BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1394_g1_i1 len=1193 path=[1171:0-471 1643:472-1192]

Length=1193
                                                                      Score     E

ref|XP_009761236.1|  PREDICTED: pathogenesis-related protein 5-like     413   4e-140   
ref|XP_009630599.1|  PREDICTED: pathogenesis-related protein 5-like     411   3e-139   
ref|XP_010314840.1|  PREDICTED: pathogenesis-related protein 5-like     406   2e-137   
ref|XP_006349436.1|  PREDICTED: pathogenesis-related protein 5-like     402   2e-135   
emb|CDO97536.1|  unnamed protein product                                360   1e-119   
ref|XP_007018987.1|  Pathogenesis-related thaumatin superfamily p...    352   4e-116   
emb|CDP12448.1|  unnamed protein product                                350   2e-115   
ref|XP_008218810.1|  PREDICTED: thaumatin-like protein                  350   2e-115   
ref|XP_007226798.1|  hypothetical protein PRUPE_ppa018160mg             350   3e-115   
ref|XP_008233902.1|  PREDICTED: pathogenesis-related protein 5          348   8e-115   
ref|XP_007222068.1|  hypothetical protein PRUPE_ppa009575mg             348   1e-114   
ref|XP_010091351.1|  hypothetical protein L484_020153                   347   3e-114   
ref|XP_010274354.1|  PREDICTED: pathogenesis-related protein 5-like     343   7e-113   
ref|XP_011088126.1|  PREDICTED: thaumatin-like protein                  342   1e-112   
gb|EYU23904.1|  hypothetical protein MIMGU_mgv1a011450mg                342   2e-112   
ref|XP_009598313.1|  PREDICTED: pathogenesis-related protein 5-like     342   2e-112   
ref|XP_006579469.1|  PREDICTED: uncharacterized protein LOC100818...    342   2e-112   
ref|XP_009367296.1|  PREDICTED: pathogenesis-related protein 5-like     342   4e-112   
ref|XP_010272861.1|  PREDICTED: pathogenesis-related protein 5          342   4e-112   
ref|XP_008378490.1|  PREDICTED: pathogenesis-related protein 5-like     341   7e-112   
ref|XP_009799009.1|  PREDICTED: pathogenesis-related protein 5-like     340   2e-111   
ref|XP_006386379.1|  hypothetical protein POPTR_0002s08760g             338   6e-111   
ref|XP_011027593.1|  PREDICTED: thaumatin-like protein                  338   7e-111   
ref|XP_011012813.1|  PREDICTED: thaumatin-like protein                  338   7e-111   
ref|XP_003531305.2|  PREDICTED: thaumatin-like protein-like             337   2e-110   
ref|XP_007159594.1|  hypothetical protein PHAVU_002G250400g             336   7e-110   
ref|XP_002273271.2|  PREDICTED: thaumatin-like protein                  335   1e-109   Vitis vinifera
ref|XP_011075024.1|  PREDICTED: thaumatin-like protein                  335   1e-109   
ref|XP_010471966.1|  PREDICTED: pathogenesis-related protein 5-like     333   6e-109   
ref|XP_006493528.1|  PREDICTED: pathogenesis-related protein 5-like     333   1e-108   
ref|XP_010416727.1|  PREDICTED: pathogenesis-related protein 5-like     332   1e-108   
ref|XP_006431908.1|  hypothetical protein CICLE_v10002066mg             332   3e-108   
ref|XP_004513301.1|  PREDICTED: pathogenesis-related protein 5-like     331   8e-108   
ref|XP_008465794.1|  PREDICTED: thaumatin-like protein                  330   1e-107   
gb|KGN50964.1|  hypothetical protein Csa_5G374740                       331   1e-107   
ref|XP_010063355.1|  PREDICTED: pathogenesis-related protein 5          330   1e-107   
ref|XP_010668000.1|  PREDICTED: thaumatin-like protein                  330   2e-107   
ref|XP_006472729.1|  PREDICTED: thaumatin-like protein-like             329   4e-107   
ref|XP_007141088.1|  hypothetical protein PHAVU_008G166500g             328   6e-107   
ref|XP_002284403.3|  PREDICTED: pathogenesis-related protein 5          329   6e-107   Vitis vinifera
ref|XP_010912035.1|  PREDICTED: pathogenesis-related protein 5          328   7e-107   
ref|XP_006434136.1|  hypothetical protein CICLE_v10002069mg             328   1e-106   
gb|KDO80739.1|  hypothetical protein CISIN_1g023852mg                   327   1e-106   
