TKLELDSLELVGSISPYIGNLSFLRKLDLENNSFTHHIPPQIGHL  197

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
             RLK+L++  N L   IPP I    QL  L L+FN
Sbjct  198  HRLKVLSLNNNSLSGSIPPNISNCFQLITLDLAFN  232


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 8/104 (8%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDL-TRLDIHNNKLTGPI  232
            +  +PP       T G+YR + EL +   ++ G  P  V  L  L T L +  N+ TG +
Sbjct  529  EGSIPP-------TLGNYRWLLELGLSGNNLNGTIPPQVIGLSSLSTVLALQRNQFTGSL  581

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            P +IG+LK L  L++  N L   +P  +G  + L  LYL  N F
Sbjct  582  PTEIGKLKNLGALDVSNNMLSGELPSSLGSCESLEALYLDGNFF  625


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 0/75 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ G  P  ++N   L  LD+  N L G IPPQ+  L +L   N++ N L   IP  +G 
Sbjct  209  SLSGSIPPNISNCFQLITLDLAFNILVGKIPPQLSSLSKLAYFNLQKNNLTGEIPHSLGN  268

Query  323  LKQLTHLYLSFNNFK  367
            L  L     +FN+ +
Sbjct  269  LSSLEIFGSTFNSLE  283


 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            +VG  P  +++L  L   ++  N LTG IP  +G L  L+I    +N L+  IP  + +L
Sbjct  234  LVGKIPPQLSSLSKLAYFNLQKNNLTGEIPHSLGNLSSLEIFGSTFNSLEGRIPSSLCQL  293

Query  326  KQLTHLYLSFN  358
            ++L  LY   N
Sbjct  294  QKLKILYFGQN  304



>gb|KDO39482.1| hypothetical protein CISIN_1g041034mg, partial [Citrus sinensis]
Length=701

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 63/119 (53%), Gaps = 9/119 (8%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLL-D  187
            GW     W    P   +D   W G+TC  +G    +T +E+   SI G   +   +   +
Sbjct  12   GW-----WKDRIPHNTSDHCNWVGITCDYKGS---ITHIELVECSIKGELGSLNFSCFPN  63

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L++ NN L+G IPPQIG L  LK LN+RWN L   IP EIG L+ L  LYLS N+ 
Sbjct  64   LQYLNLWNNNLSGSIPPQIGSLSNLKYLNLRWNNLTGTIPKEIGSLRNLEVLYLSNNSL  122


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            +GV     G+ + +  L V   ++ GP P+ +  L +L RL +  N+  G IP +IG LK
Sbjct  147  SGVLPQEIGNLKSLIWLSVMYNTVGGPIPSTLFRLTNLERLFLGCNQFNGTIPREIGNLK  206

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L+I  NKL   IP  +G L  L +L LSFN  
Sbjct  207  NLTHLSIITNKLTGAIPSTLGHLTSLLYLDLSFNQL  242


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  + NL +LT L I  NKLTG IP  +G L  L  L++ +N+L   IP EIG    
Sbjct  196  GTIPREIGNLKNLTHLSIITNKLTGAIPSTLGHLTSLLYLDLSFNQLHSFIPLEIGNFSA  255

Query  332  LTHLYLSFNNFK  367
            L  L LS N  +
Sbjct  256  LAELDLSDNKIR  267


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P A+  L +L  LD+  NKL+G  P  IG    L+ L +  N L   IPPEIG++
Sbjct  290  LSGQIPFAIGKLFNLVSLDLSKNKLSGSFPTGIGNCTELQHLALNHNSLDGTIPPEIGKI  349

Query  326  KQLTHLYLSFNNFK  367
              L +L LS NN  
Sbjct  350  LLLQNLDLSHNNLS  363


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 46/93 (49%), Gaps = 0/93 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G T    G  R + EL + +  + G  P  + NL  L  L +  N + GPIP  + RL  
Sbjct  124  GTTPIEIGSLRNLEELYLRSNKLSGVLPQEIGNLKSLIWLSVMYNTVGGPIPSTLFRLTN  183

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            L+ L +  N+    IP EIG LK LTHL +  N
Sbjct  184  LERLFLGCNQFNGTIPREIGNLKNLTHLSIITN  216


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G++  + EL++    I G  P+ ++ L +L  L++ +N L+G IP  IG+L  L  L++ 
Sbjct  251  GNFSALAELDLSDNKIRGIIPDELSKLSNLQYLNLSSNLLSGQIPFAIGKLFNLVSLDLS  310

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL    P  IG   +L HL L+ N+ 
Sbjct  311  KNKLSGSFPTGIGNCTELQHLALNHNSL  338


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T L +    + G  P+ + +L  L  LD+  N+L   IP +IG    L  L++ 
Sbjct  203  GNLKNLTHLSIITNKLTGAIPSTLGHLTSLLYLDLSFNQLHSFIPLEIGNFSALAELDLS  262

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             NK++ +IP E+ +L  L +L LS N
Sbjct  263  DNKIRGIIPDELSKLSNLQYLNLSSN  288



>ref|XP_010044564.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=983

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIH-NNK  217
            +DPCG      W GVTC   G+ RV T+L +  ++I GP P+ +  L +LT LD+  N+ 
Sbjct  70   NDPCGH----LWDGVTCD--GNSRV-TQLGLSGMNIKGPLPSDIGGLTELTSLDLSLNSG  122

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGPIP Q+G L++L IL +        IP E+G L +LT L L+ NNF
Sbjct  123  LTGPIPLQLGSLQKLTILMLAECSFTGSIPDELGNLSELTFLALNSNNF  171



>emb|CBI35487.3| unnamed protein product [Vitis vinifera]
Length=1055

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GVTC++  +   V  L +  V + G  P  +++  +L  +++  N+L GP+P Q+G L
Sbjct  63   WFGVTCTS--NRTSVQSLHLPGVGLSGQIPAGLSHCYNLREINLRRNQLVGPLPSQLGHL  120

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             RLK +++  N L   IPP  G L  LTHL L  NNF+
Sbjct  121  SRLKFMDVYANNLSGAIPPTFGNLTSLTHLNLGRNNFR  158


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  122  ELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDV  301
            E+ +    +VGP P+ + +L  L  +D++ N L+G IPP  G L  L  LN+  N  +D 
Sbjct  101  EINLRRNQLVGPLPSQLGHLSRLKFMDVYANNLSGAIPPTFGNLTSLTHLNLGRNNFRDE  160

Query  302  IPPEIGELKQLTHLYLSFNNF  364
            IP E+G L  L  L LS N  
Sbjct  161  IPKELGNLHNLVLLRLSENQL  181


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  PN++  L  L R+ +H N  +G IP   G L +L +L + +N+    IP  IGE +Q
Sbjct  257  GELPNSIGRLNKLQRIFVHENMFSGEIPNVFGNLTQLYMLTLGYNQFSGRIPVSIGECQQ  316

Query  332  LTHLYLSFN  358
            L  L LS+N
Sbjct  317  LNTLGLSWN  325


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  PN   NL  L  L +  N+ +G IP  IG  ++L  L + WN+L   IP EI  L  
Sbjct  281  GEIPNVFGNLTQLYMLTLGYNQFSGRIPVSIGECQQLNTLGLSWNRLNGSIPIEIFSLSG  340

Query  332  LTHLYLSFNNFK  367
            L+ L+L  N+ +
Sbjct  341  LSKLWLEKNSLQ  352


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 3/84 (4%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            DN L   +G    T G+   +  L +    I+G  P+ V  L+ L  LD+ +N L+GPIP
Sbjct  372  DNQL---SGNITETIGNCLSLQTLSMARNGIMGSIPDKVGKLVALKSLDLSSNNLSGPIP  428

Query  236  PQIGRLKRLKILNIRWNKLQDVIP  307
              +G LK L+ LN+ +N L+  +P
Sbjct  429  EYLGSLKDLQSLNLSFNDLEGKVP  452


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  + ++ L V    + G     + N L L  L +  N + G IP ++G+L  LK L++ 
Sbjct  360  GSLKQLSLLNVSDNQLSGNITETIGNCLSLQTLSMARNGIMGSIPDKVGKLVALKSLDLS  419

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N L   IP  +G LK L  L LSFN+ +
Sbjct  420  SNNLSGPIPEYLGSLKDLQSLNLSFNDLE  448



>emb|CDY42863.1| BnaAnng06880D [Brassica napus]
Length=276

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 12/71 (17%)
 Frame = +2

Query  167  AVTNLL---DLTRLDIHNNKLTGPIPPQIGRLKRLK-ILNIRWNKLQDVIPPEIGELKQL  334
             VT LL       +D+HNNKLTGPIP Q  RLKRLK  +N+RWNKLQD        LK+L
Sbjct  93   VVTELLLERSCFEMDLHNNKLTGPIPSQTKRLKRLKTCINLRWNKLQD--------LKRL  144

Query  335  THLYLSFNNFK  367
            THLYLSFN+FK
Sbjct  145  THLYLSFNSFK  155



>gb|AGT17059.1| receptor kinase-like protein [Saccharum hybrid cultivar R570]
Length=401

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 61/107 (57%), Gaps = 1/107 (1%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DP G   L  W GVTCS +   R V  L + ++ + G     + NL  L  LD+ NN L 
Sbjct  53   DPSGSTRLCTWRGVTCSRRHPGRNVA-LSINSLGLGGRVSPFLGNLSFLRTLDLGNNSLA  111

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            GPIPP++GRL RL++LN+  N L+  IP  +G   QLT L L+ N+ 
Sbjct  112  GPIPPELGRLGRLRVLNLSVNSLEGGIPAALGMCAQLTTLSLASNHL  158


 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT-RLDIHNNKLTGPIPPQIGRLK  256
            G   +T G+ + + E ++    + G  P  +  +  L+  LD+ +N L GPIPP+IG LK
Sbjct  206  GTVPTTLGNLKSLLEFDLSRNKLTGSIPANLLQIPSLSIELDLSHNLLEGPIPPEIGNLK  265

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             +   +   N+L   IP  +GE + L +LYL  NNF
Sbjct  266  SVSSFHAESNRLSGEIPSTLGECQLLQNLYLQ-NNF  300



>ref|XP_007148093.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
 gb|ESW20087.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
Length=930

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 10/113 (9%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +WVG DPC       W G+ CS       +TEL + ++S+ G   +A+ +L +L  LD+ 
Sbjct  46   SWVGTDPCSS-----WDGIRCSNTR----ITELRLPSLSLRGQLSSAIESLSELVTLDLS  96

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N  LTG IP +IG LKRLK L++        IP  IG LKQLT L L+ N F
Sbjct  97   YNTGLTGTIPNEIGNLKRLKSLSLVGCGFSGPIPDSIGSLKQLTFLALNSNKF  149



>gb|KDO43356.1| hypothetical protein CISIN_1g038615mg [Citrus sinensis]
Length=274

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (53%), Gaps = 4/110 (4%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLL-DLTRLDIH  208
            W    P   +D   W G+TC  +G    +T +E+   SI G   +   +   +L  L++ 
Sbjct  53   WKDRIPHNTSDHCNWVGITCDYKGS---ITHIELVECSIKGELGSLNFSCFPNLQYLNLW  109

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            NN L+G IPPQIG L  LK LN+RWN L   IP EIG  + L  LYL  N
Sbjct  110  NNNLSGSIPPQIGSLSNLKYLNLRWNNLTGTIPTEIGIFRNLEELYLPSN  159



>ref|XP_011091154.1| PREDICTED: polygalacturonase inhibitor-like [Sesamum indicum]
Length=395

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +2

Query  26   YAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            YA    DP    D   W  V C+ +  +R+V +L ++A ++ G  P AV+ L  L  L  
Sbjct  113  YALASWDP--KTDCCEWYVVECN-RITHRIV-QLHLFASNVSGQIPAAVSELPYLELLRF  168

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            H   LTG IPP I +L  LK L++ WN L   +PP + +LK LT L LSFNNF
Sbjct  169  HKLNLTGSIPPSITKLTNLKFLDVSWNHLSGHVPPFLSQLKNLTFLDLSFNNF  221


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L  + +++ G  P ++T L +L  LD+  N L+G +PP + +LK L  L++ +N     I
Sbjct  166  LRFHKLNLTGSIPPSITKLTNLKFLDVSWNHLSGHVPPFLSQLKNLTFLDLSFNNFTGSI  225

Query  305  PPEIGELKQLTHLYLSFNN  361
            P  + E + L  L+L  N+
Sbjct  226  PSSLSEFQNLGALHLDRNS  244



>ref|XP_003055698.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60950.1| predicted protein [Micromonas pusilla CCMP1545]
Length=326

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 59/117 (50%), Gaps = 7/117 (6%)
 Frame = +2

Query  17   RVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            R +  W GD PC      PW G+ C    D   VT L++   SI G   +A+  L  L  
Sbjct  75   RALLNWEGDYPCKQ----PWVGIRCYQGND---VTHLDLSHRSIGGDLLDAIAELDTLVE  127

Query  197  LDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            LD+ +N LTGPIP  IG + RL  LN+R N+    +P  +G    L H+ L+ N  +
Sbjct  128  LDLSSNFLTGPIPTAIGLMPRLATLNLRANRFTGGVPATLGNSSSLRHVSLAQNRLR  184



>ref|XP_008801288.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Phoenix dactylifera]
Length=803

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            VT L +Y  S+ G FP  V N  +LT LD+  N L+GPIPP+IGRL  L++L++  N L 
Sbjct  192  VTNLSLYNNSLTGKFPPFVLNCTNLTYLDLSQNNLSGPIPPEIGRLADLQMLDLSENFLS  251

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IP  IG L QLT L L +NN 
Sbjct  252  GPIPRSIGNLTQLTSLVLFYNNL  274


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            ++G   S  GD   +T L++      GP P  + NL  LT LD+  NKLTGPIP ++G L
Sbjct  394  FSGSIPSELGDATQLTYLDLSENKFTGPIPTNLGNLAQLTYLDLSKNKLTGPIPTKLGNL  453

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             +L+ L++  N L   IP E+G L QL  L+L+ NN 
Sbjct  454  AQLQSLHLNNNSLIGPIPSELGNLAQLQSLHLNNNNL  490


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++   ++ GP P  +  L DL  LD+  N L+GPIP  IG L +L  L + +N L 
Sbjct  216  LTYLDLSQNNLSGPIPPEIGRLADLQMLDLSENFLSGPIPRSIGNLTQLTSLVLFYNNLN  275

Query  296  DVIPPEIGELKQLTHLYLSFNNFK  367
              IP EIG +  L +L  + N  +
Sbjct  276  GAIPAEIGNMTALANLDFNTNQLE  299


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 33/98 (34%), Positives = 50/98 (51%), Gaps = 4/98 (4%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPN-AVTNLLDLTRLDIHNNKLTGPIPPQIGR  250
            W GV C++ G    + +L +   ++ G        +L  LT+LD++ N L G IP  I  
Sbjct  60   WFGVRCNSAGS---IVQLSLPNANLNGTLDEFDFASLPSLTKLDLNANLLNGSIPSNISA  116

Query  251  LKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L  L++  N   + IPPEIG+L ++  L L  NN 
Sbjct  117  LSNLASLDLSSNSFVESIPPEIGQLSEMLDLRLYHNNL  154


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L++    + GP P  + NL  L  L ++NN L GPIP ++G L +L+ L++ 
Sbjct  427  GNLAQLTYLDLSKNKLTGPIPTKLGNLAQLQSLHLNNNSLIGPIPSELGNLAQLQSLHLN  486

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L   IP  +   KQL  + L  N
Sbjct  487  NNNLIGEIPSSLKNCKQLVVVDLGDN  512


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 0/97 (0%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W G   + Q    +V  +++    +    P  +TNL  L  L++  N L G IP  IG L
Sbjct  604  WKGREAAFQKTLSLVVGIDLSGNYLRHAIPTELTNLSGLVFLNLSRNLLDGSIPEMIGNL  663

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            K L+I ++  N L   IPP I  L  L  L LS N+ 
Sbjct  664  KNLEIFDLSMNYLSGAIPPSITSLTFLDSLNLSNNHL  700


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/84 (30%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T+L++ A  + G  P+ ++ L +L  LD+ +N     IPP+IG+L  +  L +  N L 
Sbjct  96   LTKLDLNANLLNGSIPSNISALSNLASLDLSSNSFVESIPPEIGQLSEMLDLRLYHNNLA  155

Query  296  DVIPPEIGELKQLTHLYLSFNNFK  367
              IP ++  L+ + H  L  N+ +
Sbjct  156  GPIPYQLSNLRNVRHFDLGSNHLE  179



>gb|KCW71354.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1027

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            +ND  P+    CS      + T+L+VYA+S+ GP P+ + NL  L+ LD+  N LTG + 
Sbjct  75   NNDYNPFIKCDCSFNSTCHI-TQLKVYALSVAGPIPDELWNLTYLSNLDLRQNLLTGSLS  133

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            P IG L R++ L++  N L   +P ++G+L +L  L  S NNF
Sbjct  134  PSIGNLTRMQYLSLGINALSGELPLQLGQLTELLSLSFSTNNF  176



>gb|KCW71353.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1010

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            +ND  P+    CS      + T+L+VYA+S+ GP P+ + NL  L+ LD+  N LTG + 
Sbjct  75   NNDYNPFIKCDCSFNSTCHI-TQLKVYALSVAGPIPDELWNLTYLSNLDLRQNLLTGSLS  133

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            P IG L R++ L++  N L   +P ++G+L +L  L  S NNF
Sbjct  134  PSIGNLTRMQYLSLGINALSGELPLQLGQLTELLSLSFSTNNF  176



>ref|XP_006428847.1| hypothetical protein CICLE_v10013366mg [Citrus clementina]
 gb|ESR42087.1| hypothetical protein CICLE_v10013366mg [Citrus clementina]
Length=288

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 4/113 (4%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLL-DLTRLDIH  208
            W    P   +D   W G+TC  +G    +T +E+   SI G   +   +   +L  L++ 
Sbjct  53   WKDRIPHNTSDHCNWVGITCDYKGS---ITHIELVECSIKGELGSLNFSCFPNLQYLNLW  109

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            NN L+G IPPQIG L  LK LN+RWN L   IP EIG  + L  LYL  N   
Sbjct  110  NNNLSGSIPPQIGSLSNLKYLNLRWNNLTGTIPTEIGIFRNLEELYLPSNKLN  162



>emb|CAN66410.1| hypothetical protein VITISV_020977 [Vitis vinifera]
Length=636

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = +2

Query  20   VVYAW--VGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLT  193
            V+  W  V  DPC       W+G+TCS   D+  V ++ ++  +++G  P  + +L +L 
Sbjct  46   VLSTWNTVDSDPCD------WSGITCSEARDH--VIKIILHGNNLIGVIPKEIGSLKNLK  97

Query  194  RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             LD+  N+LTGPIPP+IG L  +  +N+  N L   +PPE+G L+ L  L L  N  +
Sbjct  98   VLDLGMNQLTGPIPPEIGNLTSIVKINLESNGLSGRLPPELGNLRHLEELRLDRNRLE  155



>ref|NP_001242669.1| probable leucine-rich repeat receptor-like protein kinase At5g49770-like 
precursor [Glycine max]
 gb|ACM89577.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=723

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            WVG DPCG      W G+ CS       +T+L +  +++ G   +A+ +L +L  LD+ +
Sbjct  46   WVGPDPCGSG----WDGIRCSNSK----ITQLRLPGLNLAGQLSSAIQSLSELDTLDLSY  97

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTG IP +IG LK+LK L++        IP  IG LKQLT L L+ N F
Sbjct  98   NTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFLALNSNRF  149



>emb|CDP15606.1| unnamed protein product [Coffea canephora]
Length=949

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-  217
            DDPCG     PW GV+C+   +Y  VTEL + A+ + G     +  L +LT +D+  N+ 
Sbjct  50   DDPCGF----PWEGVSCN---NYSRVTELLLSAMGLSGILSGDIGGLTELTSMDLSFNRG  102

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGP+ P+IG L+ L IL +        IP E+G L QL+ L L+ NNF
Sbjct  103  LTGPLSPRIGDLQNLSILILTGCSFNGNIPSELGNLAQLSFLALNLNNF  151



>ref|XP_010482269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=955

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            W G DPCG N    W G+TCS     R+V+ + +  V + G     +  L +L  LD+ +
Sbjct  51   WEGSDPCGTN----WVGITCSND---RIVS-ISLGNVDLEGKLSADIAALSELQILDLTS  102

Query  212  N-KLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTGP+PP IG LK+L ILN+        IP  IG L+QLT L L+ N F
Sbjct  103  NPNLTGPLPPNIGNLKKLVILNLMGCGFSGQIPESIGSLEQLTTLSLNSNKF  154



>ref|XP_003541454.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=931

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            WVG DPCG      W G+ CS       +T+L +  +++ G   +A+ +L +L  LD+ +
Sbjct  46   WVGPDPCGSG----WDGIRCSNSR----ITQLRLPGLNLGGQLSSAIQSLSELDTLDLSY  97

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTG +P +IG LK+LK L++        IP  IG LKQLT L L+ NNF
Sbjct  98   NTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFLALNSNNF  149



>gb|KHN48167.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=931

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            WVG DPCG      W G+ CS       +T+L +  +++ G   +A+ +L +L  LD+ +
Sbjct  46   WVGPDPCGSG----WDGIRCSNSR----ITQLRLPGLNLGGQLSSAIQSLSELDTLDLSY  97

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTG +P +IG LK+LK L++        IP  IG LKQLT L L+ NNF
Sbjct  98   NTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFLALNSNNF  149



>gb|KFK43514.1| hypothetical protein AALP_AA1G135400 [Arabis alpina]
Length=880

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +2

Query  110  RVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK  289
            RV+ EL+V    + G  P  + NL +L  LD+H N+L+G IPP++G L R++ L++  N 
Sbjct  377  RVLLELDVSGNDLEGEIPKKLVNLTNLEILDLHRNRLSGSIPPELGNLSRIQFLDLSQNS  436

Query  290  LQDVIPPEIGELKQLTHLYLSFNNF  364
            L   IP  +G L  LTH  +S+NN 
Sbjct  437  LSGPIPSSLGNLNTLTHFNVSYNNL  461


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +  L ++ ++++G  P  ++N   L  LD+  N L G IP ++  L  L+IL++ 
Sbjct  350  GNLVFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGEIPKKLVNLTNLEILDLH  409

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPE+G L ++  L LS N+ 
Sbjct  410  RNRLSGSIPPELGNLSRIQFLDLSQNSL  437


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L+  +  + G  P  VT    L  LD+ +NKL G IP  IG+++ L ++ +  N L+  I
Sbjct  286  LDASSNELTGRIPTGVTGCKSLKLLDLESNKLIGSIPGVIGKMESLSVIRLGGNLLEGEI  345

Query  305  PPEIGELKQLTHLYL  349
            P EIG L  L  L L
Sbjct  346  PREIGNLVFLQVLNL  360



>ref|XP_002526114.1| receptor-kinase, putative [Ricinus communis]
 gb|EEF36308.1| receptor-kinase, putative [Ricinus communis]
Length=1033

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GVTC  +  ++ V +LE+Y++ + G  P+ + NL  L  LD+HNN L+G IP +IG L
Sbjct  66   WRGVTCGNR--HQRVVKLELYSLKLSGSLPHHIGNLSFLRVLDLHNNSLSGEIPSEIGYL  123

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +RL++LN+R N +   IP  I     L H  +  N
Sbjct  124  RRLQVLNLRNNSIVGKIPANISSCSSLLHFNVGGN  158


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query  119  TELEVYAVS---IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK  289
            T L + ++S   I G  P  + NL+ L   D+ NN+ +G +PP I +L++LK+L ++ NK
Sbjct  372  TRLRLLSMSDNMISGSMPAEIGNLVSLDVFDMGNNQFSGSLPPSITKLQQLKVLYLQANK  431

Query  290  LQDVIPPEIGELKQLTHLYLSFNNFK  367
                IP  +G L  LT L L+ N+F+
Sbjct  432  FSGEIPHYLGNLTLLTELMLNDNSFR  457


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P++  NL  L  L IH NK+ G IP ++GRL  +    +  N     IPP I  
Sbjct  183  TLTGSIPSSFGNLSSLQVLAIHVNKMNGNIPDELGRLTNVLDFIVHTNNFSGAIPPPIFN  242

Query  323  LKQLTHLYLSFNNFK  367
            L  L  + LS NNF+
Sbjct  243  LSSLVRMDLSVNNFR  257


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 37/73 (51%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            ++G  P+A+  L  L    +  N LTG IP   G L  L++L I  NK+   IP E+G L
Sbjct  160  LMGDIPSALGKLSKLVFFGVDRNTLTGSIPSSFGNLSSLQVLAIHVNKMNGNIPDELGRL  219

Query  326  KQLTHLYLSFNNF  364
              +    +  NNF
Sbjct  220  TNVLDFIVHTNNF  232


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/72 (32%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P+++ + + L RL++ +N   G IP  +  L+ L+++++  N L   IP  +G    
Sbjct  531  GEIPSSLGSCIRLERLNMRDNSFKGSIPSSLSALRGLQVVDLSHNNLSGQIPEFLGSFPF  590

Query  332  LTHLYLSFNNFK  367
            L  L LSFN+F+
Sbjct  591  LQSLNLSFNDFE  602



>emb|CDY68959.1| BnaCnng61190D, partial [Brassica napus]
Length=359

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +WVG DPCG N    W G+TC+     RVV+ + +  + + G   + + +L +L  LD+ 
Sbjct  62   SWVGADPCGTN----WVGITCTND---RVVS-ISLGNLDVEGKLSSDIASLTELQILDLS  113

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +N  LTGP+P  IG+LK+LK L +        IP  IG+L+QL +L L+ N F 
Sbjct  114  YNTGLTGPLPSNIGQLKKLKNLILVACSFSGQIPESIGDLEQLIYLSLNLNQFS  167



>ref|XP_006480685.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Citrus sinensis]
Length=545

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 60/119 (50%), Gaps = 18/119 (15%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGP--------FPNAVTNLLD  187
            W    P   +D   W G+TC+ +G    +T +++    I G         FPN       
Sbjct  53   WKDRIPHNTSDHCNWVGITCNYEGS---ITHIDLEDSKIKGELGRLNFSCFPN-------  102

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  L++ NN L+G IPPQIG L  LK LN+RWN L   IP EIG L+ L   YLS NN 
Sbjct  103  LQYLNLGNNNLSGSIPPQIGSLSNLKYLNLRWNNLTGTIPKEIGSLRNLEVFYLSNNNL  161


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P  + NL  L  L + +N L GPIP  + RL  +K L + +N+    IP EIG L
Sbjct  209  LSGALPQEIGNLKSLIWLSVTSNTLGGPIPSTLFRLTNIKYLGLGFNRFNGSIPREIGNL  268

Query  326  KQLTHLYLSFN  358
            K LT+L +  N
Sbjct  269  KNLTNLAIMAN  279


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVS---IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQI  244
            W  +T +   +   +  LEV+ +S   + G  P  + +L +L  L + +N L G IP +I
Sbjct  134  WNNLTGTIPKEIGSLRNLEVFYLSNNNLNGTIPKEIGSLRNLEVLYLSSNNLNGTIPTEI  193

Query  245  GRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
              L+ L++L +R NKL   +P EIG LK L  L ++ N
Sbjct  194  WSLRNLEVLYLRNNKLSGALPQEIGNLKSLIWLSVTSN  231


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G++  + EL++    I G  P+ +T L +L  L+I +N L+G IP  IG+L  L  L++ 
Sbjct  314  GNFSALEELDLSDNKIRGIIPDELTKLANLQYLNISSNLLSGQIPFAIGKLFNLVSLDLS  373

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP  I    +L +L L+ N+ 
Sbjct  374  KNKLSGSIPTGIDNCSKLKNLTLNQNSL  401


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L + +  + G  P A+  L +L  LD+  NKL+G IP  I    +LK L +  N L   I
Sbjct  346  LNISSNLLSGQIPFAIGKLFNLVSLDLSKNKLSGSIPTGIDNCSKLKNLTLNQNSLDGTI  405

Query  305  PPEIGELKQLTHLYLSFNNFK  367
            P E+G++  L    LS NN  
Sbjct  406  PLEMGKILFLEKFDLSHNNLS  426


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R +  L + + ++ G  P  + +L +L  L + NNKL+G +P +IG LK L  L++ 
Sbjct  170  GSLRNLEVLYLSSNNLNGTIPTEIWSLRNLEVLYLRNNKLSGALPQEIGNLKSLIWLSVT  229

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IP  +  L  + +L L FN F
Sbjct  230  SNTLGGPIPSTLFRLTNIKYLGLGFNRF  257



>dbj|BAP56049.1| NHL repeat-containing protein [Thioploca ingrica]
Length=1632

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 3/107 (3%)
 Frame = +2

Query  47    PCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTG  226
             PCG N   PW G+ C    ++  VTE+ +    + GP P  + NL +L  L +  N+L+G
Sbjct  1212  PCG-NGRAPWYGIVC--DNNHGHVTEIFLSGNQLSGPIPPELGNLSELRILGLFENQLSG  1268

Query  227   PIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             PIPP++G L  L+ LN+  NKL   IP E+G L  L +L LS N   
Sbjct  1269  PIPPELGNLTHLESLNLFSNKLSGSIPSELGNLSHLENLGLSENQLS  1315


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  146   IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
             + GP P+ + NL  L  L + NN+L+G IPP++  L  L++L +  N+L  +IPP++G L
Sbjct  1314  LSGPIPSELGNLSYLYELYLSNNQLSGSIPPELSNLSHLEVLGLWSNQLSGLIPPKLGNL  1373

Query  326   KQLTHLYLSFN  358
               L +LYL  N
Sbjct  1374  SNLVYLYLDDN  1384


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  146   IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
             + G  P  + NL  L  L +  N+L+G IPP+ G L+ LK L +  N+L   IPP++G L
Sbjct  1386  LSGSIPPELGNLSHLQSLWLWKNQLSGSIPPEFGNLRNLKELVLFSNQLSGPIPPKLGNL  1445

Query  326   KQLTHLYLSFN  358
               L +L+L  N
Sbjct  1446  SNLVYLFLDDN  1456


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +2

Query  146   IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
             + G  P    NL +L  L + +N+L+GPIPP++G L  L  L +  N L  +IP E+  L
Sbjct  1410  LSGSIPPEFGNLRNLKELVLFSNQLSGPIPPKLGNLSNLVYLFLDDNLLSGLIPTELSNL  1469

Query  326   KQLTHLYLSFNNF  364
               L  L+LS N  
Sbjct  1470  SHLEDLWLSENQL  1482


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  92    STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
             S  G+   + EL +    + G  P  ++NL  L  L + +N+L+G IPP++G L  L  L
Sbjct  1320  SELGNLSYLYELYLSNNQLSGSIPPELSNLSHLEVLGLWSNQLSGLIPPKLGNLSNLVYL  1379

Query  272   NIRWNKLQDVIPPEIGELKQLTHLYL  349
              +  N L   IPPE+G L  L  L+L
Sbjct  1380  YLDDNLLSGSIPPELGNLSHLQSLWL  1405


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  125   LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
             L +++  + G  P  + NL +L  L + +N L+G IPP++G L  L+ L +  N+L   I
Sbjct  1355  LGLWSNQLSGLIPPKLGNLSNLVYLYLDDNLLSGSIPPELGNLSHLQSLWLWKNQLSGSI  1414

Query  305   PPEIGELKQLTHLYLSFNNFK  367
             PPE G L+ L  L L  N   
Sbjct  1415  PPEFGNLRNLKELVLFSNQLS  1435



>ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46953.1| ATP binding protein, putative [Ricinus communis]
Length=895

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  35   VGDDPCGDNDLPPWAG------VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            + +DPC  N    WA       V C   G    +T L++YA+ IVG  P+ +  L  L  
Sbjct  291  ITNDPCIQN--ATWANENANPRVACDCTGSICHITHLKIYALDIVGEIPSELFVLQKLMD  348

Query  197  LDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L++  N L G IPP+IG+L  ++ L++  N L   +PPE+G L +L  L  S NNF
Sbjct  349  LNLGQNVLNGSIPPEIGQLSNMQYLSLGINNLTGQVPPELGNLTKLLSLSFSSNNF  404



>ref|XP_006588460.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 gb|KHN32231.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=932

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            WVG DPCG      W G+ CS       +T+L +  +++ G   +A+ +L +L  LD+ +
Sbjct  46   WVGPDPCGSG----WDGIRCSNSK----ITQLRLPGLNLAGQLSSAIQSLSELDTLDLSY  97

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTG IP +IG LK+LK L++        IP  IG LKQLT L L+ N F
Sbjct  98   NTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFLALNSNRF  149



>gb|EMT06735.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1043

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 67/136 (49%), Gaps = 14/136 (10%)
 Frame = +2

Query  2    ASLGWRVVYAW-VGDDPCG---------DNDLPPWAGVTCS--TQGDYRV--VTELEVYA  139
            A LG +    W +  DPC          DN+    A + C   T G+  V  +T L++YA
Sbjct  67   AKLGQKAGPQWNISGDPCTGAAIDNTNIDNNDIFKAAIKCEVCTGGNTSVCRITRLKIYA  126

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            +  VGP P  + NL  LT LD+  N LTGP+P  IG L  +K +    N L   +P E+G
Sbjct  127  LDAVGPIPEELRNLTALTDLDLGQNYLTGPLPSFIGELTDMKFMTFGINALSGPVPKELG  186

Query  320  ELKQLTHLYLSFNNFK  367
             LK L  L L  NNF 
Sbjct  187  NLKNLIKLGLGGNNFS  202



>ref|XP_004292981.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Fragaria vesca subsp. vesca]
Length=935

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query  44   DPCGDNDLPPWAG------VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            DPC +N    WA       V C   G    +T L++YA+ IVG  P  +  L  L  L++
Sbjct  332  DPCTEN--ATWASETANPRVACDCTGSTCHITHLKIYALDIVGDLPGELFELKQLIDLNL  389

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              N L+G IPP+IG L  ++ L++  N L   +PPE+G+L +L  L  S N F
Sbjct  390  GQNVLSGRIPPEIGLLSNMQYLSLGINNLSGPVPPELGKLTKLVELSFSSNEF  442


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            NL  L+ L + + +++G IP QIG+  +L+ L++R+NKL   IP    +   L  LYL  
Sbjct  548  NLTSLSMLSLRSCQVSGKIPEQIGKFSKLQYLDLRFNKLIGSIPDSFQDFTVLQFLYLGN  607

Query  356  NNF  364
            N+ 
Sbjct  608  NDL  610



>emb|CDY61244.1| BnaCnng37500D [Brassica napus]
Length=953

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            WVG DPCG N    W G+TC+     RVV+ + +  + + G   + + +L +L  LD+ +
Sbjct  47   WVGADPCGTN----WVGITCTND---RVVS-ISLGNLDVEGKLSSDIASLTELQILDLSY  98

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N +LTGP+P  IG+LK+LK L +        IP  IG+L+QL +L L+ N F
Sbjct  99   NTELTGPLPSNIGQLKKLKNLILVACSFSGQIPESIGDLEQLIYLSLNLNQF  150



>emb|CAN79070.1| hypothetical protein VITISV_031965 [Vitis vinifera]
Length=661

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    +T L++    +  P P+ + +L  LT LD+  N+LTGPIP QIG L  L  LN+ 
Sbjct  116  GSLTKLTILDLSHNQLTDPIPHQIGSLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLNLS  175

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L DVIP  +G L +LTHL LSFN  
Sbjct  176  SNVLTDVIPSSLGRLTKLTHLDLSFNQL  203


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = +2

Query  83   VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRL  262
            V  S+ G    +T L++Y   ++G  P+ + +L  LT LD+ +N+LTGPI  QIG L  L
Sbjct  230  VIPSSLGRLTKLTHLDLYCNKLIGSIPHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIEL  289

Query  263  KILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              L    N+L  VIP  +G L +LTHL L +N  
Sbjct  290  TYLEFSGNELTGVIPSSLGRLTKLTHLGLFYNQL  323


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    +T L++ +  + GP  N +  L++LT L+   N+LTG IP  +GRL +L  L + 
Sbjct  260  GSLTKLTHLDLSSNQLTGPILNQIGTLIELTYLEFSGNELTGVIPSSLGRLTKLTHLGLF  319

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N+L   IP +IG L +LT+L++S N  
Sbjct  320  YNQLNGSIPHQIGTLTELTYLHISGNEL  347


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = +2

Query  83   VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRL  262
            V  S+ G    +T L++    + GP P+ +  L +LT L + +N LT  IP  +GRL +L
Sbjct  182  VIPSSLGRLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLPLSSNVLTDVIPSSLGRLTKL  241

Query  263  KILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              L++  NKL   IP +IG L +LTHL LS N  
Sbjct  242  THLDLYCNKLIGSIPHQIGSLTKLTHLDLSSNQL  275


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L + +  +    P+++  L  LT LD+  N+LTGPIP QIG L  L  L +  N L 
Sbjct  169  LTYLNLSSNVLTDVIPSSLGRLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLPLSSNVLT  228

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
            DVIP  +G L +LTHL L  N  
Sbjct  229  DVIPSSLGRLTKLTHLDLYCNKL  251


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    +T L++    + GP P+ +  L +LT L++ +N LT  IP  +GRL +L  L++ 
Sbjct  140  GSLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLNLSSNVLTDVIPSSLGRLTKLTHLDLS  199

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
            +N+L   IP +IG L +LT+L LS N
Sbjct  200  FNQLTGPIPHQIGTLTELTYLPLSSN  225


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 29/139 (21%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLPPWAGVTCSTQG--------DYRV----VTE----------  124
            GW     W+   P   N    W G+TC+           +Y+V    V+E          
Sbjct  45   GW-----WIWSHPATSNHCS-WLGITCNEAKHVTGIRLRNYQVPIGEVSELNLSLLPSLN  98

Query  125  -LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDV  301
             L +  + + G   + + +L  LT LD+ +N+LT PIP QIG L +L  L++ +N+L   
Sbjct  99   FLILSRMGLNGSISDQIGSLTKLTILDLSHNQLTDPIPHQIGSLTKLTHLDLSFNQLTGP  158

Query  302  IPPEIGELKQLTHLYLSFN  358
            IP +IG L +LT+L LS N
Sbjct  159  IPHQIGTLTELTYLNLSSN  177


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV  S+ G    +T L ++   + G  P+ +  L +LT L I  N+LTG +P  +G L +
Sbjct  301  GVIPSSLGRLTKLTHLGLFYNQLNGSIPHQIGTLTELTYLHISGNELTGAMPSSLGCLTK  360

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            L  L++  N++   IPPEIG +K L  L LS N
Sbjct  361  LISLDLCKNQINGSIPPEIGNIKSLVTLDLSDN  393


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +    + G  P+++  L  L  LD+  N++ G IPP+IG +K L  L++  N + 
Sbjct  337  LTYLHISGNELTGAMPSSLGCLTKLISLDLCKNQINGSIPPEIGNIKSLVTLDLSDNLIS  396

Query  296  DVIPPEIGELKQLTHLYLSFN  358
              IP  +  LK+L  L LS+N
Sbjct  397  GEIPSSLKNLKKLGRLDLSYN  417



>ref|XP_010064054.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1028

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRV-VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPI  232
            +N+  P+   +CS        +T+L+VYA+S+ GP P+ + NL  L  L +  N LTG +
Sbjct  72   NNNYNPFIKCSCSFNNSTTCHITQLKVYAMSVAGPIPDELWNLTYLFNLKLDQNLLTGSL  131

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P IG L R++ L +  N L   +PP++G+L +L  L  S NNF
Sbjct  132  SPSIGNLTRMQYLTVGINALSGELPPQLGQLTELLSLSFSTNNF  175



>ref|XP_004967218.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1136

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV CS +   RVV  L++ +  + G  P  + NL  LTR+   NN+LTGPIPP++G+L
Sbjct  67   WDGVRCSKRHTSRVVA-LDLESFELNGQIPTCIANLTFLTRIHFPNNQLTGPIPPELGQL  125

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             RL+ LN+  NKL  VIP  +    +L  + L  N+ +
Sbjct  126  NRLQYLNLSSNKLSGVIPDTLSSCSRLQIIDLGGNSLQ  163


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            +I G  P+ +  L ++T L +  N+ TG +P  +G L RL  L++  NKL   IP  IG 
Sbjct  501  NISGKIPSEIGYLTNVTLLYLDKNQFTGSLPDTLGNLSRLVGLSLSQNKLSGRIPVSIGT  560

Query  323  LKQLTHLYLSFNNF  364
            L QL  LYL  NNF
Sbjct  561  LSQLNELYLQENNF  574


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/72 (32%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P+++ NL  L RL +  N   G IP  IG++  L+ L++ +N L   +P  +  +  
Sbjct  308  GAIPSSLGNLSSLIRLMLAYNNFQGSIPASIGKIPNLQALDLTYNYLSGTVPTSLYNMSA  367

Query  332  LTHLYLSFNNFK  367
            LT+L +  NN +
Sbjct  368  LTYLGIGANNLQ  379



>ref|XP_009118911.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=940

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +WVG DPCG N    W G+TC+     RVV+ + +  + + G   + + +L +L  LD+ 
Sbjct  46   SWVGADPCGTN----WVGITCTND---RVVS-ISLGNLDVEGKLSSDIASLTELQILDLS  97

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N  LTGP+P  IG+LK+LK L +        IP  IG+L+QL +L L+ N F
Sbjct  98   YNTGLTGPLPSNIGQLKKLKNLILVACSFSGQIPESIGDLEQLIYLSLNLNQF  150



>dbj|BAF79953.1| receptor-like kinase [Marchantia polymorpha]
Length=632

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 4/116 (3%)
 Frame = +2

Query  20   VVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRL  199
            V+ +W+  DPC       W GV CST G  RV+T L++    + G     + +L+ LT L
Sbjct  72   VLSSWIIGDPCKGK----WKGVECSTIGKTRVITSLKLSNFGLDGTITPRLGDLITLTTL  127

Query  200  DIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             + +N L GPIP  +G+L+ L  L +  N L   IPP +  L  L  LYLS N+  
Sbjct  128  WLDSNSLRGPIPSDLGKLENLTSLRLANNSLNGSIPPSLTSLSNLRELYLSNNDLS  183



>gb|AFW76467.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1125

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV+CS     RV+  L++ +  I G  P  + NL  LTRL + NN   G IPP++G L
Sbjct  61   WHGVSCSEHSPRRVIA-LDLASEGITGTIPPCIANLTSLTRLQLANNSFRGSIPPELGLL  119

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             +L+ILN+  N L+  IP E+    QL  L L  N+ +
Sbjct  120  SQLRILNLSMNSLEGTIPSELSSCSQLQALGLWNNSLR  157


 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I GP P  + NL +L+ L + +N+ TG IP  IG LKRL +L+   N+L   IP  IG+L
Sbjct  498  ISGPIPPELGNLKNLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARNRLSGTIPDAIGDL  557

Query  326  KQLTHLYLSFNNF  364
             QLT L L  NN 
Sbjct  558  VQLTDLKLDANNL  570


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD-LTRLDIHNNKLTGPIPPQIGRLK  256
            G   S  G  R+ T L +   S  G  P+++ NL   L  L + +NK++GPIPP++G LK
Sbjct  452  GFVSSLSGCSRL-TRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLK  510

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
             L  L +  N+    IP  IG LK+L  L  + N
Sbjct  511  NLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARN  544


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR-LKILNIRWNKLQDVIPPEIGELKQL  334
            F ++++    LTRL +  N   G +P  IG L   L+IL +R NK+   IPPE+G LK L
Sbjct  453  FVSSLSGCSRLTRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLKNL  512

Query  335  THLYLSFNNF  364
            + LY+  N F
Sbjct  513  STLYMDHNRF  522


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 1/79 (1%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L ++  S+ G  P A+   + L  +D+ NN L G IP + G L  L+ L +  N+L   I
Sbjct  149  LGLWNNSLRGEVPPALGQCVQLEEIDLSNNDLEGSIPSRFGALPELRTLVLAGNRLSGAI  208

Query  305  PPEIGELK-QLTHLYLSFN  358
            PP +G     LTH+ L  N
Sbjct  209  PPSLGRSSLSLTHVDLGAN  227


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +  L      + G  P+A+ +L+ LT L +  N L+G IP  IGR  +L+ILN+ 
Sbjct  531  GNLKRLVVLSAARNRLSGTIPDAIGDLVQLTDLKLDANNLSGRIPASIGRCTQLQILNLA  590

Query  281  WNKLQDVIPPEIGEL  325
             N L   IP  I E+
Sbjct  591  RNALDGGIPRSILEI  605



>ref|XP_001773846.1| predicted protein [Physcomitrella patens]
 gb|EDQ61336.1| predicted protein [Physcomitrella patens]
Length=481

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 9/109 (8%)
 Frame = +2

Query  17   RVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            R+   W+G DPC       W GVTCS     + V EL + A  + GP   A+  L  L R
Sbjct  72   RLFPTWMGSDPCIQ-----WEGVTCSA----KQVVELNLSASGLTGPISPAIGQLTSLIR  122

Query  197  LDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHL  343
            LD+ NN +TGPIP ++  L+ L++LN   N L      EI +LK L  L
Sbjct  123  LDLSNNAITGPIPSELALLQNLQVLNFYRNPLNASFSMEILQLKNLIEL  171



>ref|XP_011091153.1| PREDICTED: polygalacturonase inhibitor-like [Sesamum indicum]
Length=329

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 3/105 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN-NKLTGPI  232
            D D   W  V C  + +   +  L ++A ++ G  P AV  L  L  L  H     TG I
Sbjct  53   DTDCCYWYVVECDRKTNR--INNLHLFAANVSGQIPEAVAELPYLESLTFHKITNFTGTI  110

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            PP + RL RLK+L I W  +   IP  +GELK LT L LSFNNF 
Sbjct  111  PPALARLTRLKMLTISWTNISGPIPSFLGELKNLTFLDLSFNNFS  155


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = +2

Query  116  VTELEVYAVS---IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
            +T L++  +S   I GP P+ +  L +LT LD+  N  +G IPP + +L+ L  L +  N
Sbjct  117  LTRLKMLTISWTNISGPIPSFLGELKNLTFLDLSFNNFSGSIPPSLAQLRNLGGLRLDRN  176

Query  287  KLQDVIPPEIGELK-QLTHLYLSFNNFK  367
            KL   IP   G+L   L +LYLS N   
Sbjct  177  KLTGSIPESFGDLTPSLQYLYLSHNQLS  204



>ref|XP_008650458.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Zea mays]
Length=1070

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV+CS     RV+  L++ +  I G  P  + NL  LTRL + NN   G IPP++G L
Sbjct  6    WHGVSCSEHSPRRVIA-LDLASEGITGTIPPCIANLTSLTRLQLANNSFRGSIPPELGLL  64