emb|CDY44520.1|  BnaCnng11310D                                          327   2e-106   
ref|XP_002528602.1|  Protein P21, putative                              327   3e-106   Ricinus communis
ref|XP_009128246.1|  PREDICTED: pathogenesis-related protein 5-like     327   4e-106   
ref|XP_002303159.2|  hypothetical protein POPTR_0003s01430g             327   4e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011007951.1|  PREDICTED: pathogenesis-related protein 5-like     326   6e-106   
ref|XP_006369356.1|  hypothetical protein POPTR_0001s21790g             326   7e-106   
gb|KDO50915.1|  hypothetical protein CISIN_1g024541mg                   325   1e-105   
ref|XP_011001430.1|  PREDICTED: thaumatin-like protein                  325   2e-105   
gb|KDP38887.1|  hypothetical protein JCGZ_05044                         325   2e-105   
ref|XP_002307423.1|  hypothetical protein POPTR_0005s16030g             324   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_009341686.1|  PREDICTED: thaumatin-like protein                  322   3e-105   
ref|XP_002447372.1|  hypothetical protein SORBIDRAFT_06g033910          323   5e-105   Sorghum bicolor [broomcorn]
ref|XP_009414593.1|  PREDICTED: pathogenesis-related protein 5-like     323   5e-105   
ref|XP_004140385.1|  PREDICTED: thaumatin-like protein-like             324   5e-105   
ref|XP_011005199.1|  PREDICTED: pathogenesis-related protein 5-like     324   6e-105   
ref|XP_003544148.2|  PREDICTED: pathogenesis-related protein 5-like     323   7e-105   
ref|XP_003543788.1|  PREDICTED: pathogenesis-related protein 5-like     323   8e-105   
ref|XP_004172611.1|  PREDICTED: thaumatin-like protein-like             322   2e-104   
ref|XP_010428854.1|  PREDICTED: thaumatin-like protein                  321   4e-104   
ref|XP_003614785.1|  Pathogenesis-related protein                       320   9e-104   
ref|XP_004250343.2|  PREDICTED: pathogenesis-related protein 5          320   1e-103   
ref|XP_006302655.1|  hypothetical protein CARUB_v10020759mg             320   1e-103   
ref|XP_007041520.1|  Pathogenesis-related thaumatin superfamily p...    319   2e-103   
ref|XP_008785871.1|  PREDICTED: pathogenesis-related protein 5          319   2e-103   
ref|XP_009419395.1|  PREDICTED: pathogenesis-related protein 5-li...    319   3e-103   
ref|XP_003574984.1|  PREDICTED: pathogenesis-related protein 5-like     318   6e-103   
gb|KDP32764.1|  hypothetical protein JCGZ_12056                         317   1e-102   
ref|XP_009419393.1|  PREDICTED: pathogenesis-related protein 5-li...    318   1e-102   
ref|XP_009419392.1|  PREDICTED: pathogenesis-related protein 5-li...    318   1e-102   
emb|CDX68047.1|  BnaA07g20870D                                          317   1e-102   
ref|XP_010065499.1|  PREDICTED: pathogenesis-related protein 5-li...    317   2e-102   
emb|CDX79230.1|  BnaC06g20730D                                          317   4e-102   
ref|XP_010065498.1|  PREDICTED: pathogenesis-related protein 5-li...    316   5e-102   
ref|XP_010103888.1|  hypothetical protein L484_024191                   315   6e-102   
ref|XP_006653913.1|  PREDICTED: pathogenesis-related protein 5-like     315   9e-102   
ref|XP_006390065.1|  hypothetical protein EUTSA_v10019646mg             314   1e-101   
gb|KHN34468.1|  Pathogenesis-related protein 5                          315   1e-101   
gb|EEC78305.1|  hypothetical protein OsI_18027                          314   3e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_010521235.1|  PREDICTED: thaumatin-like protein                  315   3e-101   
ref|XP_004292680.1|  PREDICTED: thaumatin-like protein-like             311   7e-101   
ref|NP_001054348.1|  Os04g0689900                                       312   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104608.1|  PREDICTED: thaumatin-like protein                  311   3e-100   
ref|XP_008456085.1|  PREDICTED: pathogenesis-related protein 5-li...    311   4e-100   