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             +L+ILN+  N L+  IP E+    QL  L L  N+ +
Sbjct  65   SQLRILNLSMNSLEGTIPSELSSCSQLQALGLWNNSLR  102


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I GP P  + NL +L+ L + +N+ TG IP  IG LKRL +L+   N+L   IP  IG+L
Sbjct  443  ISGPIPPELGNLKNLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARNRLSGTIPDAIGDL  502

Query  326  KQLTHLYLSFNNF  364
             QLT L L  NN 
Sbjct  503  VQLTDLKLDANNL  515


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD-LTRLDIHNNKLTGPIPPQIGRLK  256
            G   S  G  R+ T L +   S  G  P+++ NL   L  L + +NK++GPIPP++G LK
Sbjct  397  GFVSSLSGCSRL-TRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLK  455

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
             L  L +  N+    IP  IG LK+L  L  + N
Sbjct  456  NLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARN  489


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR-LKILNIRWNKLQDVIPPEIGELKQL  334
            F ++++    LTRL +  N   G +P  IG L   L+IL +R NK+   IPPE+G LK L
Sbjct  398  FVSSLSGCSRLTRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLKNL  457

Query  335  THLYLSFNNF  364
            + LY+  N F
Sbjct  458  STLYMDHNRF  467


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 1/79 (1%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L ++  S+ G  P A+   + L  +D+ NN L G IP + G L  L+ L +  N+L   I
Sbjct  94   LGLWNNSLRGEVPPALGQCVQLEEIDLSNNDLEGSIPSRFGALPELRTLVLAGNRLSGAI  153

Query  305  PPEIGELK-QLTHLYLSFN  358
            PP +G     LTH+ L  N
Sbjct  154  PPSLGRSSLSLTHVDLGAN  172


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +  L      + G  P+A+ +L+ LT L +  N L+G IP  IGR  +L+ILN+ 
Sbjct  476  GNLKRLVVLSAARNRLSGTIPDAIGDLVQLTDLKLDANNLSGRIPASIGRCTQLQILNLA  535

Query  281  WNKLQDVIPPEIGEL  325
             N L   IP  I E+
Sbjct  536  RNALDGGIPRSILEI  550



>ref|XP_006282275.1| hypothetical protein CARUB_v10028556mg, partial [Capsella rubella]
 gb|EOA15173.1| hypothetical protein CARUB_v10028556mg, partial [Capsella rubella]
Length=892

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIH  208
            +W G DPCG      W G+TC      RVV  + +  +++VG     ++ L +L +LD+ 
Sbjct  24   SWKGSDPCGTK----WVGITCINN---RVVN-ISLPNLNLVGKLSVGISALSELQKLDLT  75

Query  209  NN-KLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N  +TGP+PP IG LK+L IL++        IP  IG+L+QLT L L+ N F
Sbjct  76   SNLNMTGPLPPNIGNLKKLTILHLMGCGFTGQIPESIGDLEQLTRLSLNSNKF  128



>ref|XP_010064052.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=309

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRV-VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPI  232
            D D  P+    CS        +T+L+VYA+S+  P P+ + NL  L+ L++  N LTG +
Sbjct  74   DKDYNPFIKCDCSFNNSTTCHITQLKVYAMSVASPIPDELWNLTYLSNLNLAQNLLTGSL  133

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P IG L R++ L +  N L   +PP++G+L +L  L  S N F
Sbjct  134  SPSIGNLTRMQYLTVGINALSGELPPQLGQLTELLSLSFSTNKF  177



>ref|XP_010026004.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=657

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 67/134 (50%), Gaps = 28/134 (21%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQG-------------------DYRVVT---ELEVYAV  142
            +W GDDPC       W G+ C   G                   ++  ++    L + A 
Sbjct  91   SWRGDDPC------IWRGIGCDGSGIVSKLNLTNIGLRGSVRKLNFTALSNLISLHLSAN  144

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ GP P+++ NL  L+ L I NN L+G IPP+IG+L RL+I ++  N+L   IP EIG 
Sbjct  145  SLYGPIPSSIGNLSKLSALSIFNNLLSGTIPPEIGKLSRLRIFSLDRNRLCGTIPEEIGM  204

Query  323  LKQLTHLYLSFNNF  364
            L  L +L L  N+ 
Sbjct  205  LHSLLNLSLDDNHL  218


 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L++ + +I G  P  +  L  L  LD+H+NK++G IPP+IG L  L+ LN+  NK    I
Sbjct  427  LDLSSNNITGWLPREMRRLTSLLELDLHDNKISGNIPPEIGHLSTLEKLNLGRNKFNGSI  486

Query  305  PPEIGELKQLTHLYLSFNNFK  367
            PP++G+ + L +L LS N  +
Sbjct  487  PPQLGQCRSLWNLNLSNNEIR  507


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  ELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDV  301
            EL+++   I G  P  + +L  L +L++  NK  G IPPQ+G+ + L  LN+  N+++  
Sbjct  450  ELDLHDNKISGNIPPEIGHLSTLEKLNLGRNKFNGSIPPQLGQCRSLWNLNLSNNEIRAS  509

Query  302  IPPEIGELKQLTHLYLSFN  358
            IP EI  L+ L +L  S N
Sbjct  510  IPSEICNLQFLHYLDPSHN  528


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L + + +I G     + N+  L  LD+ +N +TG +P ++ RL  L  L++  NK+ 
Sbjct  400  LTCLRISSNNISGEIHPMIGNMAQLKVLDLSSNNITGWLPREMRRLTSLLELDLHDNKIS  459

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IPPEIG L  L  L L  N F
Sbjct  460  GNIPPEIGHLSTLEKLNLGRNKF  482


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 3/103 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            DN L    G   ++ G+   +T L +   ++VG  P  V  L  L  L +  N L G IP
Sbjct  215  DNHL---TGQIPTSMGNLSKLTYLALGQNNLVGSIPEEVGTLRHLKELRLSENSLDGLIP  271

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              IG+L  L +L++ +N L   IP E+  L+ L  + +  N  
Sbjct  272  RSIGKLVSLSVLSLHYNYLSGFIPDEMNNLRNLRVITMGENKL  314



>ref|XP_004976816.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Setaria italica]
Length=1014

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 68/132 (52%), Gaps = 13/132 (10%)
 Frame = +2

Query  8    LGWRVVYAW-VGDDPCG---------DNDLPPWAGVTCSTQGDYRVV---TELEVYAVSI  148
            LG     AW +  DPC          D+D+     + C   G    V   T+L++YA+++
Sbjct  49   LGQTASSAWNISGDPCTGAATDDTNIDSDMNFNPAIQCKCSGQNNTVCHITKLKMYALNL  108

Query  149  VGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
            VGP P  + NL  LT L++  N LTGP+P  +G L  L+ +++  N L   +P E+G+L 
Sbjct  109  VGPIPEELRNLTHLTNLNLMQNYLTGPVPSFLGELTALQYMSLAINALSGSVPKELGKLV  168

Query  329  QLTHLYLSFNNF  364
             L  L +S NN 
Sbjct  169  NLISLGISMNNL  180



>gb|EMS68409.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Triticum 
urartu]
Length=1035

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            WAGV+CS +   + VT L +    ++GP    V NL  L+ L++ N  LTGPIP ++GRL
Sbjct  62   WAGVSCSRR--RQRVTALSLPDTPLLGPLAPHVGNLSFLSVLNLRNTNLTGPIPSELGRL  119

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +RL+   +  N L + IP  +G L +L  LYL  N  
Sbjct  120  RRLRFFGLHQNSLSNAIPAALGNLTRLEFLYLHLNQL  156


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            ++G  P A+ NL  +T+L + N  LTG IPP++G ++ L  L++++N+L    P  +G L
Sbjct  328  LIGSIPAALGNLTKVTKLQLANGSLTGEIPPELGLMQELSYLDLQYNQLTGKFPASLGNL  387

Query  326  KQLTHLYLSFNNF  364
             +L++L    N+ 
Sbjct  388  SKLSYLNFQVNHL  400


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +2

Query  155  PFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQL  334
            P P ++T L +L  LD+  N + GPIP Q+G L+ L+ L ++ NKL   IP   G L  L
Sbjct  502  PIPESITTLENLAWLDLSWNNMPGPIPTQMGMLRSLERLFLQANKLSGSIPRNFGNLSWL  561

Query  335  THLYLSFNNF  364
              L LS+N  
Sbjct  562  ESLDLSYNQL  571


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +2

Query  137  AVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEI  316
            A  ++G  P A++N+ +L  +D  +N  T PIP  I  L+ L  L++ WN +   IP ++
Sbjct  472  ANQLIGGLPVAISNISNLLWIDFRDNLFTEPIPESITTLENLAWLDLSWNNMPGPIPTQM  531

Query  317  GELKQLTHLYLSFNNF  364
            G L+ L  L+L  N  
Sbjct  532  GMLRSLERLFLQANKL  547


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S  G  P  VT L    ++DI +N L G IP   G+L  L  LN+  N  +  IP ++ +
Sbjct  594  SFTGEVPVDVTGLRQTYQIDISSNLLIGSIPETFGQLSMLTYLNLSHNSFKGSIPVQLEK  653

Query  323  LKQLTHLYLSFNNF  364
            +K L  L LSFNN 
Sbjct  654  VKSLASLDLSFNNL  667


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            GP P  +  L  L RL +  NKL+G IP   G L  L+ L++ +N+L   IP     L +
Sbjct  525  GPIPTQMGMLRSLERLFLQANKLSGSIPRNFGNLSWLESLDLSYNQLSSTIPTSFFHLDK  584

Query  332  LTHLYLSFNNF  364
            L  L LS N+F
Sbjct  585  LITLDLSHNSF  595


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   VT+L++   S+ G  P  +  + +L+ LD+  N+LTG  P  +G L +L  LN +
Sbjct  337  GNLTKVTKLQLANGSLTGEIPPELGLMQELSYLDLQYNQLTGKFPASLGNLSKLSYLNFQ  396

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N L   +P  +G    L  L L  NN +
Sbjct  397  VNHLSGQVPSMLGTNTVLNILALGDNNLE  425


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            ++++  S V   P  +  L +L +L++  N L G IP  +G L ++  L +    L   I
Sbjct  297  IDLHENSFVDVLPTWLAKLTNLKKLNLGFNHLIGSIPAALGNLTKVTKLQLANGSLTGEI  356

Query  305  PPEIGELKQLTHLYLSFNNF  364
            PPE+G +++L++L L +N  
Sbjct  357  PPELGLMQELSYLDLQYNQL  376



>gb|KEH19860.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=216

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            WAGVTC  +  +  V  L +  +S+ G     + NL  L  LD+ NN   G  P ++ RL
Sbjct  64   WAGVTCDER--HGRVHSLILQNMSLRGTVSPNLGNLSFLVILDLKNNSFGGQFPTEVCRL  121

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +RLK+L+I +N+ +  IP  +G+L QL +LYL  NNF 
Sbjct  122  RRLKVLHISYNEFEGGIPASLGDLSQLQYLYLGANNFS  159



>emb|CDX83185.1| BnaA03g23210D [Brassica napus]
Length=247

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            W G DPCG +    W G+TCS   + RVV+ + +  +++ G     +  L +L  LD+ +
Sbjct  47   WEGADPCGTS----WVGITCS---NNRVVS-ISLGNLNVEGKLSGDIAALSELQILDLSY  98

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            N  LTGP+PP IG LK+LK L +        IP  IG+L+QL +L L+ N F 
Sbjct  99   NTGLTGPLPPNIGELKKLKNLILVGCSFTGQIPQSIGQLEQLIYLSLNLNQFS  151



>ref|XP_010064058.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=1029

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +2

Query  59   NDLPPWAGVTCSTQGDYRV-VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            +D  P+    CS        +T+L VYA+S+ GP P+ + NL  L+ L++  N LTG + 
Sbjct  74   DDYNPFIICDCSFSNSTTCHITQLRVYALSVAGPIPDELWNLTYLSNLNLAQNLLTGSLS  133

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            P IG L R++ L +  N L   +PP++G+L +L  L  S NNF
Sbjct  134  PSIGNLTRMQYLTVGINALSGELPPQLGQLTELLSLSFSTNNF  176



>gb|AHG54200.1| LRR receptor-like protein kinase 2 [Triticum aestivum]
Length=1014

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 66/134 (49%), Gaps = 13/134 (10%)
 Frame = +2

Query  2    ASLGWRVVYAW-VGDDPCG---------DNDLPPWAGVTCSTQGDYRVV---TELEVYAV  142
            A LG + + +W +  D C          DN+ P    + C   G    V   T L++YA+
Sbjct  40   AKLGQKALSSWNISGDLCTGAATDNTNIDNNPPFNPAIKCECSGGNASVCRVTRLKIYAL  99

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
              VGP P  + NL  LT LD+  N LTGP+P  IG L R++ ++   N L   +P E+  
Sbjct  100  DAVGPIPEELRNLTALTNLDLSQNYLTGPLPSFIGELTRMQYMSFGINALSGPLPKELRN  159

Query  323  LKQLTHLYLSFNNF  364
            L  L  L +S NNF
Sbjct  160  LTDLVSLSVSSNNF  173



>ref|XP_008680604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Zea mays]
 gb|AFW63780.1| hypothetical protein ZEAMMB73_907440 [Zea mays]
Length=767

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV+CS     RV+  L++ +  I G  P  + NL  LTRL + NN   G IPP++G L
Sbjct  61   WHGVSCSEHSPRRVIA-LDLASEGITGTIPPCIANLTSLTRLQLANNSFRGSIPPELGLL  119

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             +L+ILN+  N L+  IP E+    QL  L L  N+ +
Sbjct  120  SQLRILNLSMNSLEGTIPSELSSCSQLQALGLWNNSLR  157


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I GP P  + NL +L+ L + +N+ TG IP  IG LKRL +L+   N+L   IP  IG+L
Sbjct  498  ISGPIPPELGNLKNLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARNRLSGTIPDAIGDL  557

Query  326  KQLTHLYLSFNNF  364
             QLT L L  NN 
Sbjct  558  VQLTDLKLDANNL  570


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD-LTRLDIHNNKLTGPIPPQIGRLK  256
            G   S  G  R+ T L +   S  G  P+++ NL   L  L + +NK++GPIPP++G LK
Sbjct  452  GFVSSLSGCSRL-TRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLK  510

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
             L  L +  N+    IP  IG LK+L  L  + N
Sbjct  511  NLSTLYMDHNRFTGSIPAAIGNLKRLVVLSAARN  544


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR-LKILNIRWNKLQDVIPPEIGELKQL  334
            F ++++    LTRL +  N   G +P  IG L   L+IL +R NK+   IPPE+G LK L
Sbjct  453  FVSSLSGCSRLTRLYLAGNSFRGELPSSIGNLSSSLEILWLRDNKISGPIPPELGNLKNL  512

Query  335  THLYLSFNNF  364
            + LY+  N F
Sbjct  513  STLYMDHNRF  522


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 1/79 (1%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L ++  S+ G  P A+   + L  +D+ NN L G IP + G L  L+ L +  N+L   I
Sbjct  149  LGLWNNSLRGEVPPALGQCVQLEEIDLSNNDLEGSIPSRFGALPELRTLVLAGNRLSGAI  208

Query  305  PPEIGELK-QLTHLYLSFN  358
            PP +G     LTH+ L  N
Sbjct  209  PPSLGRSSLSLTHVDLGAN  227


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +  L      + G  P+A+ +L+ LT L +  N L+G IP  IGR  +L+ILN+ 
Sbjct  531  GNLKRLVVLSAARNRLSGTIPDAIGDLVQLTDLKLDANNLSGRIPASIGRCTQLQILNLA  590

Query  281  WNKLQDVIPPEIGEL  325
             N L   IP  I E+
Sbjct  591  RNALDGGIPRSILEI  605



>gb|EEC80874.1| hypothetical protein OsI_23501 [Oryza sativa Indica Group]
Length=975

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W G+TCS+Q   RV+  L++ +  I G  P  + NL  LT L + NN   G IPP++G L
Sbjct  67   WQGITCSSQSPRRVIA-LDLSSEGITGSIPPCIANLTFLTMLQLSNNSFHGSIPPELGLL  125

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             +L  LN+  N L+  IP E+    QL  L LS NN +
Sbjct  126  NQLSYLNLSTNSLEGNIPSELSSCSQLKILDLSNNNLQ  163


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            +I G  P  + NL  LT+L +  N LTG IPP IG L  L  +N   N L  VIP  IG 
Sbjct  477  NISGSIPPEIGNLKGLTKLYMDYNLLTGNIPPTIGNLHNLVDINFTQNYLSGVIPDAIGN  536

Query  323  LKQLTHLYLSFNNF  364
            L QLT+L L  NNF
Sbjct  537  LLQLTNLRLDRNNF  550


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +2

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR-LKILNIRWNKLQDVIPPEIGELKQL  334
            F +++TN   LTRL +  N + G +P  IG L   L+ L +  N +   IPPEIG LK L
Sbjct  433  FVSSLTNCSRLTRLMLDGNNIQGNLPSTIGNLSSDLQWLWLGGNNISGSIPPEIGNLKGL  492

Query  335  THLYLSFN  358
            T LY+ +N
Sbjct  493  TKLYMDYN  500


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 13/103 (13%)
 Frame = +2

Query  62   DLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ  241
            ++PP       T G+   + ++      + G  P+A+ NLL LT L +  N  +G IP  
Sbjct  505  NIPP-------TIGNLHNLVDINFTQNYLSGVIPDAIGNLLQLTNLRLDRNNFSGSIPAS  557

Query  242  IGRLKRLKILNIRWNKLQDVIPPEIGELK------QLTHLYLS  352
            IG+  +L  LN+ +N L   IP +I ++        L+H YLS
Sbjct  558  IGQCTQLTTLNLAYNSLNGSIPSKIFQIYPLSVVLDLSHNYLS  600


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +T+L +    + G  P  + NL +L  ++   N L+G IP  IG L +L  L + 
Sbjct  487  GNLKGLTKLYMDYNLLTGNIPPTIGNLHNLVDINFTQNYLSGVIPDAIGNLLQLTNLRLD  546

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N     IP  IG+  QLT L L++N+ 
Sbjct  547  RNNFSGSIPASIGQCTQLTTLNLAYNSL  574


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLL-DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKL  292
            +T L +   +I G  P+ + NL  DL  L +  N ++G IPP+IG LK L  L + +N L
Sbjct  443  LTRLMLDGNNIQGNLPSTIGNLSSDLQWLWLGGNNISGSIPPEIGNLKGLTKLYMDYNLL  502

Query  293  QDVIPPEIGELKQLTHLYLSFN  358
               IPP IG L  L  +  + N
Sbjct  503  TGNIPPTIGNLHNLVDINFTQN  524



>emb|CDP20793.1| unnamed protein product [Coffea canephora]
Length=726

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R + +L ++A +I GP P+++ N+ +LT L +  N L+GPIP +IG L  L  +N++
Sbjct  125  GQLRSLMQLSLHANNIHGPVPSSLGNMKNLTFLSLGYNMLSGPIPTEIGNLSNLAYINMQ  184

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPPEIG LK L  L LS NN 
Sbjct  185  SNYLTGPIPPEIGNLKALESLSLSENNL  212


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G   S+ G+ + +T L +    + GP P  + NL +L  +++ +N LTGPIPP+IG LK 
Sbjct  142  GPVPSSLGNMKNLTFLSLGYNMLSGPIPTEIGNLSNLAYINMQSNYLTGPIPPEIGNLKA  201

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L+ L++  N L   IP  +G    L  L L  N F
Sbjct  202  LESLSLSENNLTGSIPKSLGSTTNLALLSLDRNQF  236


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  V  L  L +L +H N + GP+P  +G +K L  L++ +N L   IP EIG L  
Sbjct  118  GSIPMEVGQLRSLMQLSLHANNIHGPVPSSLGNMKNLTFLSLGYNMLSGPIPTEIGNLSN  177

Query  332  LTHLYLSFN  358
            L ++ +  N
Sbjct  178  LAYINMQSN  186


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ + +  L +   ++ G  P ++ +  +L  L +  N+ +G IP  +G L +L+IL ++
Sbjct  197  GNLKALESLSLSENNLTGSIPKSLGSTTNLALLSLDRNQFSGSIPASLGNLSKLEILELQ  256

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NK+   I  E+G++ +L  L +  N  
Sbjct  257  DNKISGAILEELGQIPELVMLEMGENQL  284


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 0/71 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + GP P  + NL  L  L +  N LTG IP  +G    L +L++  N+    IP  +G L
Sbjct  188  LTGPIPPEIGNLKALESLSLSENNLTGSIPKSLGSTTNLALLSLDRNQFSGSIPASLGNL  247

Query  326  KQLTHLYLSFN  358
             +L  L L  N
Sbjct  248  SKLEILELQDN  258



>gb|KEH19878.1| LRR receptor-like kinase, partial [Medicago truncatula]
Length=214

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  26   YAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            Y  + ++    + +  W GVTC  +  +  V  L +  +S+ G     + N+  L  LD+
Sbjct  28   YDMLANNWSTSSSVCSWVGVTCDER--HGRVYSLILRNMSLRGTVSPNLGNMSFLVILDL  85

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             NN   G  P ++ RL+RLK+LN+R+NK +  I   +G L QL +LYL  NNF 
Sbjct  86   KNNSFGGQFPQELCRLRRLKVLNVRYNKFEGGISEALGNLSQLQYLYLGANNFS  139



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPCG      W  +TCS  G    V+ L + + S+ G     + NL +L  + + NN L+
Sbjct  60   DPCG------WRMITCSPDG---YVSSLGLASQSLSGTLSPGIGNLSNLKSVSLQNNALS  110

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            GPIP +IG+L++L+ L++  NK   VIP  +G+LK L +L L  N+ 
Sbjct  111  GPIPAEIGKLEKLEQLDLSNNKFSGVIPSSLGDLKNLNYLRLGNNSL  157



>ref|XP_010905353.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1100

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            WAGV+CS +   RVV  L + ++S+ G    ++ NL  L RL +  NKL G IP  IGRL
Sbjct  70   WAGVSCSPRHQERVVA-LVLESMSLGGSISPSIGNLTYLARLHLPGNKLRGVIPSDIGRL  128

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            + LK LN+ +N L   IPP +G L  L  L LS N  
Sbjct  129  RHLKDLNLSFNSLAGAIPPSLGNLSSLQRLDLSSNKL  165


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +  L++   S++GP P  +T LL+L+ LD+ +N L G IPP +GR++ L +L + 
Sbjct  174  GNLSSLAYLDLSNNSLIGPIPPKITKLLNLSYLDLSSNGLAGGIPPLLGRIEALSVLALA  233

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L  +IPP +G L  LT+L LS N+ 
Sbjct  234  SNSLTGIIPPSVGALSSLTYLDLSRNSL  261


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV  S  G  R + +L +   S+ G  P ++ NL  L RLD+ +NKLTG +PP IG L  
Sbjct  119  GVIPSDIGRLRHLKDLNLSFNSLAGAIPPSLGNLSSLQRLDLSSNKLTGEMPPSIGNLSS  178

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            L  L++  N L   IPP+I +L  L++L LS N
Sbjct  179  LAYLDLSNNSLIGPIPPKITKLLNLSYLDLSSN  211


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            AG    + G+   +  L++ +  + G  P ++ NL  L  LD+ NN L GPIPP+I +L 
Sbjct  142  AGAIPPSLGNLSSLQRLDLSSNKLTGEMPPSIGNLSSLAYLDLSNNSLIGPIPPKITKLL  201