gb|EPS67898.1|  hypothetical protein M569_06877                         309   7e-100   
gb|KFK42166.1|  hypothetical protein AALP_AA2G219700                    310   1e-99    
ref|XP_008352662.1|  PREDICTED: pathogenesis-related protein 5-like     309   2e-99    
ref|XP_004149961.1|  PREDICTED: thaumatin-like protein-like             309   4e-99    
ref|XP_002459540.1|  hypothetical protein SORBIDRAFT_02g006300          306   3e-98    Sorghum bicolor [broomcorn]
emb|CAB53479.1|  CAA30376.1 protein                                     319   9e-98    Oryza sativa [red rice]
ref|NP_177893.1|  Pathogenesis-related thaumatin superfamily protein    307   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041521.1|  Pathogenesis-related thaumatin superfamily p...    301   1e-96    
dbj|BAJ93087.1|  predicted protein                                      302   1e-96    
emb|CAJ86348.1|  H0814G11.15                                            299   7e-96    Oryza sativa [red rice]
ref|XP_002887695.1|  predicted protein                                  298   2e-95    
ref|XP_008361553.1|  PREDICTED: pathogenesis-related protein 5-like     299   4e-95    
ref|XP_008456086.1|  PREDICTED: pathogenesis-related protein 5-li...    296   5e-95    
ref|XP_004959962.1|  PREDICTED: pathogenesis-related protein 5-like     296   2e-94    
ref|XP_006847064.1|  hypothetical protein AMTR_s00017p00203890          298   3e-94    
ref|XP_006847062.1|  hypothetical protein AMTR_s00017p00203180          285   1e-90    
ref|XP_008650876.1|  PREDICTED: putative thaumatin domain family ...    286   2e-90    
ref|XP_004973784.1|  PREDICTED: thaumatin-like protein-like             286   3e-90    
ref|NP_001131821.2|  putative thaumatin domain family protein pre...    272   1e-85    Zea mays [maize]
ref|NP_001242274.1|  uncharacterized protein LOC100818786 precursor     266   2e-83    
ref|XP_010240659.1|  PREDICTED: pathogenesis-related protein 5-like     256   1e-78    
ref|NP_177642.2|  pathogenesis-related thaumatin-like protein pro...    242   8e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545287.2|  PREDICTED: pathogenesis-related protein 5-like     241   2e-73    
ref|XP_003545288.2|  PREDICTED: pathogenesis-related protein 5-like     240   5e-73    
gb|AAG51919.1|AC013258_13  thaumatin-like protein; 23251-22305          240   6e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147654.1|  LOC100281263 precursor                             239   7e-73    Zea mays [maize]
gb|ABL86687.1|  TLP1                                                    238   2e-72    Gossypium barbadense [Egyptian cotton]
ref|XP_006301180.1|  hypothetical protein CARUB_v10021579mg             238   3e-72    
gb|KHG08802.1|  hypothetical protein F383_35963                         237   5e-72    
gb|KFK44066.1|  hypothetical protein AALP_AA1G211800                    237   5e-72    
ref|XP_010471608.1|  PREDICTED: pathogenesis-related protein 5-like     237   6e-72    
ref|XP_006473452.1|  PREDICTED: pathogenesis-related protein 5-like     236   9e-72    
ref|XP_006434928.1|  hypothetical protein CICLE_v10002288mg             236   1e-71    
ref|XP_009595245.1|  PREDICTED: pathogenesis-related protein 5          236   1e-71    
ref|XP_009417646.1|  PREDICTED: thaumatin-like protein                  236   2e-71    
emb|CDY46016.1|  BnaA02g17100D                                          236   2e-71    
gb|ABR17407.1|  unknown                                                 236   2e-71    Picea sitchensis
ref|XP_010428505.1|  PREDICTED: pathogenesis-related protein 5 is...    235   3e-71    
ref|XP_002264550.2|  PREDICTED: pathogenesis-related protein 5-like     234   4e-71    Vitis vinifera
ref|XP_009110283.1|  PREDICTED: pathogenesis-related protein 5-like     234   5e-71    
emb|CDX83771.1|  BnaC08g18740D                                          234   7e-71    
ref|XP_002529658.1|  Zeamatin precursor, putative                       236   7e-71    Ricinus communis