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L++  N L   IPP +G ++ L+ L L+ N+ 
Sbjct  202  NLSYLDLSSNGLAGGIPPLLGRIEALSVLALASNSL  237


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    ++ L + + S+ G  P +V  L  LT LD+  N L G +PP    L  L +L++ 
Sbjct  222  GRIEALSVLALASNSLTGIIPPSVGALSSLTYLDLSRNSLDGELPPSFTNLSHLVVLDLS  281

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N LQ  +P ++G L  L    +S N
Sbjct  282  ANNLQGHLPEDLGRLTSLQFFQISVN  307


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 7/93 (8%)
 Frame = +2

Query  65   LPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQI  244
            +PP  G   S       +T L++   S+ G  P + TNL  L  LD+  N L G +P  +
Sbjct  241  IPPSVGALSS-------LTYLDLSRNSLDGELPPSFTNLSHLVVLDLSANNLQGHLPEDL  293

Query  245  GRLKRLKILNIRWNKLQDVIPPEIGELKQLTHL  343
            GRL  L+   I  NK+   IP  I  +  L  L
Sbjct  294  GRLTSLQFFQISVNKISGTIPLSIYNISSLQTL  326



>ref|XP_006436572.1| hypothetical protein CICLE_v10033583mg, partial [Citrus clementina]
 gb|ESR49812.1| hypothetical protein CICLE_v10033583mg, partial [Citrus clementina]
Length=494

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  95   TQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILN  274
            T G    +T+LE+    +VGP P+++ +L  LT L+++NNKL GPIPP++    +L+IL 
Sbjct  102  TLGHLNRLTDLELSENKLVGPIPSSLGHLTQLTTLNMYNNKLDGPIPPELMNCSKLRILI  161

Query  275  IRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            +  N L   IP EIG+L++L +L LS N
Sbjct  162  LGNNLLSGSIPSEIGKLQELNYLDLSHN  189


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +2

Query  95   TQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILN  274
            T G  + +  L++    +VGP P++V +L  LT   +H+N + G IP +IG L  L++L+
Sbjct  6    TLGHLKRLRSLDLSQNKLVGPIPSSVGHLTQLTTFYMHSNLINGSIPLEIGNLNFLQVLD  65

Query  275  IRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +  NKL+  IP  I  L  LT L L +NN 
Sbjct  66   LSDNKLEGPIPSTIAGLVNLTSLSLEYNNL  95


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +  L++    + GP P+ +  L++LT L +  N LTG IP  +G L RL  L + 
Sbjct  56   GNLNFLQVLDLSDNKLEGPIPSTIAGLVNLTSLSLEYNNLTGSIPLTLGHLNRLTDLELS  115

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNN  361
             NKL   IP  +G L QLT L + +NN
Sbjct  116  ENKLVGPIPSSLGHLTQLTTLNM-YNN  141


 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            S+ G    +T   +++  I G  P  + NL  L  LD+ +NKL GPIP  I  L  L  L
Sbjct  29   SSVGHLTQLTTFYMHSNLINGSIPLEIGNLNFLQVLDLSDNKLEGPIPSTIAGLVNLTSL  88

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            ++ +N L   IP  +G L +LT L LS N  
Sbjct  89   SLEYNNLTGSIPLTLGHLNRLTDLELSENKL  119


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +   ++ G  P  + +L  LT L++  NKL GPIP  +G L +L  LN+  NKL 
Sbjct  85   LTSLSLEYNNLTGSIPLTLGHLNRLTDLELSENKLVGPIPSSLGHLTQLTTLNMYNNKLD  144

Query  296  DVIPPEIGELKQLTHLYLSFN  358
              IPPE+    +L  L L  N
Sbjct  145  GPIPPELMNCSKLRILILGNN  165



>ref|XP_010100747.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB84050.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=599

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPC       W  V CS +G    V  LE+ +V + G    ++ NL  L  + + NN++T
Sbjct  66   DPC------TWNMVACSLEG---FVISLEMTSVGLSGTLSPSIGNLTHLRTMLLQNNQIT  116

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            GPIP +IG+L  L  L++  N+    IP  +G L  L++L LSFNN 
Sbjct  117  GPIPSEIGKLSELHTLDLSGNQFDGEIPSSLGLLTHLSYLDLSFNNL  163



>ref|XP_009417199.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=1228

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = +2

Query  53   GDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPI  232
            GDN  P  +G    + GD R +T L +   ++ GP P+ +  L  L  L +  N+L GPI
Sbjct  154  GDN--PGLSGPIPGSFGDLRNLTTLALALCNLSGPIPSRLGRLTQLHNLVLQQNQLDGPI  211

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            PP++G L +L+ILN+  N L   IP ++GEL QLT+L L  N  +
Sbjct  212  PPELGNLDKLQILNLADNLLGGEIPSQLGELSQLTYLNLMSNQLE  256


 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L +Y   + G  P A+ N   L  +D + N+ +G IP  IGRL++L  +++R N L   I
Sbjct  417  LYLYENQLSGEIPPAIGNCSSLQMIDFYGNQFSGSIPASIGRLEQLSFVHLRQNDLSGEI  476

Query  305  PPEIGELKQLTHLYLSFN  358
            P  +G  +QLT L L+ N
Sbjct  477  PASLGRCRQLTILDLADN  494


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV  +  G    + EL++ +    GP P  + N   L +L + +N L G +P ++G+L  
Sbjct  641  GVIPTWVGSLPQLGELKLSSNRFFGPLPIELFNCSKLLKLSLDDNSLNGSLPSEVGKLAS  700

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L +L+   N+L   IP  IG L +L  L LS N F
Sbjct  701  LNVLDFARNQLSGGIPASIGRLSKLYDLRLSHNLF  735


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P+   NL +L  L +++N+L G +P +IG+L++L+IL +  N+L   IPP IG    
Sbjct  378  GSIPSEFGNLSNLQTLALYHNELRGGLPEEIGKLQQLQILYLYENQLSGEIPPAIGNCSS  437

Query  332  LTHLYLSFNNF  364
            L  +    N F
Sbjct  438  LQMIDFYGNQF  448


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 55/114 (48%), Gaps = 7/114 (6%)
 Frame = +2

Query  17   RVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            RV+  W  D+P    D   W GVTC        V  L + + S+ G    ++  L  L  
Sbjct  50   RVLDDWSSDNP----DHCSWTGVTCDLDSG---VVALNLSSSSLAGSLSPSLGRLSRLAT  102

Query  197  LDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            LD+ +N+LTG IP Q+ RL  L  L +  N+L   +PP +G L  L  + L  N
Sbjct  103  LDLSSNRLTGTIPSQLARLSALTTLFLYSNRLSGTMPPSLGSLSGLRVVRLGDN  156


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ G  P+ V  L  L  LD   N+L+G IP  IGRL +L  L +  N     I  E+G+
Sbjct  686  SLNGSLPSEVGKLASLNVLDFARNQLSGGIPASIGRLSKLYDLRLSHNLFSGPILMELGQ  745

Query  323  LKQL-THLYLSFNNF  364
            L++L + L LSFN+ 
Sbjct  746  LQELQSALDLSFNDL  760



>gb|KCW45345.1| hypothetical protein EUGRSUZ_L00983 [Eucalyptus grandis]
Length=690

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 13/125 (10%)
 Frame = +2

Query  29   AWVGDDPC-----GD----NDLPPW----AGVTCSTQGDYRVVTELEVYAVSIVGPFPNA  169
            +W G+D C     G+      L  W    +G   S  G    +T L++    +VGP P++
Sbjct  81   SWRGNDSCNFVGIGELRNLKGLSLWGNGLSGSIPSEIGKLTFLTSLDLAENDLVGPIPSS  140

Query  170  VTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYL  349
            + NL +L  L I++N L+GPIP +IG L  L+ L++  N L   IP  IG L  LT L L
Sbjct  141  IQNLSNLHFLHIYSNHLSGPIPKEIGNLVSLRRLDLSNNSLGGAIPSSIGSLTNLTILRL  200

Query  350  SFNNF  364
             +NNF
Sbjct  201  RYNNF  205


 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L +Y+  + GP P  + NL+ L RLD+ NN L G IP  IG L  L IL +R+N     +
Sbjct  150  LHIYSNHLSGPIPKEIGNLVSLRRLDLSNNSLGGAIPSSIGSLTNLTILRLRYNNFSGSL  209

Query  305  PPEIGELKQLTHLYLSFNNFK  367
            PPE+ ++ +L+   LS N  +
Sbjct  210  PPEVNKITRLSAFDLSSNELE  230



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 64/113 (57%), Gaps = 11/113 (10%)
 Frame = +2

Query  32   WVGD--DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            W GD  DPC       W  VTCS +    +V  L + + ++ G    ++ NL +L  + +
Sbjct  55   WDGDAVDPCS------WNMVTCSPEN---LVISLGIPSQNLSGTLSPSIGNLTNLQTVVL  105

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NN +TGPIP ++G+L +L+ L++  N L   IPP +G L++L +  LS+NN 
Sbjct  106  QNNNITGPIPSELGKLSKLQTLDLSDNFLSGEIPPSLGHLRRLQYFDLSYNNL  158



>ref|XP_010026000.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=644

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 48/134 (36%), Positives = 59/134 (44%), Gaps = 28/134 (21%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRV----------------------VTELEVYAV  142
            +W GDDPC       W G+ C   G                          V  L + A 
Sbjct  58   SWQGDDPC------IWRGIGCDDPGSVSELNLTNMGLQGSLSKLNFTALSNVISLNLSAN  111

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ GP P +V NL  L+ L I  N L+G IP +IG+L RL IL I  N L   +P EIG 
Sbjct  112  SLYGPIPPSVGNLSKLSTLSIFENSLSGTIPLEIGKLSRLSILYISRNHLHGTVPEEIGM  171

Query  323  LKQLTHLYLSFNNF  364
            L  L +L L  NN 
Sbjct  172  LHSLLNLSLYENNL  185


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  +  L  L  L ++ N LTG IP  IG+L  L++LN+ +N +   IP    +L  
Sbjct  163  GTVPEEIGMLHSLLNLSLYENNLTGKIPRSIGKLTTLEVLNLSYNSISGFIPQSFNDLLG  222

Query  332  LTHLYLSFNNFK  367
            L  + +S N+ +
Sbjct  223  LVSVNISHNDLE  234



>gb|KEH19906.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=166

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GVTC  +  +  V  L +  +S+ G     + NL  L  LD+ NN   G +P ++ RL
Sbjct  15   WVGVTCDER--HGRVQSLILQNMSLRGTVSPNLGNLSFLVILDLKNNSFGGQLPTELYRL  72

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +RLKIL+I +N+ +  IP  +G+L QL +LYL  NNF 
Sbjct  73   RRLKILHISYNEFEGGIPAALGDLSQLEYLYLGVNNFS  110



>ref|XP_011028449.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=808

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +WVG DPCG      W G+ C+       VT + + ++ + G     ++NL +L  LD+ 
Sbjct  44   SWVGSDPCGSR----WDGILCTNSR----VTSITLASMGLKGTLSGDISNLSELQILDLS  95

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +N +L+GP+PP IG LK+L  L +   +    IP  IG L QLT+L +S N+F+
Sbjct  96   YNPELSGPLPPAIGDLKKLTSLILVSCRFSGPIPDTIGSLPQLTYLDMSNNSFE  149



>ref|XP_004976815.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Setaria italica]
Length=1049

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 13/132 (10%)
 Frame = +2

Query  8    LGWRVVYAWV-GDDPCG---------DND--LPPWAGVTCSTQGDYRV-VTELEVYAVSI  148
            LG R+  +W  G DPC          DND  + P     C+ Q +    +T L++YA+++
Sbjct  85   LGSRLWPSWFSGVDPCAGAATDDTDVDNDPKMNPGIKCDCTYQNNTVCHITRLKMYALNL  144

Query  149  VGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
             GP P  + NL  LT L++  N LTGPIP  +G L  L+ L++  N L   +P E+G+L 
Sbjct  145  AGPIPEELRNLTHLTSLNLMQNYLTGPIPSFLGELTALQYLSLAMNALSGSVPKELGKLV  204

Query  329  QLTHLYLSFNNF  364
             L  L +S NN 
Sbjct  205  NLIALGISINNL  216



>ref|XP_002265946.1| PREDICTED: receptor-like protein kinase 2 [Vitis vinifera]
Length=969

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 7/129 (5%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPP-------WAGVTCSTQGDYRVVTELEVYAVSIVGPF  160
            AS+G   +    G   C +N L         + G    + G ++ +  L++   S VGPF
Sbjct  273  ASIGSEGIELVNGLSTCANNSLERLHLGGNRFGGQLPDSLGLFKNLKSLDLSYNSFVGPF  332

Query  161  PNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTH  340
            PN++ +L +L  L++  N ++GPIP  IG L R+K L++  N +   IP  IG+L++LT 
Sbjct  333  PNSIQHLTNLESLNLRENSISGPIPTWIGNLLRMKRLDLSNNLMNGTIPKSIGQLRELTV  392

Query  341  LYLSFNNFK  367
            LYL++N+++
Sbjct  393  LYLNWNSWE  401


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 57/113 (50%), Gaps = 9/113 (8%)
 Frame = +2

Query  17   RVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTR  196
            R + +WVG D C       W GV C+ Q  + V  +L+   +   G   +++ +L  L  
Sbjct  61   RTLSSWVGADCC------KWKGVDCNNQTGHVVKVDLKYGGLG--GEISDSLLDLKHLNY  112

Query  197  LDIHNNKLTG-PIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLS  352
            LD+  N   G PIP  +G  +RL+ LN+       +IPP +G L QL +L LS
Sbjct  113  LDLSFNDFQGIPIPNFLGSFERLRYLNLSHAAFGGMIPPHLGNLSQLCYLDLS  165


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  113  VVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKL  292
            ++  +++ + +I G  P  +TNL  L  L++  N+LTG IP +IG ++ L+ L++ WN L
Sbjct  767  ILNLIDLSSNNIWGEIPKEITNLSTLGALNLSRNQLTGKIPEKIGAMQGLETLDLSWNCL  826

Query  293  QDVIPPEIGELKQLTHLYLSFN  358
               IPP    +  L HL LS N
Sbjct  827  SGPIPPSTSSITSLNHLNLSHN  848


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +  L +   SI GP P  + NLL + RLD+ NN + G IP  IG+L+ L +L + WN  +
Sbjct  342  LESLNLRENSISGPIPTWIGNLLRMKRLDLSNNLMNGTIPKSIGQLRELTVLYLNWNSWE  401

Query  296  DVI  304
             V+
Sbjct  402  GVM  404


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            GD   +  L+V +  + G  P++++ L DL  +D+ NN+L+G IP     L+ L  +++ 
Sbjct  553  GDLSSLEVLDVSSNLLNGSIPSSMSKLKDLRVIDLSNNQLSGKIPKNWSDLQHLDTIDLS  612

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP  +     LT L L  NN 
Sbjct  613  KNKLSGGIPSWMCSKSSLTQLILGDNNL  640



>ref|XP_010656659.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1260

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R + +LE+ A ++ GP P+++ NL +LT L +H NKL+G IP +IG L+ L  L + 
Sbjct  264  GLLRSLNDLELSANNLSGPIPHSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNNLKLS  323

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPP IG L+ LT LYL  N  
Sbjct  324  TNNLSGPIPPSIGNLRNLTTLYLHTNKL  351


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R + +LE+ A ++ GP P ++ NL +LT L +H NKL+G IP +IG L+ L  L + 
Sbjct  360  GLLRSLNDLELSANNLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNDLELS  419

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPP IG L+ LT LYL  N  
Sbjct  420  TNNLNGPIPPSIGNLRNLTTLYLHTNKL  447


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R + +LE+   ++ GP P ++ NL +LT L +H NKL+G IP +IG L+ L  L + 
Sbjct  408  GLLRSLNDLELSTNNLNGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGMLRSLNDLELS  467

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPP IG+L+ LT LYL  N  
Sbjct  468  TNNLNGPIPPSIGKLRNLTTLYLHNNKL  495


 Score = 72.0 bits (175),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R + +LE+   ++ GP P ++  L +LT L +HNNKL+G IP +IG L+ L  L++ 
Sbjct  456  GMLRSLNDLELSTNNLNGPIPPSIGKLRNLTTLYLHNNKLSGSIPLEIGLLRSLFNLSLS  515

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPP IG L+ LT LYL  N F
Sbjct  516  TNNLSGPIPPFIGNLRNLTKLYLDNNRF  543


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R +  L++   ++ GP P ++ NL +LT L +H NKL+G IP +IG L+ L  L + 
Sbjct  312  GLLRSLNNLKLSTNNLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNDLELS  371

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IPP IG L+ LT LYL  N  
Sbjct  372  ANNLSGPIPPSIGNLRNLTTLYLHTNKL  399


 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +Y+    G  P  +  L  L  L +  N L+GPIPP IG L+ L  L + 
Sbjct  192  GNLRNLTSLYLYSNEFYGFIPQEIGLLRSLNNLVLSTNNLSGPIPPSIGNLRNLTTLYLH  251

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP EIG L+ L  L LS NN 
Sbjct  252  TNKLSGSIPKEIGLLRSLNDLELSANNL  279


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L ++   + G  P  +  L  L  L++  N L GPIPP IG+L+ L  L + 
Sbjct  432  GNLRNLTTLYLHTNKLSGSIPKEIGMLRSLNDLELSTNNLNGPIPPSIGKLRNLTTLYLH  491

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP EIG L+ L +L LS NN 
Sbjct  492  NNKLSGSIPLEIGLLRSLFNLSLSTNNL  519


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L ++   + G  P  +  L  L  L++  N L+GPIPP IG L+ L  L + 
Sbjct  336  GNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNDLELSANNLSGPIPPSIGNLRNLTTLYLH  395

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP EIG L+ L  L LS NN 
Sbjct  396  TNKLSGSIPQEIGLLRSLNDLELSTNNL  423


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R +  L +   ++ GP P ++ NL +LT L +H NKL+G IP +IG L+ L  L + 
Sbjct  216  GLLRSLNNLVLSTNNLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGLLRSLNDLELS  275

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IP  IG L+ LT LYL  N  
Sbjct  276  ANNLSGPIPHSIGNLRNLTTLYLHTNKL  303


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L ++   + G  P  +  L  L  L++  N L+GPIP  IG L+ L  L + 
Sbjct  240  GNLRNLTTLYLHTNKLSGSIPKEIGLLRSLNDLELSANNLSGPIPHSIGNLRNLTTLYLH  299

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP EIG L+ L +L LS NN 
Sbjct  300  TNKLSGSIPQEIGLLRSLNNLKLSTNNL  327


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R +  L +   ++ GP P  + NL +LT+L + NN+ +G IP +IG L+ L  L + 
Sbjct  504  GLLRSLFNLSLSTNNLSGPIPPFIGNLRNLTKLYLDNNRFSGSIPREIGLLRSLHDLALA  563

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IP EI  L  L  L+L  NNF
Sbjct  564  TNKLSGPIPQEIDNLIHLKSLHLEENNF  591


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 44/135 (33%), Positives = 58/135 (43%), Gaps = 28/135 (21%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGD---------------YRV-------VTELEVYAV  142
            +W G  PC +     W GVTC                    Y +       +  L++Y  
Sbjct  78   SWSGVSPCNN-----WFGVTCHKSKSVSSLNLESCGLRGTLYNLNFLSLPNLVTLDLYNN  132

Query  143  SIVGPFPNAVTNLLD-LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
            S  G  P  ++NL   +T LD+  N   G IP Q+G L  L  L +  N L+  IPP IG
Sbjct  133  SFYGIIPTHISNLSKFITILDLGFNNFAGLIPHQVGLLTSLIFLALPSNHLRGQIPPSIG  192

Query  320  ELKQLTHLYLSFNNF  364
             L+ LT LYL  N F
Sbjct  193  NLRNLTSLYLYSNEF  207


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P ++ NL +LT L +++N+  G IP +IG L+ L  L +  N L   IPP IG L+ 
Sbjct  185  GQIPPSIGNLRNLTSLYLYSNEFYGFIPQEIGLLRSLNNLVLSTNNLSGPIPPSIGNLRN  244

Query  332  LTHLYLSFNNF  364
            LT LYL  N  
Sbjct  245  LTTLYLHTNKL  255


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  V NL +L  L + +N L+G IP Q+G L +L  LN+  NK  + IP EIG +  
Sbjct  737  GNIPLEVGNLFNLEHLSLTSNNLSGSIPKQLGMLSKLFFLNLSKNKFGESIPDEIGNMHS  796

Query  332  LTHLYLSFN  358
            L +L LS N
Sbjct  797  LQNLDLSQN  805


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  110  RVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK  289
            + +T L++   +  G  P+ V  L  L  L + +N L G IPP IG L+ L  L +  N+
Sbjct  147  KFITILDLGFNNFAGLIPHQVGLLTSLIFLALPSNHLRGQIPPSIGNLRNLTSLYLYSNE  206

Query  290  LQDVIPPEIGELKQLTHLYLSFNNF  364
                IP EIG L+ L +L LS NN 
Sbjct  207  FYGFIPQEIGLLRSLNNLVLSTNNL  231


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +2

Query  161  PNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTH  340
            P+ + N+  L  LD+  N L G IP Q+G L+RL+ LN+  N+L   IP    ++  LT 
Sbjct  788  PDEIGNMHSLQNLDLSQNMLNGKIPQQLGELQRLETLNLSHNELSGSIPSTFEDMLSLTS  847

Query  341  LYLSFNNFK  367
            + +S N  +
Sbjct  848  VDISSNQLE  856


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +   ++ G  P  +   + L RLD+ +N L G IP ++G+L  +  L +  N+L 
Sbjct  677  LTSLNISHNNLSGIIPPQLGEAIQLHRLDLSSNHLLGKIPRELGKLTSMFHLVLSNNQLS  736

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IP E+G L  L HL L+ NN 
Sbjct  737  GNIPLEVGNLFNLEHLSLTSNNL  759



>ref|XP_010069675.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Eucalyptus grandis]
Length=1161

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPCG      W+ VTCS Q     VTE+++ +V +  PFP+ +++L  L +L + +  LT
Sbjct  82   DPCG------WSYVTCSPQN---FVTEIDIQSVELALPFPSNLSSLPFLRKLVMSDANLT  132

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            G +PP IG    L  LN+  N L   IPP IG LK L  L L+ N  
Sbjct  133  GSLPPDIGDWAELTTLNVSSNSLVGSIPPSIGRLKNLQDLILNSNQL  179


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKI-LNIRWNKLQDVIPPEIG  319
            S  GP P+ +    +L  LD+  N  +G IP ++ ++K L+I LN+ WN L  +IPPEI 
Sbjct  587  SFSGPIPSWLKRCSNLQMLDLSGNGFSGTIPVELCQIKSLEIALNLSWNSLSGMIPPEIS  646

Query  320  ELKQLTHLYLSFNNF  364
             L +L+ L +S N  
Sbjct  647  ALNKLSVLDISHNQL  661


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            +G   ++ G    +  L VY   + G  P  + N  +L  L ++ N L+GP+P  +G+L+
Sbjct  253  SGSIPASLGKLSQLQTLSVYTTMLSGEIPPEIGNCSELVDLFLYENNLSGPLPATLGKLR  312

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +L+ L +  N  +  IP +IG  + L  + LS N+F
Sbjct  313  KLEGLLLWQNSFEGTIPEQIGGCESLVIMDLSLNSF  348


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I G  P+ +   L+LT L +   K++G IP  +G+L +L+ L++    L   IPPEIG  
Sbjct  228  IAGNIPDEIGECLNLTLLGLAETKVSGSIPASLGKLSQLQTLSVYTTMLSGEIPPEIGNC  287

Query  326  KQLTHLYLSFNNF  364
             +L  L+L  NN 
Sbjct  288  SELVDLFLYENNL  300


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            GD+  +T L V + S+VG  P ++  L +L  L +++N+LTG IP +IG    L+ L + 
Sbjct  140  GDWAELTTLNVSSNSLVGSIPPSIGRLKNLQDLILNSNQLTGEIPGEIGNCTSLRNLVVF  199

Query  281  WNKLQDVIPPEIGELKQL  334
             N L   IP EIG+L +L
Sbjct  200  DNFLSGDIPVEIGKLSKL  217


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            D  L  ++G    + G+   + EL +   +I G  P +++N  +L +L +  N+++ PIP
Sbjct  342  DLSLNSFSGRIPWSIGNLSNLEELMLSNNNITGSIPVSLSNATNLVQLQLDRNQISSPIP  401

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
             +IG+L +L +     N L+  IP  + + K L +L LS N
Sbjct  402  REIGKLTKLTVFFAWQNSLEGSIPSTLADCKSLQYLDLSHN  442


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T++ + +  I G  P  + N   L+R  + NNK++G IP ++G L  L  L++  N+L 
Sbjct  458  LTKILLISNDISGTLPPEIGNCGSLSRFRLGNNKVSGEIPKEVGFLNNLSFLDLSDNRLT  517

Query  296  DVIPPEIGELKQLTHLYLSFN  358
              IP EIG    L  L LS N
Sbjct  518  GSIPEEIGNCTALGMLDLSNN  538


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 47/100 (47%), Gaps = 7/100 (7%)
 Frame = +2

Query  62   DLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ  241
            ++PP  G  CS       + +L +Y  ++ GP P  +  L  L  L +  N   G IP Q
Sbjct  279  EIPPEIG-NCSE------LVDLFLYENNLSGPLPATLGKLRKLEGLLLWQNSFEGTIPEQ  331

Query  242  IGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            IG  + L I+++  N     IP  IG L  L  L LS NN
Sbjct  332  IGGCESLVIMDLSLNSFSGRIPWSIGNLSNLEELMLSNNN  371


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +2

Query  116  VTELEVYAV---SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
            +T+L V+     S+ G  P+ + +   L  LD+ +N LTG +PP++ RL+ L  + +  N
Sbjct  407  LTKLTVFFAWQNSLEGSIPSTLADCKSLQYLDLSHNALTGSLPPELFRLQNLTKILLISN  466

Query  287  KLQDVIPPEIGELKQLTHLYLSFN  358
             +   +PPEIG    L+   L  N
Sbjct  467  DISGTLPPEIGNCGSLSRFRLGNN  490


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G   ST  D + +  L++   ++ G  P  +  L +LT++ + +N ++G +PP+IG    
Sbjct  422  GSIPSTLADCKSLQYLDLSHNALTGSLPPELFRLQNLTKILLISNDISGTLPPEIGNCGS  481

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            L    +  NK+   IP E+G L  L+ L LS N
Sbjct  482  LSRFRLGNNKVSGEIPKEVGFLNNLSFLDLSDN  514



>ref|XP_010943538.1| PREDICTED: polygalacturonase inhibitor-like [Elaeis guineensis]
Length=331

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIH  208
            AW  D PC D     WAGV+C +      VT L++   +     P +V +L  L  L  H
Sbjct  54   AWTSDYPCCD-----WAGVSCDSATGR--VTSLDISGTNSSATIPTSVADLPFLQSLTFH  106

Query  209  NNK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N  LTGPIP  I  L RL  L + WN L   +P  +  L  L +L L+FN F 
Sbjct  107  KNANLTGPIPSAIATLTRLTFLRLDWNGLSGPVPAFLARLTALDYLNLAFNQFS  160



>ref|XP_010523517.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Tarenaya hassleriana]
Length=1305

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  137  AVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEI  316
            + SI GP PN ++ L +LT+LD+ NN L   IP  IG L++L +LN+ + +L   IPPE+
Sbjct  272  SCSITGPLPNELSKLHNLTKLDLSNNPLKCSIPKSIGNLQKLSVLNLVYAELNGTIPPEL  331

Query  317  GELKQLTHLYLSFNNF  364
            G  K L  L LSFN+ 
Sbjct  332  GNCKNLKTLMLSFNSL  347


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++   ++ G  P A+ N   L  L++ NN+L G IP   G L  L  LN+  NKL 
Sbjct  683  LTTLDLSGNALSGSIPEAIGNSRKLQGLNLGNNQLAGSIPQSFGLLDSLVKLNLTGNKLN  742

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              +P  IG+LK+LTHL LS N  
Sbjct  743  GSVPASIGKLKELTHLDLSHNEL  765


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  +  L  L  L +  N L+GPIPP++GRLKRL+ L++  N L    P  +GEL  
Sbjct  132  GMIPAEIGGLAQLESLQLGPNLLSGPIPPELGRLKRLQNLDLSGNSLTRTFPSGLGELTH  191

Query  332  LTHLYLSFN  358
            L +L LS N
Sbjct  192  LLYLDLSDN  200


 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  110  RVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK  289
            R +T L++   S+ G  P  ++ L  L +L +  N+ +G IP +IG L +L+ L +  N 
Sbjct  94   RFLTILDLSENSLSGEIPPGISRLKGLKQLSLGGNRFSGMIPAEIGGLAQLESLQLGPNL  153

Query  290  LQDVIPPEIGELKQLTHLYLSFNNF  364
            L   IPPE+G LK+L +L LS N+ 
Sbjct  154  LSGPIPPELGRLKRLQNLDLSGNSL  178


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  + N + L RLD+ NN+L G IP +IG+L  L  +N+  N  +  IP E+G    
Sbjct  515  GHLPAEIGNAVSLERLDLSNNRLKGEIPREIGKLTSLSFVNLNSNLFKGKIPVEVGNCTA  574

Query  332  LTHLYLSFNNF  364
            LT L L  NN 
Sbjct  575  LTTLDLGNNNL  585


 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +2

Query  152  GPFPNAV-TNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
            G  P A+ +N   LT LD+ NN  +G IP +IG+L  L  L +  NK    IPPEIG+L 
Sbjct  204  GSLPPAIFSNFPALTSLDVSNNSFSGEIPAEIGKLSYLSDLYMGMNKFSGTIPPEIGKLS  263

Query  329  QLTHL  343
             L + 
Sbjct  264  SLENF  268


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 1/89 (1%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQI-GRLKRLKILNI  277
            G  + +  L++   S+   FP+ +  L  L  LD+ +N L+G +PP I      L  L++
Sbjct  163  GRLKRLQNLDLSGNSLTRTFPSGLGELTHLLYLDLSDNYLSGSLPPAIFSNFPALTSLDV  222

Query  278  RWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              N     IP EIG+L  L+ LY+  N F
Sbjct  223  SNNSFSGEIPAEIGKLSYLSDLYMGMNKF  251


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +  L +    + G  P +   L  L +L++  NKL G +P  IG+LK L  L++ 
Sbjct  702  GNSRKLQGLNLGNNQLAGSIPQSFGLLDSLVKLNLTGNKLNGSVPASIGKLKELTHLDLS  761

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   +P  + E+  L  +Y+  N+F
Sbjct  762  HNELTGELPLALSEMLNLLGIYIQQNSF  789


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P ++ NL  L  LD+H NK TG +    G L +L+ L++  N+L   IP ++  L  
Sbjct  817  GSLPASLGNLSYLIFLDLHGNKFTGEVSSGFGNLMQLEYLDVSLNRLSGQIPEKVCALPN  876

Query  332  LTHLYLSFNNFK  367
            L  L  + N FK
Sbjct  877  LHFLSFADNMFK  888



>ref|XP_010441110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=247

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            W G DPCG N    W G++CS   + RVV  + +  +++ G     ++ L +L  LD+  
Sbjct  47   WKGFDPCGTN----WVGISCS---NGRVV-NISLSNLNLQGKLSADISTLSELVTLDLTS  98

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N+ +TGP+PP IG LK+L  LN+        IP  IG L++LT L L+ N F
Sbjct  99   NSNITGPLPPNIGNLKKLTELNLMGCGFDGQIPESIGNLEKLTKLSLNSNKF  150



>ref|XP_006303147.1| hypothetical protein CARUB_v10008271mg [Capsella rubella]
 gb|EOA36045.1| hypothetical protein CARUB_v10008271mg [Capsella rubella]
Length=882

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  110  RVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK  289
            RV+ EL+V    +VG  P  + NL +L  LD+H N L G IP  +G+L R++ L++  N 
Sbjct  380  RVLLELDVSGNDLVGEIPKKLLNLTNLEILDLHQNHLNGSIPSDLGKLSRIQFLDLSHNS  439

Query  290  LQDVIPPEIGELKQLTHLYLSFNNF  364
            L   IP  +G L  LTH  +S+NN 
Sbjct  440  LSGSIPSSLGNLNTLTHFNVSYNNL  464


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 15/120 (13%)
 Frame = +2

Query  35   VGDDPCGDNDLPPWA----------GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLL  184
            V DDP   N L  W           GVTC+ +G    V ++ ++  S+ G     ++NL 
Sbjct  37   VSDDPY--NSLASWVSDGDLCNSFNGVTCNPEG---FVDKIVLWNTSLAGTLSPGLSNLK  91

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             +  L +  N+ TG +P    +L+ L  +N+  N L   IP  IG+L  L  L LS N F
Sbjct  92   FVRVLTLFGNRFTGNLPLDYSKLQTLWTINVSSNSLSGSIPEFIGDLSSLRFLDLSRNGF  151


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L+  +  + G  P +VT    L  LD+ +NKL G IP  IG++++L ++ +  N +   I
Sbjct  289  LDASSNELAGRIPTSVTGCKSLKLLDVESNKLNGSIPGGIGKMEKLSVIRLGDNSIDGEI  348

Query  305  PPEIGELKQLTHLYL  349
            P EIG L+ L  L L
Sbjct  349  PREIGNLEFLQVLNL  363



>ref|XP_010092461.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB51227.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=1017

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = +2

Query  59   NDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPP  238
            +D   W GVTC  +  +R VT L++ +  + G   + V NL  LTRL++ NN  +  IPP
Sbjct  52   DDFCKWQGVTCGRR--HRRVTALDLSSCQLKGQLSSHVGNLSFLTRLELQNNSFSHIIPP  109

Query  239  QIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            QI +L RLKIL++  N     IP  I     L +L LSFNN 
Sbjct  110  QISKLFRLKILSLGNNSFSGKIPTNISCFSNLQYLDLSFNNL  151


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I G  P  ++NL+ L  L +  N LTG IP  IG+L+ L  L + WN++   IP  +G  
Sbjct  374  ISGRIPKGISNLVSLELLGLEQNLLTGVIPSSIGKLQNLYWLTLGWNRISGPIPSSLGNS  433

Query  326  KQLTHLYLSFNNFK  367
              L  LYL FN+ +
Sbjct  434  TSLGLLYLLFNDIE  447


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S  G  P  ++   +L  LD+  N LTG IPP +G L +L++L +R N L   IP  +G 
Sbjct  126  SFSGKIPTNISCFSNLQYLDLSFNNLTGKIPPDMGLLFKLRVLVLRNNNLLGEIPTCLGN  185

Query  323  LKQLTHLYLSFNNF  364
            L  L  + L  N+F
Sbjct  186  LSALMRIQLGHNSF  199


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 0/96 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G   S+ G    + EL +   ++ GP P  +  L  LT + +  N  TG IP ++G+L  
Sbjct  448  GSIPSSIGQCTQLIELHLMENNLSGPIPKELFGLSSLTLIVLSKNHFTGSIPMEVGKLVH  507

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            + +L+I  +KL   IP  +G    L +LYL  N+ +
Sbjct  508  VFVLDISESKLVGEIPETLGGCTVLQYLYLQGNSLQ  543


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P+++  L +L  L +  N+++GPIP  +G    L +L + +N ++  IP  IG+ 
Sbjct  398  LTGVIPSSIGKLQNLYWLTLGWNRISGPIPSSLGNSTSLGLLYLLFNDIEGSIPSSIGQC  457

Query  326  KQLTHLYLSFNNF  364
             QL  L+L  NN 
Sbjct  458  TQLIELHLMENNL  470



>ref|XP_008234273.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Prunus 
mume]
Length=1203

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV+C        VT L +  +S+ G  P ++ +L +LT LD+ +N L G IPPQI +L
Sbjct  62   WVGVSCHLGR----VTSLALPTLSLRGTLPPSLFSLPNLTVLDLSSNLLRGQIPPQISKL  117

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              L  L+I  N L   +PPEIG LK LT LY+  N+F
Sbjct  118  PSLVSLDISNNSLSGTLPPEIGSLKNLTDLYIGANHF  154


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            GD   +  L+  + SI GP P  ++ L  L++LD+  N L   IP  IG+L++L ILN+ 
Sbjct  163  GDLSRLENLDSPSCSITGPLPEELSKLESLSKLDLSYNPLRCSIPKAIGKLQKLSILNLV  222

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            + +L   +P E+G  + L  L LSFN+ 
Sbjct  223  FAELYGSVPAELGNCRNLKTLMLSFNSL  250


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++ +  + G  P  ++ L  L  LDI NN L+G +PP+IG LK L  L I  N   
Sbjct  96   LTVLDLSSNLLRGQIPPQISKLPSLVSLDISNNSLSGTLPPEIGSLKNLTDLYIGANHFS  155

Query  296  DVIPPEIGELKQLTHL  343
              +PPEIG+L +L +L
Sbjct  156  GPLPPEIGDLSRLENL  171


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 52/112 (46%), Gaps = 24/112 (21%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ-------------  241
            G+  V+ +L +    + G  P +++ L +LT LD+  N L+G IPP+             
Sbjct  557  GNCVVLVDLLISNNMLSGGIPKSLSRLTNLTTLDLSGNMLSGSIPPEFGESPKLQGLYLG  616

Query  242  -----------IGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
                       +GRL  L  LN+  NKL   +P   G LK LTHL LSFN  
Sbjct  617  NNQLTSTMPGSLGRLGSLVKLNLTGNKLSGAVPISFGNLKGLTHLDLSFNKL  668


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  + +T+L + A    GP P  + +L  L  LD  +  +TGP+P ++ +L+ L  L++ 
Sbjct  139  GSLKNLTDLYIGANHFSGPLPPEIGDLSRLENLDSPSCSITGPLPEELSKLESLSKLDLS  198

Query  281  WNKLQDVIPPEIGELKQLTHLYLSF  355
            +N L+  IP  IG+L++L+ L L F
Sbjct  199  YNPLRCSIPKAIGKLQKLSILNLVF  223


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +  L++   S+ G  P  + +L +LT L I  N  +GP+PP+IG L RL+ L+     + 
Sbjct  120  LVSLDISNNSLSGTLPPEIGSLKNLTDLYIGANHFSGPLPPEIGDLSRLENLDSPSCSIT  179

Query  296  DVIPPEIGELKQLTHLYLSFNNFK  367
              +P E+ +L+ L+ L LS+N  +
Sbjct  180  GPLPEELSKLESLSKLDLSYNPLR  203


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 36/71 (51%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P  + N + L  L I NN L+G IP  + RL  L  L++  N L   IPPE GE  +
Sbjct  550  GTIPEDLGNCVVLVDLLISNNMLSGGIPKSLSRLTNLTTLDLSGNMLSGSIPPEFGESPK  609

Query  332  LTHLYLSFNNF  364
            L  LYL  N  
Sbjct  610  LQGLYLGNNQL  620


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L RL + NN+LTG IP +IG L  L +LN+  N L+  IP EIG    LT L L  N  
Sbjct  430  LERLVLSNNQLTGTIPKEIGNLSTLSVLNLNSNLLEGNIPAEIGRCTGLTTLELGNNQL  488


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            G  P ++ NL  LT LD+H+N   G IPP +G L +L+  ++  NKL   IP ++  L  
Sbjct  720  GELPLSLGNLSYLTYLDLHSNLFRGEIPPDLGNLMQLEYFDVSSNKLSGQIPEKVCSLNN  779

Query  332  LTHLYLSFNNFK  367
            L +L  + N  +
Sbjct  780  LFYLNFAENRLE  791



>ref|XP_009589616.1| PREDICTED: receptor-like protein kinase [Nicotiana tomentosiformis]
Length=366

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GVTC ++  ++ VT L + ++++ G  P  + NL  L  LDI NN   G +P ++ RL
Sbjct  63   WIGVTCGSR--HQRVTALNLSSMNLKGMVPPQLGNLSFLISLDIRNNSFYGSLPEELARL  120

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +RLK++N+  N     IP   G L  L  LYLSFN F 
Sbjct  121  RRLKMINVMNNNFTGAIPSFFGLLPNLHSLYLSFNQFS  158



>ref|XP_010690203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=940

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            WV  DPCG      W G+ C+   + RV+ E+ +   ++ GP P  + +L +L  LD+ N
Sbjct  53   WVRRDPCGRR----WEGIYCN---ESRVI-EIILPGTNLAGPLPEEILSLSELQTLDLSN  104

Query  212  NK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N+ LTGP+P  IG L  L  L +        IP  IG L++LTHL+L+ N+F
Sbjct  105  NRGLTGPLPSSIGNLSNLVSLVLVGCNFSGPIPESIGSLQRLTHLFLNINHF  156



>emb|CBI22182.3| unnamed protein product [Vitis vinifera]
Length=998

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P++  NL +LT L + +N+++G IPPQIG++K L+ L++ +N L   IPPEIG+
Sbjct  163  NLTGVIPSSFGNLTNLTYLYLGSNQISGFIPPQIGKMKNLEFLSLSYNGLHGSIPPEIGK  222

Query  323  LKQLTHLYLSFNNF  364
            L+ L +L+L +NN 
Sbjct  223  LQNLNYLFLDYNNL  236


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P ++ NL  L  L +H+N+L G IPP+IG++K L    +  N L  VIP   G 
Sbjct  115  NLTGELPLSLANLTQLEYLSLHSNRLHGSIPPEIGKMKNLIYFILHDNNLTGVIPSSFGN  174

Query  323  LKQLTHLYLSFN  358
            L  LT+LYL  N
Sbjct  175  LTNLTYLYLGSN  186


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            DN+L    GV  S+ G+   +T L + +  I G  P  +  + +L  L +  N L G IP
Sbjct  161  DNNL---TGVIPSSFGNLTNLTYLYLGSNQISGFIPPQIGKMKNLEFLSLSYNGLHGSIP  217

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            P+IG+L+ L  L + +N L  VIP   G L  LT+LYL  N
Sbjct  218  PEIGKLQNLNYLFLDYNNLTSVIPSSFGNLTNLTYLYLDSN  258


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            + EL +    + G  P+ +  L  L  L +  N LTG +P  +  L +L+ L++  N+L 
Sbjct  82   LVELFLSDCGLNGSIPHQIGTLTQLIILYLPLNNLTGELPLSLANLTQLEYLSLHSNRLH  141

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IPPEIG++K L +  L  NN 
Sbjct  142  GSIPPEIGKMKNLIYFILHDNNL  164


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 14/81 (17%)
 Frame = +2

Query  161  PNAVTNLLDLTRLDIHNNKLTGPIPPQIGR--------------LKRLKILNIRWNKLQD  298
            P++  NL +LT L + +N+++G IPPQIG+              LK+L  L+I  N +  
Sbjct  241  PSSFGNLTNLTYLYLDSNQISGFIPPQIGKIKNLDGFIPEEILNLKKLGHLDISNNLISG  300

Query  299  VIPPEIGELKQLTHLYLSFNN  361
             IP E+G LK+  +  LS NN
Sbjct  301  KIPSELGNLKEAIYFNLSRNN  321



>emb|CBN74819.1| Hypothetical leucine rich repeat protein [Ectocarpus siliculosus]
Length=293

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +2

Query  2    ASLGWRVVYAWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            A   W+    W    P G+     W  VT    G    VT LE+   ++ GP P+A+  L
Sbjct  105  AKGAWQKRKGWGKSSPLGN-----WDRVTVDRLGR---VTTLELQFNNLKGPIPSALGGL  156

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
              L  L +HNN+L+G IPP++G L  L  L ++ NKL   IPPE+G+L  L  L +S NN
Sbjct  157  TALQTLHVHNNQLSGVIPPELGWLTALTDLELQTNKLTGPIPPELGKLTALRKLDVSGNN  216

Query  362  FK  367
              
Sbjct  217  LS  218



>gb|AAK43424.1| polygalacturonase inhibitor protein [Physocarpus capitatus]
Length=250

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 54/104 (52%), Gaps = 3/104 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNN-KLTGPI  232
            DND   W  VTC +  +   +  L ++A  + G  P  V +L  L  L+ H    LTGPI
Sbjct  5    DNDCCEWYSVTCDSTNNR--INSLTIFAGEVSGQIPTQVGDLPYLETLEFHKQPNLTGPI  62

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P I +LK LK L + W  L   IP  + +LK LT L LSF NF
Sbjct  63   QPSIVKLKSLKFLRLSWTNLSGSIPDFLSQLKNLTFLDLSFGNF  106


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (52%), Gaps = 1/77 (1%)
 Frame = +2

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
             ++ G  P+ ++ L +LT LD+     TG IP  + +L  L  L++  NKL   IP   G
Sbjct  80   TNLSGSIPDFLSQLKNLTFLDLSFGNFTGSIPSSLSKLPNLNALHLDRNKLTGHIPKSFG  139

Query  320  ELK-QLTHLYLSFNNFK  367
            E +  +  LYLS N F 
Sbjct  140  EFQGSVPDLYLSHNQFS  156



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            +VGP P  + NL    +L +H N LTGPIP ++G + RL  L +  NKL   IPPE+G+L
Sbjct  298  LVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKL  357

Query  326  KQLTHLYLSFNNFK  367
            +QL  L LS NNFK
Sbjct  358  EQLFELNLSSNNFK  371


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+     +L ++   + GP P+ + N+  L+ L +++NKL G IPP++G+L++L  LN+ 
Sbjct  307  GNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLS  366

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N  +  IP E+G +  L  L LS NNF
Sbjct  367  SNNFKGKIPVELGHIINLDKLDLSGNNF  394


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    + EL + + +  G  P  + ++++L +LD+  N  +G IP  +G L+ L ILN+ 
Sbjct  355  GKLEQLFELNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLS  414

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L   +P E G L+ +  + +SFN
Sbjct  415  RNHLSGQLPAEFGNLRSIQMIDVSFN  440


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 22/129 (17%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQ----------------------GDYRVVTELEVYAVSIVGP  157
            D   ++DL  W GV C                         GD R +  +++    + G 
Sbjct  51   DDVHNSDLCSWRGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQ  110

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLT  337
             P+ + N   L  LD+  N L G IP  I +LK+L+ LN++ N+L   +P  + ++  L 
Sbjct  111  IPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLK  170

Query  338  HLYLSFNNF  364
             L L+ N+ 
Sbjct  171  RLDLAGNHL  179



>gb|KCW88500.1| hypothetical protein EUGRSUZ_A00886 [Eucalyptus grandis]
Length=975

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 8/101 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNK-L  220
            DPCG     PW GVTC +      VT L + +++I GP P  +  L +LT LD+  NK L
Sbjct  74   DPCG----LPWVGVTCDSNSR---VTGLGLSSMNIKGPLPADIGGLTELTSLDLSLNKGL  126