emb|CDX73133.1|  BnaC06g35810D                                          234   7e-71    
ref|XP_002890328.1|  hypothetical protein ARALYDRAFT_472154             234   9e-71    
ref|XP_010416369.1|  PREDICTED: pathogenesis-related protein 5-like     234   9e-71    
ref|XP_009128072.1|  PREDICTED: pathogenesis-related protein 5-like     234   1e-70    
ref|XP_009760388.1|  PREDICTED: pathogenesis-related protein 5-like     234   1e-70    
ref|XP_006574674.1|  PREDICTED: thaumatin-like protein 1-like           236   1e-70    
ref|XP_009391386.1|  PREDICTED: thaumatin-like protein                  234   1e-70    
ref|XP_010428506.1|  PREDICTED: pathogenesis-related protein 5 is...    234   1e-70    
ref|XP_009106158.1|  PREDICTED: pathogenesis-related protein 5-like     234   1e-70    
gb|KFK41942.1|  hypothetical protein AALP_AA2G192200                    234   1e-70    
ref|XP_002887572.1|  hypothetical protein ARALYDRAFT_316436             234   1e-70    
ref|XP_006856120.1|  hypothetical protein AMTR_s00059p00148770          233   1e-70    
ref|XP_008670298.1|  PREDICTED: thaumatin-like protein 1b               236   2e-70    
ref|XP_010929479.1|  PREDICTED: pathogenesis-related protein 5-like     235   2e-70    
emb|CDX83773.1|  BnaC08g18720D                                          233   2e-70    
ref|XP_002513767.1|  naringenin-chalcone synthase, putative             238   3e-70    Ricinus communis
ref|XP_007017454.1|  Thaumatin-like protein 3                           233   3e-70    
ref|XP_002460468.1|  hypothetical protein SORBIDRAFT_02g028890          235   5e-70    Sorghum bicolor [broomcorn]
ref|XP_009110282.1|  PREDICTED: pathogenesis-related protein 5-like     232   6e-70    
emb|CDY37263.1|  BnaCnng08170D                                          231   8e-70    
emb|CDY41037.1|  BnaC05g14950D                                          231   2e-69    
gb|EPS57386.1|  zeamatin                                                231   2e-69    
gb|KFK33653.1|  hypothetical protein AALP_AA5G041900                    231   2e-69    
ref|XP_009149407.1|  PREDICTED: pathogenesis-related protein 5-like     230   2e-69    
ref|XP_009795150.1|  PREDICTED: pathogenesis-related protein 5-li...    230   2e-69    
emb|CDP01888.1|  unnamed protein product                                233   2e-69    
gb|KEH19055.1|  pathogenesis-related thaumatin family protein           230   3e-69    
ref|XP_006661394.1|  PREDICTED: pathogenesis-related protein 5-like     233   3e-69    
ref|XP_009622122.1|  PREDICTED: thaumatin-like protein 1                234   3e-69    
dbj|BAD90814.1|  thaumatin-like protein                                 230   3e-69    Cryptomeria japonica
ref|XP_010519216.1|  PREDICTED: thaumatin-like protein                  230   3e-69    
ref|XP_006599328.1|  PREDICTED: thaumatin-like protein 1-like           232   4e-69    
ref|XP_006390357.1|  hypothetical protein EUTSA_v10019680mg             230   4e-69    
ref|XP_009419984.1|  PREDICTED: pathogenesis-related protein 5-like     231   4e-69    
gb|ABK25809.1|  unknown                                                 229   5e-69    Picea sitchensis
ref|XP_009607714.1|  PREDICTED: pathogenesis-related protein 5-like     232   6e-69    
ref|XP_009117553.1|  PREDICTED: pathogenesis-related protein 5-li...    229   7e-69    
ref|NP_001288837.1|  thaumatin-like protein precursor                   229   7e-69    
ref|XP_006416518.1|  hypothetical protein EUTSA_v10008604mg             229   7e-69    
ref|XP_009117552.1|  PREDICTED: pathogenesis-related protein 5-li...    229   8e-69    
emb|CDX96487.1|  BnaA07g30980D                                          229   8e-69    
gb|KDP26886.1|  hypothetical protein JCGZ_18044                         228   9e-69    
ref|XP_010262514.1|  PREDICTED: thaumatin-like protein isoform X2       229   1e-68    
ref|XP_011084258.1|  PREDICTED: thaumatin-like protein                  229   1e-68    
ref|XP_004516152.1|  PREDICTED: thaumatin-like protein-like             228   1e-68    