Query  221  TGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHL  343
            TGPIP Q+G L++L IL +        IP E+G L +LT L
Sbjct  127  TGPIPSQLGSLQKLNILILANCSFTSSIPDELGNLTELTFL  167



>ref|XP_006402242.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
 gb|ESQ43695.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
Length=953

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +W G DPCG N    W G+TCS     RVV+ + +  +++ G     +  L +L  LD+ 
Sbjct  46   SWEGADPCGTN----WVGITCSND---RVVS-ISLGNLNVEGKLSADIAALPELQILDLS  97

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N  LTGP+PP IG+LK+L+ L +        IP  IG L+QL +L L+ N F
Sbjct  98   YNTGLTGPLPPNIGQLKKLRNLILVGCSFTGQIPESIGNLEQLIYLSLNLNKF  150



>emb|CBN79779.1| Hypothetical leucine rich repeat protein [Ectocarpus siliculosus]
Length=272

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +2

Query  86   TCST-QGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRL  262
            TCST +  +R      V + +  GP P+ + +L  L RL++  N+L+GPIPP++G L  L
Sbjct  63   TCSTPKSKFRESRTCPVASRTCTGPIPSELGHLSVLKRLNLSGNQLSGPIPPELGNLGAL  122

Query  263  KILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              L +  NKL   IPPE+G+L++L  L+LS N+ 
Sbjct  123  TSLALGANKLSGNIPPELGDLRELQRLWLSDNHL  156


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 53/103 (51%), Gaps = 5/103 (5%)
 Frame = +2

Query  71   PWAGVTC-----STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            P A  TC     S  G   V+  L +    + GP P  + NL  LT L +  NKL+G IP
Sbjct  78   PVASRTCTGPIPSELGHLSVLKRLNLSGNQLSGPIPPELGNLGALTSLALGANKLSGNIP  137

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            P++G L+ L+ L +  N L   IPPE+GEL  L  LYL  N  
Sbjct  138  PELGDLRELQRLWLSDNHLTGPIPPELGELAALKSLYLLKNQL  180


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L + A  + G  P  + +L +L RL + +N LTGPIPP++G L  LK L + 
Sbjct  117  GNLGALTSLALGANKLSGNIPPELGDLRELQRLWLSDNHLTGPIPPELGELAALKSLYLL  176

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPE+ +L+QL  L+LS N+ 
Sbjct  177  KNQLTGNIPPELRDLRQLQWLWLSNNHL  204


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  104  DYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRW  283
            D R +  L +    + GP P  +  L  L +L + NN+L+GPIP ++GRL  L+ L++  
Sbjct  190  DLRQLQWLWLSNNHLTGPIPPELGKLTALVQLRLWNNQLSGPIPVELGRLAVLEYLSLGG  249

Query  284  NKLQDVIPPEIG  319
            N+L   IPPE+G
Sbjct  250  NELTGPIPPELG  261


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            GD R +  L +    + GP P  +  L  L  L +  N+LTG IPP++  L++L+ L + 
Sbjct  141  GDLRELQRLWLSDNHLTGPIPPELGELAALKSLYLLKNQLTGNIPPELRDLRQLQWLWLS  200

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N L   IPPE+G+L  L  L L  N   
Sbjct  201  NNHLTGPIPPELGKLTALVQLRLWNNQLS  229


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +  L +    + G  P  + +L  L  L + NN LTGPIPP++G+L  L  L + 
Sbjct  165  GELAALKSLYLLKNQLTGNIPPELRDLRQLQWLWLSNNHLTGPIPPELGKLTALVQLRLW  224

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IP E+G L  L +L L  N  
Sbjct  225  NNQLSGPIPVELGRLAVLEYLSLGGNEL  252



>ref|XP_010911433.1| PREDICTED: putative receptor-like protein kinase At3g47110, partial 
[Elaeis guineensis]
Length=412

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            W GV+C+ +     V+ LE+ +  + GP    + NL  L R+D+ +N+L G IPP+IGRL
Sbjct  67   WEGVSCTRKRHPGRVSALELVSHGLAGPLSPFIGNLSFLRRIDLSDNRLYGEIPPEIGRL  126

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +RL  LN+ +N  ++VIP        L  L LS+N  
Sbjct  127  RRLHFLNLSFNSFEEVIPVNFTYCLDLQVLSLSYNQL  163


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +2

Query  158  FPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLT  337
             P   T  LDL  L +  N+L G IP +I  L +LKIL++  N +  VIPP +G L  L+
Sbjct  143  IPVNFTYCLDLQVLSLSYNQLAGTIPDEISNLSKLKILSVAGNNITGVIPPWVGNLSHLS  202

Query  338  HLYLSFNNF  364
             L +  NN 
Sbjct  203  ELSVGTNNL  211


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            ++ L++ ++ L GP+ P IG L  L+ +++  N+L   IPPEIG L++L  L LSFN+F+
Sbjct  81   VSALELVSHGLAGPLSPFIGNLSFLRRIDLSDNRLYGEIPPEIGRLRRLHFLNLSFNSFE  140



>ref|XP_010030336.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=1269

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +2

Query  104  DYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRW  283
            + R +T L +    + G  P  + NL  LT LD+  NKL GPIPP+IG L+ L  L ++ 
Sbjct  614  NLRSLTYLYLEGNQLGGYIPPEIWNLTSLTHLDLDGNKLGGPIPPEIGNLRNLTYLYLQE  673

Query  284  NKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            N+L   IPPEIG L+ LTHLYL  N   
Sbjct  674  NQLSGSIPPEIGNLRSLTHLYLQGNKLS  701


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  R +T+L +    + G  P  + NL  LT L +  N+L G IPP+IG L  L  L+++
Sbjct  277  GKLRSLTDLYLQGNQLGGSIPPEIRNLTSLTSLHLQGNQLGGSIPPEIGNLTSLTSLHLQ  336

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N+L   IPPEIG L  LT L+L  N
Sbjct  337  GNQLSGSIPPEIGNLTSLTSLFLQEN  362


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +    + G  P  + NL  L  L +  NKL G IPP+I  L+ L  L ++
Sbjct  685  GNLRSLTHLYLQGNKLSGSIPLEIGNLTSLIHLYLQGNKLGGSIPPEIRNLRNLTYLYLQ  744

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IPPEIG L  L HLYL  N  
Sbjct  745  GNKLGGSIPPEIGNLTSLIHLYLQGNQL  772


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++    + GP P  + NL +LT L +  N+L+G IPP+IG L+ L  L ++ NKL 
Sbjct  642  LTHLDLDGNKLGGPIPPEIGNLRNLTYLYLQENQLSGSIPPEIGNLRSLTHLYLQGNKLS  701

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IP EIG L  L HLYL  N  
Sbjct  702  GSIPLEIGNLTSLIHLYLQGNKL  724


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +    + G  P  + NL++LT L +  N+L G IPP+IG L+ L  L + 
Sbjct  541  GNLRSLTYLYLQENQLGGSIPLKIGNLMNLTYLILEGNQLGGSIPPEIGNLRSLIGLYLE  600

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEI  L+ LT+LYL  N  
Sbjct  601  ENQLGGSIPPEIWNLRSLTYLYLEGNQL  628


 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            + + P P+++ NL  LT L++  N+L G IPP+I     L  L+++ N+L   IPPEIG+
Sbjct  219  NFIAPIPSSIRNLTSLTNLNLQRNQLGGSIPPEIWNFTSLTDLDLQENQLGGSIPPEIGK  278

Query  323  LKQLTHLYLSFNNF  364
            L+ LT LYL  N  
Sbjct  279  LRSLTDLYLQGNQL  292


 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T+L +    + G  P  + NL  LT L +  N+L G IPP+IG L+ L  L + 
Sbjct  397  GNLTSLTDLFLEGNQLGGSIPPEIGNLRSLTYLILEGNQLCGSIPPEIGNLRSLIGLYLE  456

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L+ LT LYL  N  
Sbjct  457  ENQLGGSIPPEIGNLRSLTDLYLDGNQL  484


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T+L +    + G  P+ + NL  LT L +  N++ G IP +IG L  L  L + 
Sbjct  469  GNLRSLTDLYLDGNQLGGSIPSEIGNLRSLTYLYLQENQIGGSIPLKIGNLTSLTDLFLE  528

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L+ LT+LYL  N  
Sbjct  529  GNQLGGSIPPEIGNLRSLTYLYLQENQL  556


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++ + S++G  P  V NL  L  L+I  N ++G IPP++G L+RL  LN+ +N L 
Sbjct  114  LTYLDLSSNSLIGKLPPCVQNLTRLQVLNIGVNYISGSIPPELGNLERLNTLNLTFNLLN  173

Query  296  DVIPPEIGELKQLTHLYLSFNNFK  367
              +PP IG L  L  L    NN  
Sbjct  174  GAVPPTIGRLHNLRSLIFRSNNLS  197


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +    + G  P  + NL  LT L +  NKL+G IP +IG L  L  L ++
Sbjct  661  GNLRNLTYLYLQENQLSGSIPPEIGNLRSLTHLYLQGNKLSGSIPLEIGNLTSLIHLYLQ  720

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NKL   IPPEI  L+ LT+LYL  N  
Sbjct  721  GNKLGGSIPPEIRNLRNLTYLYLQGNKL  748


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +    + G  P  + NL  LT L +  N+L+G IPP+IG L  L  L ++ N++ 
Sbjct  306  LTSLHLQGNQLGGSIPPEIGNLTSLTSLHLQGNQLSGSIPPEIGNLTSLTSLFLQENQIG  365

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IPPEIG L  LT L+L  N  
Sbjct  366  GSIPPEIGNLTSLTDLFLEGNQL  388


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T+L +    + G  P  + NL  LT L +  N+L G IPP+IG L+ L  L + 
Sbjct  373  GNLTSLTDLFLEGNQLGGSIPPEIGNLTSLTDLFLEGNQLGGSIPPEIGNLRSLTYLILE  432

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L+ L  LYL  N  
Sbjct  433  GNQLCGSIPPEIGNLRSLIGLYLEENQL  460


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L +    + G  P  + NL  LT L +  N++ G IPP+IG L  L  L + 
Sbjct  325  GNLTSLTSLHLQGNQLSGSIPPEIGNLTSLTSLFLQENQIGGSIPPEIGNLTSLTDLFLE  384

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L  LT L+L  N  
Sbjct  385  GNQLGGSIPPEIGNLTSLTDLFLEGNQL  412


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +T L +    + G  P  + NL  L  L +  N+L G IPP+IG L+ L  L + 
Sbjct  421  GNLRSLTYLILEGNQLCGSIPPEIGNLRSLIGLYLEENQLGGSIPPEIGNLRSLTDLYLD  480

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N+L   IP EIG L+ LT+LYL  N
Sbjct  481  GNQLGGSIPSEIGNLRSLTYLYLQEN  506


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L +    I G  P  + NL  LT L +  N+L G IPP+IG L  L  L + 
Sbjct  349  GNLTSLTSLFLQENQIGGSIPPEIGNLTSLTDLFLEGNQLGGSIPPEIGNLTSLTDLFLE  408

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L+ LT+L L  N  
Sbjct  409  GNQLGGSIPPEIGNLRSLTYLILEGNQL  436


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
             G   S  G+ R +T L +    I G  P  + NL  LT L +  N+L G IPP+IG L+
Sbjct  485  GGSIPSEIGNLRSLTYLYLQENQIGGSIPLKIGNLTSLTDLFLEGNQLGGSIPPEIGNLR  544

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L ++ N+L   IP +IG L  LT+L L  N  
Sbjct  545  SLTYLYLQENQLGGSIPLKIGNLMNLTYLILEGNQL  580


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +    + G  P  + N   LT LD+  N+L G IPP+IG+L+ L  L ++ N+L 
Sbjct  234  LTNLNLQRNQLGGSIPPEIWNFTSLTDLDLQENQLGGSIPPEIGKLRSLTDLYLQGNQLG  293

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IPPEI  L  LT L+L  N  
Sbjct  294  GSIPPEIRNLTSLTSLHLQGNQL  316


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P  +  L  LT LD+ +N L G +PP +  L RL++LNI  N +   IPPE+G L
Sbjct  100  LAGKIPLQICTLSRLTYLDLSSNSLIGKLPPCVQNLTRLQVLNIGVNYISGSIPPELGNL  159

Query  326  KQLTHLYLSFN  358
            ++L  L L+FN
Sbjct  160  ERLNTLNLTFN  170


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +  L +    + G  P  + NL  LT L +  N+L G IPP+I  L  L  L++ 
Sbjct  589  GNLRSLIGLYLEENQLGGSIPPEIWNLRSLTYLYLEGNQLGGYIPPEIWNLTSLTHLDLD  648

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             NKL   IPPEIG L+ LT+LYL  N   
Sbjct  649  GNKLGGPIPPEIGNLRNLTYLYLQENQLS  677


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +2

Query  104  DYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRW  283
            ++  +T+L++    + G  P  +  L  LT L +  N+L G IPP+I  L  L  L+++ 
Sbjct  254  NFTSLTDLDLQENQLGGSIPPEIGKLRSLTDLYLQGNQLGGSIPPEIRNLTSLTSLHLQG  313

Query  284  NKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            N+L   IPPEIG L  LT L+L  N   
Sbjct  314  NQLGGSIPPEIGNLTSLTSLHLQGNQLS  341


 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T+L +    + G  P  + NL  LT L +  N+L G IP +IG L  L  L + 
Sbjct  517  GNLTSLTDLFLEGNQLGGSIPPEIGNLRSLTYLYLQENQLGGSIPLKIGNLMNLTYLILE  576

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEIG L+ L  LYL  N  
Sbjct  577  GNQLGGSIPPEIGNLRSLIGLYLEENQL  604


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +2

Query  116  VTELEVYAVS---IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
            +T L+V  +    I G  P  + NL  L  L++  N L G +PP IGRL  L+ L  R N
Sbjct  135  LTRLQVLNIGVNYISGSIPPELGNLERLNTLNLTFNLLNGAVPPTIGRLHNLRSLIFRSN  194

Query  287  KLQDVIPPEIGELKQLTHLYLSFNNF  364
             L   IP E+G L ++  + LSFNNF
Sbjct  195  NLSGSIPLELGNLAKMNVVDLSFNNF  220


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = +2

Query  104  DYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRW  283
            + R +T L +    + G  P  + NL  L  L +  N+L G IP QI  LK L  LN++ 
Sbjct  734  NLRNLTYLYLQGNKLGGSIPPEIGNLTSLIHLYLQGNQLGGCIPSQIENLKSLIELNLQE  793

Query  284  NKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N++  +IP E+G+L  L  L LS NN 
Sbjct  794  NRIDCIIPSEMGDLWNLQRLNLSLNNL  820


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +  L +    + G  P  + NL +LT L +  NKL G IPP+IG L  L  L ++
Sbjct  709  GNLTSLIHLYLQGNKLGGSIPPEIRNLRNLTYLYLQGNKLGGSIPPEIGNLTSLIHLYLQ  768

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N+L   IP +I  LK L  L L  N
Sbjct  769  GNQLGGCIPSQIENLKSLIELNLQEN  794


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L +    + G  P  + NL  L  L +  N+L G IPP+I  L+ L  L + 
Sbjct  565  GNLMNLTYLILEGNQLGGSIPPEIGNLRSLIGLYLEENQLGGSIPPEIWNLRSLTYLYLE  624

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   IPPEI  L  LTHL L  N  
Sbjct  625  GNQLGGYIPPEIWNLTSLTHLDLDGNKL  652



>emb|CDP20736.1| unnamed protein product [Coffea canephora]
Length=1045

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = +2

Query  14   WRVVYAWVGDDPCGDNDLPPWA-GVTCS---TQGDYRVVTELEVYAVSIVGPFPNAVTNL  181
            W +          G+ D+  +  G+ C     +G    +T L++YA+ +VG  P+ + NL
Sbjct  76   WNISGELCSGVAIGNTDIQTFNPGIKCDCSYNKGTLCHITRLKIYALDVVGDLPDELWNL  135

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
              L  L++  N LTGP+PP IGRL R++ L+I  N L   +P E+G L  L  L  S NN
Sbjct  136  TFLIDLNLGQNYLTGPLPPSIGRLTRMQYLSIGINALSGELPKELGMLTDLRSLSFSTNN  195

Query  362  FK  367
            F 
Sbjct  196  FS  197



>ref|XP_003516680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like isoform X1 [Glycine max]
Length=886

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L+V    + G  P  + NL +L  L++H+N+L G IPP +G L R++ L++  N L   I
Sbjct  388  LDVSGNKLEGEIPQTLYNLTNLESLNLHHNQLNGSIPPSLGNLSRIQYLDLSHNSLSGPI  447

Query  305  PPEIGELKQLTHLYLSFNNF  364
            PP +G L  LTH  LSFNN 
Sbjct  448  PPSLGNLNNLTHFDLSFNNL  467


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +2

Query  149  VGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
            VG  P+ ++N   L  LD+  NKL G IP  +  L  L+ LN+  N+L   IPP +G L 
Sbjct  372  VGQIPDDISNCKFLLGLDVSGNKLEGEIPQTLYNLTNLESLNLHHNQLNGSIPPSLGNLS  431

Query  329  QLTHLYLSFNNF  364
            ++ +L LS N+ 
Sbjct  432  RIQYLDLSHNSL  443


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGD-DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            +WV   +PC D     + GV+C+++G    V  + ++  S+ G   ++++ L  L  L +
Sbjct  50   SWVSSGNPCND-----YNGVSCNSEG---FVERIVLWNTSLGGVLSSSLSGLKRLRILAL  101

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
              N+ +G IP   G L  L  +N+  N L   IP  IG+   +  L LS N F
Sbjct  102  FGNRFSGGIPEGYGELHSLWKINLSSNALSGSIPEFIGDFPSIRFLDLSKNGF  154



>ref|XP_011072437.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g63430 isoform X2 [Sesamum indicum]
Length=656

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 28/130 (22%)
 Frame = +2

Query  35   VGDDPCGDNDLPPWAGVTCSTQGDYRV----------------------VTELEVYAVSI  148
            V  DPCG      W+G++CS  GD+ +                      + EL ++   +
Sbjct  53   VDSDPCG------WSGISCSVAGDHVIKLNISGVALKGFIAPELHQLSTLRELILHGNLL  106

Query  149  VGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
            +G  P  +  L +LT LD+ +N+LTG IPP+IG L  +  +N++ N L   +PPE+G LK
Sbjct  107  IGAIPKEIGMLKNLTVLDLGSNRLTGTIPPEIGNLSSIVKINLQSNGLTGKLPPELGNLK  166

Query  329  QLTHLYLSFN  358
             L  L +  N
Sbjct  167  YLQELRVDRN  176



>ref|XP_011072429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g63430 isoform X1 [Sesamum indicum]
Length=662

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 28/130 (22%)
 Frame = +2

Query  35   VGDDPCGDNDLPPWAGVTCSTQGDYRV----------------------VTELEVYAVSI  148
            V  DPCG      W+G++CS  GD+ +                      + EL ++   +
Sbjct  53   VDSDPCG------WSGISCSVAGDHVIKLNISGVALKGFIAPELHQLSTLRELILHGNLL  106

Query  149  VGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELK  328
            +G  P  +  L +LT LD+ +N+LTG IPP+IG L  +  +N++ N L   +PPE+G LK
Sbjct  107  IGAIPKEIGMLKNLTVLDLGSNRLTGTIPPEIGNLSSIVKINLQSNGLTGKLPPELGNLK  166

Query  329  QLTHLYLSFN  358
             L  L +  N
Sbjct  167  YLQELRVDRN  176



>ref|XP_002317403.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98015.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=617

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPC       W  ++CST+G    V  LE+ +V + G    ++ NL+ L  + + NN L+
Sbjct  60   DPC------TWNMISCSTEG---FVISLEMASVGLSGTLSPSIGNLIHLRTMLLQNNHLS  110

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            GPIP +IG+L  L+ L++  N+    IP  +G L  L++L LS NN 
Sbjct  111  GPIPEEIGKLSELQTLDLSGNQFGGGIPSSLGFLTHLSYLRLSKNNL  157



>emb|CAH67463.1| OSIGBa0159I10.8 [Oryza sativa Indica Group]
Length=655

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 30/131 (23%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVT------------ELEVYAVS-----------IV  151
            ++PCG      W GV CS   D RVVT             LE+ ++S           ++
Sbjct  56   ENPCG------WTGVGCSP-FDSRVVTLELANSSLKGFLALEIESLSSLQKLILDHNTLM  108

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            GP P  +  L +L  L++  N+L GPIP +IG + ++  +++R N+L   IPPEIG L  
Sbjct  109  GPIPKGIGKLRNLIMLNLSTNQLDGPIPIEIGDMPKISKIDLRANRLDGAIPPEIGNLTS  168

Query  332  LTHLYLSFNNF  364
            LT L LS N+ 
Sbjct  169  LTELQLSNNSL  179



>gb|EMT04510.1| Polygalacturonase inhibitor [Aegilops tauschii]
Length=339

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 57/113 (50%), Gaps = 7/113 (6%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
             W  D PC D     W GVTC      RVV+       +I G  P+A+  L  L  L + 
Sbjct  57   GWTSDSPCCD-----WNGVTCD-HFTGRVVSLAVFQDANITGTIPSALAGLPHLQDLTLR  110

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            H   L+GPIPP IG+L  L  L I W  +   +P  +G LK+LT L LSFN+ 
Sbjct  111  HLPLLSGPIPPAIGKLSNLSSLRISWTAVSGPVPSFLGSLKKLTFLELSFNSL  163


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = +2

Query  65   LPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQI  244
            LP  +G      G    ++ L +   ++ GP P+ + +L  LT L++  N LTG IP  +
Sbjct  112  LPLLSGPIPPAIGKLSNLSSLRISWTAVSGPVPSFLGSLKKLTFLELSFNSLTGAIPASL  171

Query  245  GRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            G +  L  +N+  N+L   IP  + +     +L+LS NN 
Sbjct  172  GTIPNLSGINLSRNRLTGAIPMFLSKSADQVYLWLSHNNL  211



>gb|EMT21840.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1069

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 5/98 (5%)
 Frame = +2

Query  71   PWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGR  250
            P A V  ST+     + +L + +  I G  P  ++NL++LT L + NN L+G IP  IG+
Sbjct  408  PVAVVNLSTR-----LQDLSLGSNQISGSIPVEISNLVNLTSLRMENNFLSGSIPSTIGK  462

Query  251  LKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L+ L ILN+  NKL   IPP +G++ QL  LYLS N F
Sbjct  463  LQNLYILNLSKNKLSGQIPPSVGDITQLGKLYLSDNKF  500


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +    + G  P+ +  L +L  L++  NKL+G IPP +G + +L  L +  NK  
Sbjct  442  LTSLRMENNFLSGSIPSTIGKLQNLYILNLSKNKLSGQIPPSVGDITQLGKLYLSDNKFT  501

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IP  +G+ K L  L LS NN 
Sbjct  502  GNIPGSLGQCKGLLELNLSRNNL  524



>gb|AAK43425.1| polygalacturonase inhibitor protein [Physocarpus opulifolius]
 gb|AAK43427.1| polygalacturonase inhibitor protein [Physocarpus opulifolius]
Length=250

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 54/104 (52%), Gaps = 3/104 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNN-KLTGPI  232
            DND   W  VTC +  +   +  L ++A  + G  P  V +L  L  L+ H    LTGPI
Sbjct  5    DNDCCDWYSVTCDSTNNR--INSLTIFAGEVSGQIPTQVGDLPYLETLEFHKQPNLTGPI  62

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P I +LK LK L + W  L   IP  + +LK LT L LSF NF
Sbjct  63   QPSIVKLKSLKFLRLSWTNLSGSIPDFLSQLKNLTFLDLSFGNF  106



>gb|KCW56526.1| hypothetical protein EUGRSUZ_I02251 [Eucalyptus grandis]
Length=790

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +2

Query  116  VTELEVYAVS---IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
            +T+L V  +S    +GP P+ + NL  LTRL +  NK  G IPP+IG L  L ILN++ N
Sbjct  205  LTKLNVVDLSCNNFIGPIPSFIGNLTSLTRLYLQENKFGGFIPPEIGNLMNLTILNLQRN  264

Query  287  KLQDVIPPEIGELKQLTHLYLSFNNF  364
            KL   IP EIG+L+ L  L LS NN 
Sbjct  265  KLNGSIPLEIGDLRNLEFLDLSLNNL  290


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/133 (31%), Positives = 60/133 (45%), Gaps = 23/133 (17%)
 Frame = +2

Query  29   AWVGDDPCGDNDLP--PWAGVTCSTQGDYRVV---------------------TELEVYA  139
             W      G+  LP   W GV C T    + +                     T L++  
Sbjct  36   GWWPPSVTGNTALPYYAWPGVWCDTSRSVKEIDLTHRIGGNLSNMNFSLLPNLTYLQLVH  95

Query  140  VSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIG  319
              + G  P  +  L  LT LD+ NN L G +PP +  L  L++L I  N++   IPP++G
Sbjct  96   TEMAGVIPLQICTLSRLTYLDLSNNSLAGKLPPCVQNLISLEVLRIDHNQISGSIPPKLG  155

Query  320  ELKQLTHLYLSFN  358
             L++LT+LYL FN
Sbjct  156  NLERLTNLYLQFN  168


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++   S+ G  P  V NL+ L  L I +N+++G IPP++G L+RL  L +++N L 
Sbjct  112  LTYLDLSNNSLAGKLPPCVQNLISLEVLRIDHNQISGSIPPKLGNLERLTNLYLQFNALS  171

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
             V+P  IG L  L  L  S N+ 
Sbjct  172  GVVPLTIGRLHNLQSLLCSSNDL  194


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L +      G  P  + NL++LT L++  NKL G IP +IG L+ L+ L++ 
Sbjct  227  GNLTSLTRLYLQENKFGGFIPPEIGNLMNLTILNLQRNKLNGSIPLEIGDLRNLEFLDLS  286

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N L   IP E+G+L ++  + LS N F
Sbjct  287  LNNLVGKIPLELGKLIKMRAVDLSSNVF  314


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +2

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            GP P+++ NL  L  L +  NK +G I   I  L+ L  LN+  N+    IP EIG L  
Sbjct  316  GPLPSSIWNLTSLNSLSLQVNKFSGSISSAIDNLEYLIELNLSENRFDGAIPSEIGNLWG  375

Query  332  LTHLYLSFNNF  364
            L  L LS NNF
Sbjct  376  LEILDLSSNNF  386


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 44/96 (46%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            +GV   T G    +  L   +  + G  P  + NL  L  +D+  N   GPIP  IG L 
Sbjct  171  SGVVPLTIGRLHNLQSLLCSSNDLGGSIPLELENLTKLNVVDLSCNNFIGPIPSFIGNLT  230

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             L  L ++ NK    IPPEIG L  LT L L  N  
Sbjct  231  SLTRLYLQENKFGGFIPPEIGNLMNLTILNLQRNKL  266


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            GD R +  L++   ++VG  P  +  L+ +  +D+ +N  TGP+P  I  L  L  L+++
Sbjct  275  GDLRNLEFLDLSLNNLVGKIPLELGKLIKMRAVDLSSNVFTGPLPSSIWNLTSLNSLSLQ  334

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NK    I   I  L+ L  L LS N F
Sbjct  335  VNKFSGSISSAIDNLEYLIELNLSENRF  362



>ref|XP_010937489.1| PREDICTED: nodulation receptor kinase-like [Elaeis guineensis]
Length=764

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 56/102 (55%), Gaps = 7/102 (7%)
 Frame = +2

Query  11   GWRVVYAWVGDDPCGDNDLP-PWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLD  187
            G +++  W GD PC    LP PW G+TC    +  V+T+L + + S+ GP P A+ NL +
Sbjct  238  GNKILEKWHGD-PC----LPSPWEGLTCENSNNMMVITKLNLSSKSLQGPLPAAIANLTE  292

Query  188  LTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNK-LQDVIPP  310
            L  LD+ NN  TG IP     L  L  L+I  N+ L   +PP
Sbjct  293  LEELDVQNNNFTGSIPKSFASLHHLSKLSIGCNQHLSSKLPP  334



>ref|XP_006353961.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Solanum tuberosum]
Length=983

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = +2

Query  53   GDNDLP---PWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            GDN      P + V  S+Q     +  L  +   I G  P  ++NL++L  LD+ NN LT
Sbjct  332  GDNQFVGTLPHSTVNLSSQ-----LQRLLFFGNRIGGSIPREISNLVNLNLLDMSNNNLT  386

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            G IP  IGRL  L  L++R N L  VIP  IG L +L +LYL FN
Sbjct  387  GSIPDSIGRLANLGSLDLRNNLLTGVIPSSIGNLTELVYLYLGFN  431


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 7/80 (9%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLT-------RLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            + G  P+++ NL +L        RLDI  N LTG IP Q+  L  L  +   +N L   +
Sbjct  409  LTGVIPSSIGNLTELVYLYLGFNRLDISENNLTGSIPQQLIALSSLTKVYAYYNSLTGTL  468

Query  305  PPEIGELKQLTHLYLSFNNF  364
            P  IG    LT+L  SFNNF
Sbjct  469  PVHIGNWSHLTYLDFSFNNF  488


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++VG  P  V +L  L RL + NN LTG  P  IG L  L+ L + +N L+  +P  +  
Sbjct  136  TLVGLIPYQVGSLTKLVRLYLRNNNLTGIFPVSIGNLTSLEELYLSYNSLEGQVPASLAR  195

Query  323  LKQLTHLYLSFNNF  364
            L +L  L LS N+F
Sbjct  196  LTKLRLLGLSVNSF  209


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P  +++ ++L  L + +N L G IP Q+G L +L  L +R N L  + P  IG L
Sbjct  113  LTGEIPVNLSHCVNLKSLVLDHNTLVGLIPYQVGSLTKLVRLYLRNNNLTGIFPVSIGNL  172

Query  326  KQLTHLYLSFNNFK  367
              L  LYLS+N+ +
Sbjct  173  TSLEELYLSYNSLE  186


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G FP ++ NL  L  L +  N L G +P  + RL +L++L +  N      PP +  
Sbjct  160  NLTGIFPVSIGNLTSLEELYLSYNSLEGQVPASLARLTKLRLLGLSVNSFSGEFPPSLYN  219

Query  323  LKQLTHLYLSFNNF  364
            L  L  + LSFN+F
Sbjct  220  LSSLELIALSFNHF  233


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 7/81 (9%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRL-------KILNIRWNKLQDV  301
            ++ G  P+++  L +L  LD+ NN LTG IP  IG L  L         L+I  N L   
Sbjct  384  NLTGSIPDSIGRLANLGSLDLRNNLLTGVIPSSIGNLTELVYLYLGFNRLDISENNLTGS  443

Query  302  IPPEIGELKQLTHLYLSFNNF  364
            IP ++  L  LT +Y  +N+ 
Sbjct  444  IPQQLIALSSLTKVYAYYNSL  464



>gb|AAK43423.1| polygalacturonase inhibitor protein [Physocarpus capitatus]
Length=250

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 54/104 (52%), Gaps = 3/104 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNN-KLTGPI  232
            DND   W  VTC +  +   +  L ++A  + G  P  V +L  L  L+ H    LTGPI
Sbjct  5    DNDCCDWYSVTCDSTNNR--INSLTIFAGEVSGQIPTQVGDLPYLETLEFHKQPNLTGPI  62

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P I +LK LK L + W  L   IP  + +LK LT L LSF NF
Sbjct  63   QPSIVKLKSLKFLRLSWTNLSGSIPDFLSQLKNLTFLDLSFGNF  106



>ref|XP_006485280.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Citrus sinensis]
Length=709

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G   ST G    +T L++   ++VGP P++V +L  LT  D+H+N++ G IP +IG L  
Sbjct  67   GFIPSTLGHLNRLTSLDLSCNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLNL  126

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L++L++  NKL+  IP  I  L  LT L L +NN 
Sbjct  127  LQVLDLSHNKLEGPIPSTIAGLVNLTSLSLDYNNL  161


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G++  +  L+++   + GP P+ + +L++LT L + NN LTG IP  +G L RL  L++ 
Sbjct  26   GNFNFLQVLDLFYNKLEGPIPSTIASLVNLTSLFLCNNSLTGFIPSTLGHLNRLTSLDLS  85

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L   IP  +G L QLT   +  N
Sbjct  86   CNNLVGPIPSSVGHLTQLTTFDMHSN  111


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+  ++  L++    + GP P+ +  L++LT L +  N LTG IP  +GRL RL  L + 
Sbjct  122  GNLNLLQVLDLSHNKLEGPIPSTIAGLVNLTSLSLDYNNLTGSIPSTLGRLNRLIDLELS  181

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             NKL   IP  +G L QLT L +  N
Sbjct  182  ENKLVGPIPSSVGHLTQLTILNMYSN  207


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = +2

Query  92   STQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKIL  271
            S+ G    +T L +Y+  I G  P  + NL  LT L+++NNKL GPIP ++    +L+IL
Sbjct  191  SSVGHLTQLTILNMYSNRINGSIPLEIGNLTQLTTLNMYNNKLDGPIPLELMNCSKLRIL  250

Query  272  NIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
             +  N L   I  EIG+L++L  L LS N+
Sbjct  251  ILGNNLLSGSILSEIGKLQELYSLDLSHNS  280


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L +   ++ G  P+ +  L  L  L++  NKL GPIP  +G L +L ILN+  N++ 
Sbjct  151  LTSLSLDYNNLTGSIPSTLGRLNRLIDLELSENKLVGPIPSSVGHLTQLTILNMYSNRIN  210

Query  296  DVIPPEIGELKQLTHLYLSFNN  361
              IP EIG L QLT L + +NN
Sbjct  211  GSIPLEIGNLTQLTTLNM-YNN  231


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            G   ST G    + +LE+    +VGP P++V +L  LT L++++N++ G IP +IG L +
Sbjct  163  GSIPSTLGRLNRLIDLELSENKLVGPIPSSVGHLTQLTILNMYSNRINGSIPLEIGNLTQ  222

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            L  LN+  NKL   IP E+    +L  L L  N
Sbjct  223  LTTLNMYNNKLDGPIPLELMNCSKLRILILGNN  255


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ G  P+ + +L  LT LD+  N L GPIP  +G L +L   ++  N++   IP EIG 
Sbjct  64   SLTGFIPSTLGHLNRLTSLDLSCNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGN  123

Query  323  LKQLTHLYLSFNNFK  367
            L  L  L LS N  +
Sbjct  124  LNLLQVLDLSHNKLE  138


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  NLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSF  355
            +L  LT  D+H+N++ G IP +IG    L++L++ +NKL+  IP  I  L  LT L+L  
Sbjct  3    HLTRLTTFDMHSNRINGSIPLEIGNFNFLQVLDLFYNKLEGPIPSTIASLVNLTSLFLCN  62

Query  356  NNF  364
            N+ 
Sbjct  63   NSL  65


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T  ++++  I G  P  + N   L  LD+  NKL GPIP  I  L  L  L +  N L 
Sbjct  7    LTTFDMHSNRINGSIPLEIGNFNFLQVLDLFYNKLEGPIPSTIASLVNLTSLFLCNNSLT  66

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IP  +G L +LT L LS NN 
Sbjct  67   GFIPSTLGHLNRLTSLDLSCNNL  89



>gb|KEH21568.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=788

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/89 (45%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L +    +VG  P ++ NL  LT LD+  N L G +PP I  L++L  LNI 
Sbjct  154  GNLSKLTHLNLSNNILVGKLPPSIENLSKLTHLDLSANSLKGQVPPSIENLRQLNYLNIS  213

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +N +Q  IPPE+  LK LT LYLS N FK
Sbjct  214  FNFIQGSIPPELWLLKNLTCLYLSNNRFK  242


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            +T L++    +    P+++ NL  LT L++ NN L G +PP I  L +L  L++  N L+
Sbjct  135  LTHLQLSRNYLESQVPHSLGNLSKLTHLNLSNNILVGKLPPSIENLSKLTHLDLSANSLK  194

Query  296  DVIPPEIGELKQLTHLYLSFN  358
              +PP I  L+QL +L +SFN
Sbjct  195  GQVPPSIENLRQLNYLNISFN  215


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I G  P  +  L +LT L + NN+  G IP  +G LK+L++L+I  N +Q  IP E+G L
Sbjct  217  IQGSIPPELWLLKNLTCLYLSNNRFKGEIPSSLGNLKQLQVLDISHNNIQGSIPLELGFL  276

Query  326  KQLTHLYLSFN  358
            + L+ L LS N
Sbjct  277  EYLSSLDLSHN  287



>emb|CAD41514.3| OSJNBb0020O11.17 [Oryza sativa Japonica Group]
 gb|EAY94968.1| hypothetical protein OsI_16776 [Oryza sativa Indica Group]
 gb|EAZ31454.1| hypothetical protein OsJ_15590 [Oryza sativa Japonica Group]
Length=664

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 30/131 (23%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVT------------ELEVYAVS-----------IV  151
            ++PCG      W GV CS   D RVVT             LE+ ++S           ++
Sbjct  65   ENPCG------WTGVGCSP-FDSRVVTLELANSSLKGFLALEIESLSSLQKLILDHNTLM  117

Query  152  GPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQ  331
            GP P  +  L +L  L++  N+L GPIP +IG + ++  +++R N+L   IPPEIG L  
Sbjct  118  GPIPKGIGKLRNLIMLNLSTNQLDGPIPIEIGDMPKISKIDLRANRLDGAIPPEIGNLTS  177

Query  332  LTHLYLSFNNF  364
            LT L LS N+ 
Sbjct  178  LTELQLSNNSL  188



>ref|XP_009605193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=948

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            W G DPCGD    PW G+ C+     RVVT +++ ++++ G     +  L +L  LD+  
Sbjct  48   WSGTDPCGD----PWDGIECNNS---RVVT-IKLSSMNLKGELSGDIEALSELQILDLSY  99

Query  212  NK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            NK LTG +P  IG LK L IL +   +   +IP  +G L QL  L L+ NNF
Sbjct  100  NKDLTGSLPQSIGSLKSLSILILVGCRFSGLIPDTVGSLSQLVFLSLNLNNF  151


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  182  LDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNN  361
            + L  L + NN+LTG IPP +G +K L+++ +  N L   IP  +  L +++ L+LS N 
Sbjct  218  MTLKHLLLENNQLTGKIPPTLGLVKTLEVVRLDRNSLDGSIPSTLNNLMRMSALFLSNNE  277

Query  362  F  364
            F
Sbjct  278  F  278



>emb|CDY21455.1| BnaC03g27420D [Brassica napus]
Length=953

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +W G DPCG +    W G+TCS     RVV+ + +  +++ G     +  L +L  LD+ 
Sbjct  46   SWEGADPCGTS----WVGITCSNN---RVVS-ISLGNLNVEGKLSGDIAALSELQILDLS  97

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N  LTGP+PP IG LK+LK L +        IP  IG+L+QL +L L+ N F
Sbjct  98   YNTGLTGPLPPNIGELKKLKNLILVGCSFTGQIPESIGQLEQLIYLSLNLNQF  150



>ref|XP_010025444.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Eucalyptus grandis]
 ref|XP_010025445.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Eucalyptus grandis]
 ref|XP_010025446.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Eucalyptus grandis]
 ref|XP_010025447.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Eucalyptus grandis]
 ref|XP_010025448.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Eucalyptus grandis]
 gb|KCW62100.1| hypothetical protein EUGRSUZ_H04770 [Eucalyptus grandis]
 gb|KCW62101.1| hypothetical protein EUGRSUZ_H04770 [Eucalyptus grandis]
Length=605

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = +2

Query  74   WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
            ++G      G  + +T L +    I G  P  + NL  LT LD+ NN+LTG IPP +G L
Sbjct  74   FSGTLSPKIGALKTLTTLNLQGNGITGEIPPEIGNLTSLTNLDLENNRLTGQIPPSVGNL  133

Query  254  KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             +L+ L++  N L   IP  +  L  L +L L+FNN +
Sbjct  134  LKLQFLSLSQNNLSGTIPESLSTLHNLINLQLAFNNLE  171


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            +PC       W+ V C    +   V  + + +++  G     +  L  LT L++  N +T
Sbjct  49   NPC------TWSNVICDPNNN---VVSVTLSSMNFSGTLSPKIGALKTLTTLNLQGNGIT  99

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            G IPP+IG L  L  L++  N+L   IPP +G L +L  L LS NN 
Sbjct  100  GEIPPEIGNLTSLTNLDLENNRLTGQIPPSVGNLLKLQFLSLSQNNL  146



>gb|AAK43460.1| polygalacturonase inhibitor protein [Neillia hanceana]
 gb|AAK43461.1| polygalacturonase inhibitor protein [Neillia hanceana]
Length=250

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 3/104 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNN-KLTGPI  232
            DND   W  VTC +  +   +  L ++A  + G  P  V +L  L  L+ H    LTGPI
Sbjct  5    DNDCCDWYSVTCDSTTNR--INSLTIFAGEVSGQIPTQVGDLPYLETLEFHKQPNLTGPI  62

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P I +LK LK L + W  L   +P  + +LK LT L LSF+NF
Sbjct  63   QPSIVKLKSLKFLRLSWTNLSGSVPDFLSQLKNLTFLDLSFSNF  106



>gb|AAK43462.1| polygalacturonase inhibitor protein [Neillia hanceana]
Length=250

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 3/104 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNN-KLTGPI  232
            DND   W  VTC +  +   +  L ++A  + G  P  V +L  L  L+ H    LTGPI
Sbjct  5    DNDCCDWYSVTCDSTTNR--INSLTIFAGEVSGQIPTQVGDLPYLETLEFHKQPNLTGPI  62

Query  233  PPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             P I +LK LK L + W  L   +P  + +LK LT L LSF+NF
Sbjct  63   QPSIVKLKSLKFLRLSWTNLSGSVPDFLSQLKNLTFLDLSFSNF  106



>ref|XP_008659447.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Zea mays]
 gb|AFW86332.1| hypothetical protein ZEAMMB73_446534 [Zea mays]
Length=199

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 9/108 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPC       W+ ++CS +    +VT LE  + ++ G    ++ NL  L +L + NN + 
Sbjct  58   DPCT------WSFISCSPE---NLVTALEAPSKNLSGRLSPSIGNLTKLEKLQLQNNNII  108

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            GPIP +IG+L +L+ L +  NKL   +P  +G L +L ++ LS+NN  
Sbjct  109  GPIPAEIGKLAKLRTLVLSSNKLHGTVPNSLGRLGRLQYIDLSYNNLS  156


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   + +L++   +I+GP P  +  L  L  L + +NKL G +P  +GRL RL+ +++ 
Sbjct  92   GNLTKLEKLQLQNNNIIGPIPAEIGKLAKLRTLVLSSNKLHGTVPNSLGRLGRLQYIDLS  151

Query  281  WNKLQDVIP  307
            +N L   IP
Sbjct  152  YNNLSGPIP  160



>ref|XP_002436858.1| hypothetical protein SORBIDRAFT_10g010020 [Sorghum bicolor]
 gb|EER88225.1| hypothetical protein SORBIDRAFT_10g010020 [Sorghum bicolor]
Length=199

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = +2

Query  44   DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            DPC       W+ ++CS +    +VT LE  +  + GP   ++ NL  L  L + NN + 
Sbjct  58   DPCS------WSFISCSPE---NLVTALEAPSKYLSGPLSPSIGNLTKLEILLLQNNNII  108

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            GPIP +IG+L +L+ L +  NKL   IP  +G L++L ++ LS+NN 
Sbjct  109  GPIPTEIGKLAKLRTLVLSSNKLDGTIPNSLGHLERLHYIDLSYNNL  155



>gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Erythranthe guttata]
Length=955

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHN  211
            WVG DPCGD     W G+TC      RVV+ + + ++++ G   + ++ L +L  LD+  
Sbjct  45   WVGSDPCGD----VWDGITCKND---RVVS-ITLASINLTGQLSSDISGLTELQTLDLSY  96

Query  212  NK-LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            NK +TG +P  IG +K+L  L +        IPP IG L+QL +L L+ NNF
Sbjct  97   NKGMTGSLPSGIGNVKKLSSLILVGCGFSGPIPPSIGSLQQLRYLSLNSNNF  148



>ref|XP_010941603.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Elaeis guineensis]
Length=1061

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = +2

Query  29   AW-VGDDPCG----------DNDLPPWAGVTCSTQGDYRV-VTELEVYAVSIVGPFPNAV  172
            AW +  +PC           D  L P+    CS   +    +T+L+VYA+ +VGP P  +
Sbjct  80   AWNISGEPCSGAATDTTRFDDTSLNPFIKCDCSYNNNTTCHITQLKVYALDVVGPIPEEL  139

Query  173  TNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLS  352
             NL  L  L++  N LTGP+P  IG    ++ L++  N L   IP E+G+L+ L  L + 
Sbjct  140  QNLTYLFNLNLAQNYLTGPLPAFIGNFTAMQYLSVGINALSGPIPKELGKLQNLISLGMG  199

Query  353  FNNF  364
             NNF
Sbjct  200  TNNF  203



>gb|EPS67674.1| hypothetical protein M569_07098, partial [Genlisea aurea]
Length=878

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P +V N+  L  L++  N LTG IPP+IGRL+ L+ L + +N+LQ  IPPEIG +
Sbjct  146  VFGEIPPSVGNMTSLVDLELSGNYLTGKIPPEIGRLRNLQQLELYYNQLQGEIPPEIGNM  205

Query  326  KQLTHLYLSFNNF  364
             +L +L +S NNF
Sbjct  206  AELINLDMSVNNF  218



>ref|XP_003596118.1| Receptor protein kinase-like protein [Medicago truncatula]
Length=1029

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 7/102 (7%)
 Frame = +2

Query  62   DLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ  241
            D+PP       + G+   +T L +Y  S+VG  P ++ NL  L  L+I +N + G IPP+
Sbjct  328  DIPP-------SLGNLVKLTHLVIYGNSLVGKIPPSIGNLRSLESLEISDNYIQGSIPPR  380

Query  242  IGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +G LK L  L +  N+++  IPP +G LKQL  L +S NN +
Sbjct  381  LGLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDISNNNIQ  422


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I G  P ++ NL+ LT L I+ N L G IPP IG L+ L+ L I  N +Q  IPP +G L
Sbjct  325  ISGDIPPSLGNLVKLTHLVIYGNSLVGKIPPSIGNLRSLESLEISDNYIQGSIPPRLGLL  384

Query  326  KQLTHLYLSFNNFK  367
            K LT L LS N  K
Sbjct  385  KNLTTLRLSHNRIK  398


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            +GV   + G+   +T L++    + G  P+++ NL  LT LD+ +N L+G +PP +G L 
Sbjct  182  SGVVPHSLGNLSKLTHLDLSDNLLSGVVPHSLGNLSKLTHLDLSDNLLSGVVPPSLGNLS  241