gb|KFK41805.1|  hypothetical protein AALP_AA2G174200                    228   1e-68    
ref|XP_009106020.1|  PREDICTED: thaumatin-like protein isoform X2       229   1e-68    
ref|XP_002887570.1|  hypothetical protein ARALYDRAFT_476641             228   1e-68    
ref|XP_006302689.1|  hypothetical protein CARUB_v10020799mg             229   2e-68    
ref|XP_010262463.1|  PREDICTED: thaumatin-like protein isoform X1       228   2e-68    
ref|XP_010416362.1|  PREDICTED: pathogenesis-related protein 5-like     228   2e-68    
ref|XP_003629298.1|  Thaumatin-like protein                             230   2e-68    
ref|XP_006383093.1|  hypothetical protein POPTR_0005s11480g             231   2e-68    
ref|XP_010941295.1|  PREDICTED: thaumatin-like protein 1b               230   2e-68    
ref|XP_009795149.1|  PREDICTED: pathogenesis-related protein 5-li...    231   2e-68    
ref|XP_008680256.1|  PREDICTED: thaumatin-like protein 1b               231   2e-68    
emb|CDY68760.1|  BnaAnng28270D                                          228   2e-68    
ref|XP_004293225.1|  PREDICTED: pathogenesis-related protein 5-like     228   2e-68    
ref|XP_010471602.1|  PREDICTED: pathogenesis-related protein 5-like     228   2e-68    
ref|XP_010266794.1|  PREDICTED: thaumatin-like protein 1b               230   3e-68    
ref|XP_010245598.1|  PREDICTED: thaumatin-like protein 1b               230   3e-68    
ref|XP_011092890.1|  PREDICTED: thaumatin-like protein 1b               231   3e-68    
gb|KEH20376.1|  pathogenesis-related thaumatin family protein           228   3e-68    
ref|XP_010428509.1|  PREDICTED: pathogenesis-related protein 5          227   4e-68    
ref|XP_011088584.1|  PREDICTED: thaumatin-like protein 1b               230   4e-68    
ref|XP_004501042.1|  PREDICTED: pathogenesis-related protein 5-like     227   4e-68    
ref|XP_010530276.1|  PREDICTED: pathogenesis-related protein 5-like     227   4e-68    
ref|XP_007209509.1|  hypothetical protein PRUPE_ppa010418mg             227   4e-68    
ref|XP_008393422.1|  PREDICTED: thaumatin-like protein                  227   4e-68    
ref|NP_001031064.1|  Thaumatin-like protein                             227   5e-68    Arabidopsis thaliana [mouse-ear cress]
emb|CDX72995.1|  BnaC06g34430D                                          228   5e-68    
ref|XP_003539647.1|  PREDICTED: thaumatin-like protein-like             226   5e-68    
ref|XP_006341532.1|  PREDICTED: thaumatin-like protein-like             227   6e-68    
ref|XP_004509365.1|  PREDICTED: pathogenesis-related protein 5-li...    229   6e-68    
ref|XP_008337996.1|  PREDICTED: thaumatin-like protein 1                227   6e-68    
ref|XP_007160531.1|  hypothetical protein PHAVU_002G329400g             227   6e-68    
ref|XP_004509366.1|  PREDICTED: pathogenesis-related protein 5-li...    227   6e-68    
ref|XP_007046679.1|  Pathogenesis-related thaumatin superfamily p...    229   6e-68    
ref|NP_177640.1|  thaumatin-like protein 3                              226   6e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160788.1|  hypothetical protein PHAVU_001G016700g             226   7e-68    
ref|NP_173261.1|  Thaumatin-like protein                                226   7e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444818.1|  PREDICTED: thaumatin-like protein 1b               226   9e-68    
ref|XP_007202291.1|  hypothetical protein PRUPE_ppa009119mg             228   1e-67    
ref|XP_004512141.1|  PREDICTED: thaumatin-like protein 1-like           228   1e-67    
ref|XP_007157907.1|  hypothetical protein PHAVU_002G107800g             229   1e-67    
gb|EYU37936.1|  hypothetical protein MIMGU_mgv1a009447mg                229   1e-67    
ref|XP_011083577.1|  PREDICTED: thaumatin-like protein 1b               228   1e-67    
gb|KHG07208.1|  hypothetical protein F383_34305                         228   1e-67    
ref|XP_008352435.1|  PREDICTED: thaumatin-like protein 1                228   1e-67    