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +L  L++  N L+  +P  +G L +LTHL  S+N+ +
Sbjct  242  KLTHLDLSVNLLKGQVPHSLGNLSKLTHLDFSYNSLE  278


 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L++    + G  P+++ NL  LT LD+ +N L+G +P  +G L +L  L++ 
Sbjct  166  GNLSKLTHLDLSDNILSGVVPHSLGNLSKLTHLDLSDNLLSGVVPHSLGNLSKLTHLDLS  225

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N L  V+PP +G L +LTHL LS N  K
Sbjct  226  DNLLSGVVPPSLGNLSKLTHLDLSVNLLK  254


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L+    S+ G  PN++ N   L  LDI NN L G IP ++G +K L  LN+ 
Sbjct  262  GNLSKLTHLDFSYNSLEGEIPNSLGNHRQLKYLDISNNNLNGSIPHELGFIKYLGSLNLS  321

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N++   IPP +G L +LTHL +  N+ 
Sbjct  322  TNRISGDIPPSLGNLVKLTHLVIYGNSL  349


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +  LE+    I G  P  +  L +LT L + +N++ G IPP +G LK+L+ L+I 
Sbjct  358  GNLRSLESLEISDNYIQGSIPPRLGLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDIS  417

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N +Q  +P E+G LK LT L LS N
Sbjct  418  NNNIQGFLPFELGLLKNLTTLDLSHN  443


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L++ A  + G  P+++ NL  LT LD+ +N L+G +P  +G L +L  L++ 
Sbjct  142  GNLSKLTHLDLSANILKGQVPHSLGNLSKLTHLDLSDNILSGVVPHSLGNLSKLTHLDLS  201

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L  V+P  +G L +LTHL LS N
Sbjct  202  DNLLSGVVPHSLGNLSKLTHLDLSDN  227


 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    +T L++   ++ G  P+++ NL  LT LD+  N L G +P  +G L +L  L++ 
Sbjct  118  GHLSKLTHLDMSYNNLQGQVPHSLGNLSKLTHLDLSANILKGQVPHSLGNLSKLTHLDLS  177

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L  V+P  +G L +LTHL LS N
Sbjct  178  DNILSGVVPHSLGNLSKLTHLDLSDN  203


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  + +T L +    I G  P ++ NL  L  LDI NN + G +P ++G LK L  L++ 
Sbjct  382  GLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDISNNNIQGFLPFELGLLKNLTTLDLS  441

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   +P  +  L QL +L  S+N F
Sbjct  442  HNRLNGNLPISLKNLTQLIYLNCSYNFF  469


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G++R +  L++   ++ G  P+ +  +  L  L++  N+++G IPP +G L +L  L I 
Sbjct  286  GNHRQLKYLDISNNNLNGSIPHELGFIKYLGSLNLSTNRISGDIPPSLGNLVKLTHLVIY  345

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L   IPP IG L+ L  L +S N
Sbjct  346  GNSLVGKIPPSIGNLRSLESLEISDN  371


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +L  L I    L G IP +IG L +L  L++ +N LQ  +P  +G L +LTHL LS N  
Sbjct  98   NLESLVIRKIGLEGTIPKEIGHLSKLTHLDMSYNNLQGQVPHSLGNLSKLTHLDLSANIL  157

Query  365  K  367
            K
Sbjct  158  K  158



>ref|XP_007224199.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
 gb|EMJ25398.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
Length=653

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 8/114 (7%)
 Frame = +2

Query  44   DPCGDNDLPPWAG------VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            DPC  N    WA       V C   G    +T L++YA+ I+G  P  +  L +L  L++
Sbjct  52   DPCIPN--ATWASNTANPRVLCDCAGSTCHITHLKIYALDILGEIPRELFELKELIDLNL  109

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
              N L+GPIP +IG+L +L+ L++  N L   +PPEIG L +L  L    N F 
Sbjct  110  GQNVLSGPIPAEIGQLSKLQYLSLGINNLTGPVPPEIGNLSKLLSLSFGSNQFS  163


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  104  DYRVVTELEVYAVSIVGPFPNAV---TNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILN  274
            ++  + +L++  V  +G   +++    NL  L+ L + N +++G IP QIG   +L+ L+
Sbjct  241  NFGALVKLDILRVGDLGEEDSSLGFLENLTSLSTLSLRNCRVSGKIPEQIGNFAKLQYLD  300

Query  275  IRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            + +NKL   IP    +   L  LYL  NN  
Sbjct  301  LSFNKLTGQIPNSFQKFTVLQFLYLGDNNLS  331



>ref|XP_011028448.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=888

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = +2

Query  29   AWVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-  205
            +WVG DPCG      W G+ C+       VT + + ++ + G     ++NL +L  LD+ 
Sbjct  44   SWVGSDPCGSR----WDGILCTNSR----VTSITLASMGLKGTLSGDISNLSELQILDLS  95

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +N +L+GP+PP IG LK+L  L +   +    IP  IG L QLT+L L+ N F
Sbjct  96   YNPELSGPLPPAIGDLKKLTSLILVSCRFSGPIPDTIGSLPQLTYLSLNSNGF  148



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 65/113 (58%), Gaps = 11/113 (10%)
 Frame = +2

Query  32   WVGD--DPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            W GD  DPC       W  VTCS +    +V  L + + ++ G    ++ NL +L  + +
Sbjct  55   WDGDAVDPCS------WNMVTCSPEN---LVISLGIPSQNLSGTLSPSIGNLTNLQTVVL  105

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             NN +TGPIP ++G+L +L+ L++  N L   IPP +G L++L +L L+ N+F
Sbjct  106  QNNNITGPIPSELGKLSKLQTLDLSDNFLSGEIPPSLGHLRRLQYLRLNNNSF  158



>ref|XP_002277606.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Vitis vinifera]
Length=878

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P++  NL +LT L + +N+++G IPPQIG++K L+ L++ +N L   IPPEIG+
Sbjct  177  NLTGVIPSSFGNLTNLTYLYLGSNQISGFIPPQIGKMKNLEFLSLSYNGLHGSIPPEIGK  236

Query  323  LKQLTHLYLSFNNF  364
            L+ L +L+L +NN 
Sbjct  237  LQNLNYLFLDYNNL  250


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  161  PNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTH  340
            P++  NL +LT L + +N+++G IPPQIG++K L++L + +N L   IP EIG+LK L  
Sbjct  255  PSSFGNLTNLTYLYLDSNQISGFIPPQIGKIKNLELLELSYNGLHGPIPLEIGKLKNLKI  314

Query  341  LYLSFNNF  364
            L L +NN 
Sbjct  315  LNLGYNNL  322


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P ++ NL  L  L +H+N+L G IPP+IG++K L    +  N L  VIP   G 
Sbjct  129  NLTGELPLSLANLTQLEYLSLHSNRLHGSIPPEIGKMKNLIYFILHDNNLTGVIPSSFGN  188

Query  323  LKQLTHLYLSFN  358
            L  LT+LYL  N
Sbjct  189  LTNLTYLYLGSN  200


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +2

Query  83   VTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRL  262
            V  S+ G+   +T L + +  I G  P  +  + +L  L++  N L GPIP +IG+LK L
Sbjct  253  VIPSSFGNLTNLTYLYLDSNQISGFIPPQIGKIKNLELLELSYNGLHGPIPLEIGKLKNL  312

Query  263  KILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            KILN+ +N L  VIP   G L  LT+L L  N
Sbjct  313  KILNLGYNNLIGVIPSSFGNLTNLTYLTLGGN  344


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   DNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIP  235
            DN+L    GV  S+ G+   +T L + +  I G  P  +  + +L  L +  N L G IP
Sbjct  175  DNNL---TGVIPSSFGNLTNLTYLYLGSNQISGFIPPQIGKMKNLEFLSLSYNGLHGSIP  231

Query  236  PQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFN  358
            P+IG+L+ L  L + +N L  VIP   G L  LT+LYL  N
Sbjct  232  PEIGKLQNLNYLFLDYNNLTSVIPSSFGNLTNLTYLYLDSN  272


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            +++G  P++  NL +LT L +  N+++G IPP+IG++K L   N+ +N L  VIP   G 
Sbjct  321  NLIGVIPSSFGNLTNLTYLTLGGNQISGFIPPEIGKMKNLIFFNLGYNSLTGVIPSSFGN  380

Query  323  LKQLTHLYLSFN  358
            L  LT L L  N
Sbjct  381  LTHLTSLILRGN  392


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  LEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVI  304
            L +++  + G  P  +  + +L    +H+N LTG IP   G L  L  L +  N++   I
Sbjct  147  LSLHSNRLHGSIPPEIGKMKNLIYFILHDNNLTGVIPSSFGNLTNLTYLYLGSNQISGFI  206

Query  305  PPEIGELKQLTHLYLSFN  358
            PP+IG++K L  L LS+N
Sbjct  207  PPQIGKMKNLEFLSLSYN  224


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  116  VTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQ  295
            + EL +    + G  P+ +  L  L  L +  N LTG +P  +  L +L+ L++  N+L 
Sbjct  96   LVELFLSDCGLNGSIPHQIGTLTQLIILYLPLNNLTGELPLSLANLTQLEYLSLHSNRLH  155

Query  296  DVIPPEIGELKQLTHLYLSFNNF  364
              IPPEIG++K L +  L  NN 
Sbjct  156  GSIPPEIGKMKNLIYFILHDNNL  178


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            S+ G  P++  NL  LT L +  N++ G IPP+IG L  L  L++  N++   IP EI  
Sbjct  369  SLTGVIPSSFGNLTHLTSLILRGNQINGSIPPEIGYLLDLLYLDLNTNQISGFIPEEILN  428

Query  323  LKQLTHLYLSFN  358
            LK+L HL +S N
Sbjct  429  LKKLGHLDISNN  440



>ref|XP_009134023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=953

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            W G DPCG +    W G+TCS     RVV+ + +  +++ G     +  L +L  LD+ +
Sbjct  47   WEGADPCGTS----WVGITCSNN---RVVS-ISLGNLNVEGKLSGDIAALSELQILDLSY  98

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTGP+PP IG LK+LK L +        IP  IG+L+QL +L L+ N F
Sbjct  99   NTGLTGPLPPNIGELKKLKNLILVGCSFTGQIPQSIGQLEQLIYLSLNLNQF  150



>ref|XP_010252232.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=984

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = +2

Query  41   DDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-HNNK  217
            DDPCG     PW GV+C        +T L +  + + G     +    +LT LD+ +N +
Sbjct  81   DDPCGT----PWEGVSCRNSR----ITALSLSTMGLKGTLSGDIGQFTELTTLDLSYNKE  132

Query  218  LTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            LTGP+ P+IG L++L IL +        IP EIG L +LT L L+ NNF
Sbjct  133  LTGPLSPRIGDLQKLNILILAGCGFTGTIPTEIGNLAKLTFLALNSNNF  181



>emb|CDX83184.1| BnaA03g23220D [Brassica napus]
Length=953

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  32   WVGDDPCGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI-H  208
            W G DPCG +    W G+TCS     RVV+ + +  +++ G     +  L +L  LD+ +
Sbjct  47   WEGADPCGTS----WVGITCSNN---RVVS-ISLGNLNVEGKLSGDIAALSELQILDLSY  98

Query  209  NNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            N  LTGP+PP IG LK+LK L +        IP  IG+L+QL +L L+ N F
Sbjct  99   NTGLTGPLPPNIGELKKLKNLILVGCSFTGQIPQSIGQLEQLIYLSLNLNQF  150



>gb|KDP44797.1| hypothetical protein JCGZ_01297 [Jatropha curcas]
Length=1977

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  62   DLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ  241
            D   W GVTCS +  ++ VTEL++ +  + G     + NL  L  LD+ NN  T  IPP+
Sbjct  60   DFCQWYGVTCSRR--HQRVTELDLNSSKLAGTISPYIGNLSFLKVLDLQNNSFTHNIPPE  117

Query  242  IGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            IG L+RL+ L +  N L   IP E+G L +L  LY+  NN 
Sbjct  118  IGSLRRLQRLFLNNNSLTGKIPVELGYLSKLQFLYIQMNNL  158


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  74    WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
             W GVTC     ++ V  L++ ++ + G     + NL  L  LD+ NN   G IP +IGRL
Sbjct  1070  WHGVTCGHL--HQRVIMLDLSSLKLAGSVSPHIGNLSFLRILDLQNNSFNGEIPSEIGRL  1127

Query  254   KRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             +RL+ L +  N     IP  I     L +L + +N  
Sbjct  1128  RRLQQLVLSNNSFSGKIPSNISSCLNLINLQIGWNQL  1164


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +2

Query  101   GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
             G+ + +  L VY   + G  P+++ + L L  L + +N   GPIP  +  LK L+++N  
Sbjct  1514  GNLKNLGVLLVYENMLSGEIPSSLGSCLSLEILSMEDNYFRGPIPSSLSALKALQVINFS  1573

Query  281   WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
              N L   IP  +  L  L  L LSFN+F+
Sbjct  1574  HNNLTGQIPEFLSHLALLIKLNLSFNDFE  1602


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 4/86 (5%)
 Frame = +2

Query  119   TELEVYAVS---IVGPFPNA-VTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWN  286
             T LE+ AV    I G    A + NL++L  L++ NN  +G +P  IG+L++L++L ++ N
Sbjct  1371  TALEILAVDNNMIHGSILAAGIPNLVNLQYLEMWNNNFSGNVPVDIGKLQKLELLYLQNN  1430

Query  287   KLQDVIPPEIGELKQLTHLYLSFNNF  364
                  IP  +G    LT+L LS N+ 
Sbjct  1431  NFSGEIPHSLGNSTLLTYLRLSDNSL  1456


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +2

Query  74    WAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRL  253
             ++G    + G+  ++T L +   S+ G  P +++   +L  LD+  N L+G IPPQ+  L
Sbjct  1432  FSGEIPHSLGNSTLLTYLRLSDNSLHGTIPLSLSECKNLLLLDLSGNYLSGSIPPQVIGL  1491

Query  254   KRLKI-LNIRWNKLQDVIPPEIGELKQL  334
               L I L++  NKL   +P ++G LK L
Sbjct  1492  SSLSIGLDLSLNKLSGPLPVDVGNLKNL  1519



>ref|WP_007565775.1| hypothetical protein [Bacteroides coprocola]
 gb|EDV02071.1| leucine Rich Repeat protein [Bacteroides coprocola DSM 17136]
Length=672

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +2

Query  29   AWVGDDP-CGDNDLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDI  205
            AW  +   C D DL  W GV    QG    V  +++ + ++ G  P+ + NL  L  L++
Sbjct  24   AWTNNSNWCSDADLSEWYGVYTDYQGR---VMSIDLSSNNLTGSLPDEIGNLEVLWTLNL  80

Query  206  HNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +NN+LTG IP  IG+L  L+ L++  N+L   +P E+G ++ L + YLS N  
Sbjct  81   YNNELTGEIPVSIGKLTELRNLDLSQNQLTGGLPSELGNMQNLVYSYLSNNQL  133



>ref|XP_004235483.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Solanum 
lycopersicum]
Length=1032

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 57/108 (53%), Gaps = 8/108 (7%)
 Frame = +2

Query  53   GDNDLP---PWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLT  223
            GDN      P + V  S+Q     +  L  +   I G  P  ++NL++L  LD+ NN LT
Sbjct  363  GDNQFVGTLPHSTVNLSSQ-----LQRLLFFGNRIGGNIPREISNLVNLNLLDMSNNNLT  417

Query  224  GPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            G IP  IGRL  L  LN+  N L  VIP  IG L +L +LYL FN  K
Sbjct  418  GSIPDSIGRLTNLGALNLGNNLLIGVIPSSIGNLTELVYLYLGFNRLK  465


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 0/95 (0%)
 Frame = +2

Query  80   GVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKR  259
            GV  S+ G+   +  L +    + G  P  + N   L RLDI  N LTG IP Q+  L  
Sbjct  442  GVIPSSIGNLTELVYLYLGFNRLKGNIPLTLGNCNQLLRLDISENNLTGSIPQQLIALSS  501

Query  260  LKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L  +   +N L   +P  IG    LT+L  SFNNF
Sbjct  502  LTKVYAYYNSLTGTLPVHIGNWSHLTYLDFSFNNF  536


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++VG  P  V  L  L RL + NN LTG  P  IG L  L+ L + +N L+  +P  + +
Sbjct  167  TLVGQIPYQVGFLTKLVRLYLRNNNLTGIFPVSIGNLTSLEELYLSYNSLEGEVPASLAQ  226

Query  323  LKQLTHLYLSFNNF  364
            L +L  L LS N+F
Sbjct  227  LTKLRLLGLSVNSF  240


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G FP ++ NL  L  L +  N L G +P  + +L +L++L +  N      PP +  
Sbjct  191  NLTGIFPVSIGNLTSLEELYLSYNSLEGEVPASLAQLTKLRLLGLSVNSFSGEFPPSLYN  250

Query  323  LKQLTHLYLSFNNF  364
            L  L  + LSFNNF
Sbjct  251  LSSLELIALSFNNF  264


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            + G  P  +++ ++L  L + +N L G IP Q+G L +L  L +R N L  + P  IG L
Sbjct  144  LTGEIPINLSHCVNLKSLVLDHNTLVGQIPYQVGFLTKLVRLYLRNNNLTGIFPVSIGNL  203

Query  326  KQLTHLYLSFNNFK  367
              L  LYLS+N+ +
Sbjct  204  TSLEELYLSYNSLE  217


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 33/98 (34%), Positives = 45/98 (46%), Gaps = 4/98 (4%)
 Frame = +2

Query  74   WAGVTCS-TQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGR  250
            W GV C  TQ   + V  L +  +S+ G   + + NL  L  LD+  N     IP Q+ R
Sbjct  74   WTGVKCGLTQ---KRVVSLNLKGLSLAGTISSHLGNLSFLNSLDLAENSFHDEIPQQLSR  130

Query  251  LKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            L RL+ LN+ +N L   IP  +     L  L L  N  
Sbjct  131  LSRLQNLNLSFNYLTGEIPINLSHCVNLKSLVLDHNTL  168


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  143  SIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGE  322
            ++ G  P+++  L +L  L++ NN L G IP  IG L  L  L + +N+L+  IP  +G 
Sbjct  415  NLTGSIPDSIGRLTNLGALNLGNNLLIGVIPSSIGNLTELVYLYLGFNRLKGNIPLTLGN  474

Query  323  LKQLTHLYLSFNNF  364
              QL  L +S NN 
Sbjct  475  CNQLLRLDISENNL  488



>gb|KEH19363.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=997

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 7/102 (7%)
 Frame = +2

Query  62   DLPPWAGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQ  241
            D+PP       + G+   +T L +Y  S+VG  P ++ NL  L  L+I +N + G IPP+
Sbjct  343  DIPP-------SLGNLVKLTHLVIYGNSLVGKIPPSIGNLRSLESLEISDNYIQGSIPPR  395

Query  242  IGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +G LK L  L +  N+++  IPP +G LKQL  L +S NN +
Sbjct  396  LGLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDISNNNIQ  437


 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  146  IVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGEL  325
            I G  P ++ NL+ LT L I+ N L G IPP IG L+ L+ L I  N +Q  IPP +G L
Sbjct  340  ISGDIPPSLGNLVKLTHLVIYGNSLVGKIPPSIGNLRSLESLEISDNYIQGSIPPRLGLL  399

Query  326  KQLTHLYLSFNNFK  367
            K LT L LS N  K
Sbjct  400  KNLTTLRLSHNRIK  413


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +2

Query  77   AGVTCSTQGDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLK  256
            +GV   + G+   +T L++    + G  P+++ NL  LT LD+ +N L+G +PP +G L 
Sbjct  197  SGVVPHSLGNLSKLTHLDLSDNLLSGVVPHSLGNLSKLTHLDLSDNLLSGVVPPSLGNLS  256

Query  257  RLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
            +L  L++  N L+  +P  +G L +LTHL  S+N+ +
Sbjct  257  KLTHLDLSVNLLKGQVPHSLGNLSKLTHLDFSYNSLE  293


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L++    + G  P+++ NL  LT LD+ +N L+G +P  +G L +L  L++ 
Sbjct  181  GNLSKLTHLDLSDNILSGVVPHSLGNLSKLTHLDLSDNLLSGVVPHSLGNLSKLTHLDLS  240

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNFK  367
             N L  V+PP +G L +LTHL LS N  K
Sbjct  241  DNLLSGVVPPSLGNLSKLTHLDLSVNLLK  269


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L+    S+ G  PN++ N   L  LDI NN L G IP ++G +K L  LN+ 
Sbjct  277  GNLSKLTHLDFSYNSLEGEIPNSLGNHRQLKYLDISNNNLNGSIPHELGFIKYLGSLNLS  336

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N++   IPP +G L +LTHL +  N+ 
Sbjct  337  TNRISGDIPPSLGNLVKLTHLVIYGNSL  364


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+ R +  LE+    I G  P  +  L +LT L + +N++ G IPP +G LK+L+ L+I 
Sbjct  373  GNLRSLESLEISDNYIQGSIPPRLGLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDIS  432

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N +Q  +P E+G LK LT L LS N
Sbjct  433  NNNIQGFLPFELGLLKNLTTLDLSHN  458


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G+   +T L++ A  + G  P+++ NL  LT LD+ +N L+G +P  +G L +L  L++ 
Sbjct  157  GNLSKLTHLDLSANILKGQVPHSLGNLSKLTHLDLSDNILSGVVPHSLGNLSKLTHLDLS  216

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L  V+P  +G L +LTHL LS N
Sbjct  217  DNLLSGVVPHSLGNLSKLTHLDLSDN  242


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G    +T L++   ++ G  P+++ NL  LT LD+  N L G +P  +G L +L  L++ 
Sbjct  133  GHLSKLTHLDMSYNNLQGQVPHSLGNLSKLTHLDLSANILKGQVPHSLGNLSKLTHLDLS  192

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L  V+P  +G L +LTHL LS N
Sbjct  193  DNILSGVVPHSLGNLSKLTHLDLSDN  218


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G  + +T L +    I G  P ++ NL  L  LDI NN + G +P ++G LK L  L++ 
Sbjct  397  GLLKNLTTLRLSHNRIKGEIPPSLGNLKQLEELDISNNNIQGFLPFELGLLKNLTTLDLS  456

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFNNF  364
             N+L   +P  +  L QL +L  S+N F
Sbjct  457  HNRLNGNLPISLKNLTQLIYLNCSYNFF  484


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  GDYRVVTELEVYAVSIVGPFPNAVTNLLDLTRLDIHNNKLTGPIPPQIGRLKRLKILNIR  280
            G++R +  L++   ++ G  P+ +  +  L  L++  N+++G IPP +G L +L  L I 
Sbjct  301  GNHRQLKYLDISNNNLNGSIPHELGFIKYLGSLNLSTNRISGDIPPSLGNLVKLTHLVIY  360

Query  281  WNKLQDVIPPEIGELKQLTHLYLSFN  358
             N L   IPP IG L+ L  L +S N
Sbjct  361  GNSLVGKIPPSIGNLRSLESLEISDN  386


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  185  DLTRLDIHNNKLTGPIPPQIGRLKRLKILNIRWNKLQDVIPPEIGELKQLTHLYLSFNNF  364
            +L  L I    L G IP +IG L +L  L++ +N LQ  +P  +G L +LTHL LS N  
Sbjct  113  NLESLVIRKIGLEGTIPKEIGHLSKLTHLDMSYNNLQGQVPHSLGNLSKLTHLDLSANIL  172

Query  365  K  367
            K
Sbjct  173  K  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514511713122