ref|XP_010459436.1|  PREDICTED: thaumatin-like protein                  226   1e-67    
ref|XP_006390358.1|  hypothetical protein EUTSA_v10019046mg             226   1e-67    
ref|XP_009785059.1|  PREDICTED: thaumatin-like protein isoform X2       226   1e-67    
emb|CDP07567.1|  unnamed protein product                                226   2e-67    
ref|XP_011016697.1|  PREDICTED: thaumatin-like protein 1b               228   2e-67    
gb|KFK30232.1|  hypothetical protein AALP_AA7G234800                    225   2e-67    
ref|XP_010416366.1|  PREDICTED: pathogenesis-related protein 5-like     225   2e-67    
emb|CDY19198.1|  BnaC05g13990D                                          225   2e-67    
ref|XP_004235810.1|  PREDICTED: thaumatin-like protein                  225   2e-67    
ref|XP_008240157.1|  PREDICTED: thaumatin-like protein                  225   2e-67    
ref|XP_006390359.1|  hypothetical protein EUTSA_v10019053mg             225   3e-67    
ref|XP_003530957.2|  PREDICTED: thaumatin-like protein-like             225   3e-67    
ref|XP_008801393.1|  PREDICTED: pathogenesis-related protein 5-li...    226   3e-67    
ref|XP_010061079.1|  PREDICTED: thaumatin-like protein 1b               228   3e-67    
emb|CAN80000.1|  hypothetical protein VITISV_043971                     236   3e-67    Vitis vinifera
ref|XP_010097569.1|  hypothetical protein L484_017379                   225   3e-67    
ref|XP_010498212.1|  PREDICTED: thaumatin-like protein                  225   3e-67    
ref|XP_008801392.1|  PREDICTED: pathogenesis-related protein 5-li...    226   3e-67    
ref|XP_008803099.1|  PREDICTED: thaumatin-like protein                  224   4e-67    
ref|XP_003563464.1|  PREDICTED: thaumatin-like protein                  225   4e-67    
ref|XP_010459595.1|  PREDICTED: pathogenesis-related protein 5-like     225   4e-67    
ref|XP_009356044.1|  PREDICTED: thaumatin-like protein                  225   4e-67    
gb|KGN62685.1|  hypothetical protein Csa_2G368860                       226   4e-67    
gb|EPS57841.1|  hypothetical protein M569_16976                         226   4e-67    
gb|AAA32875.1|  thaumatin-like protein                                  224   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026231.1|  PREDICTED: pathogenesis-related protein 5          224   5e-67    
gb|KEH36134.1|  pathogenesis-related thaumatin family protein           224   5e-67    
ref|XP_002892990.1|  hypothetical protein ARALYDRAFT_889237             224   5e-67    
gb|ACU65941.1|  pathogenesis-related 5 protein                          224   6e-67    
ref|XP_002277548.1|  PREDICTED: thaumatin-like protein 1b               228   6e-67    Vitis vinifera
ref|XP_009379396.1|  PREDICTED: thaumatin-like protein 1                226   6e-67    
ref|XP_007160787.1|  hypothetical protein PHAVU_001G016600g             224   6e-67    
ref|XP_009106162.1|  PREDICTED: pathogenesis-related protein 5          224   7e-67    
ref|XP_006416627.1|  hypothetical protein EUTSA_v10008614mg             224   8e-67    
ref|XP_010066268.1|  PREDICTED: thaumatin-like protein 1b               227   8e-67    
gb|AAO64168.1|  putative pathogenesis-related protein 5 precursor       224   9e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141401.1|  hypothetical protein PHAVU_008G192300g             224   1e-66    
gb|KDP36909.1|  hypothetical protein JCGZ_08200                         226   1e-66    
ref|XP_008808638.1|  PREDICTED: thaumatin-like protein 1b               225   1e-66    
ref|XP_006466958.1|  PREDICTED: pathogenesis-related protein 5-li...    223   1e-66    
ref|XP_006451631.1|  hypothetical protein CICLE_v10009291mg             224   1e-66    
gb|AAM62907.1|  thaumatin-like protein                                  223   1e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257784.1|  PREDICTED: thaumatin-like protein                  223   1e-66    
ref|NP_001288814.1|  thaumatin-like protein precursor                   223   1e-66    
ref|XP_009414066.1|  PREDICTED: thaumatin-like protein                  224   1e-66    
ref|NP_177503.1|  pathogenesis-related thaumatin-like protein           224   1e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003612190.1|  Thaumatin-like protein                             226   1e-66    
ref|XP_006851913.1|  hypothetical protein AMTR_s00041p00163280          226   1e-66    
ref|XP_009785058.1|  PREDICTED: thaumatin-like protein isoform X1       223   1e-66    
ref|XP_010539926.1|  PREDICTED: pathogenesis-related protein 5-like     223   1e-66    
gb|KHG17165.1|  hypothetical protein F383_22419                         223   1e-66    
ref|NP_001058421.1|  Os06g0691200                                       223   2e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006590727.1|  PREDICTED: thaumatin-like protein 1-like iso...    223   2e-66    
ref|XP_007156160.1|  hypothetical protein PHAVU_003G263400g             225   2e-66    
emb|CDY26178.1|  BnaA06g12390D                                          223   2e-66    
ref|XP_006384568.1|  hypothetical protein POPTR_0004s17890g             226   2e-66    
ref|XP_004147029.1|  PREDICTED: pathogenesis-related protein 5-like     226   2e-66    
ref|XP_010471604.1|  PREDICTED: pathogenesis-related protein 5-like     223   2e-66    
ref|XP_010416364.1|  PREDICTED: pathogenesis-related protein 5-like     223   2e-66    
gb|KCW67976.1|  hypothetical protein EUGRSUZ_F01670                     223   2e-66    
gb|AAB71214.1|  thaumatin-like protein                                  223   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|NP_177641.1|  pathogenesis-related protein 5                        222   3e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973952.1|  PREDICTED: pathogenesis-related protein 5-like     227   3e-66    
ref|XP_002887571.1|  hypothetical protein ARALYDRAFT_895371             222   3e-66    
ref|XP_006466957.1|  PREDICTED: pathogenesis-related protein 5-li...    224   3e-66    
ref|XP_010428504.1|  PREDICTED: pathogenesis-related protein 5          222   3e-66    
ref|XP_003537638.1|  PREDICTED: thaumatin-like protein 1-like iso...    224   3e-66    
ref|XP_008457672.1|  PREDICTED: thaumatin-like protein 1b               226   3e-66    
ref|XP_009794244.1|  PREDICTED: thaumatin-like protein 1b               224   4e-66    
ref|XP_003545289.2|  PREDICTED: pathogenesis-related protein 5-like     222   4e-66    
ref|XP_010471607.1|  PREDICTED: pathogenesis-related protein 5          222   4e-66    
ref|XP_003549422.2|  PREDICTED: pathogenesis-related protein 5-like     222   4e-66    
ref|XP_010033497.1|  PREDICTED: thaumatin-like protein 1b               224   4e-66    
ref|XP_004505780.1|  PREDICTED: thaumatin-like protein 1-like           225   4e-66    
gb|KHG02948.1|  Thaumatin-like protein 1                                224   4e-66    
ref|XP_006379282.1|  hypothetical protein POPTR_0009s13510g             225   4e-66    
gb|ABK94543.1|  unknown                                                 225   4e-66    
ref|XP_002313721.2|  hypothetical protein POPTR_0009s13510g             225   5e-66    
gb|KFK41943.1|  hypothetical protein AALP_AA2G192300                    221   5e-66    
gb|ABK92515.1|  unknown                                                 225   5e-66    
gb|KHG15300.1|  Thaumatin-like protein 1                                224   5e-66    
ref|XP_007219826.1|  hypothetical protein PRUPE_ppa026643mg             221   5e-66    
gb|KHG02944.1|  hypothetical protein F383_23941                         225   5e-66    
ref|NP_173365.2|  pathogenesis-related thaumatin-like protein           222   5e-66    
emb|CDP07385.1|  unnamed protein product                                224   5e-66    
gb|AHC69780.1|  thuamatin-like protein                                  222   5e-66    
emb|CDP01890.1|  unnamed protein product                                225   5e-66    
gb|KHG27805.1|  Thaumatin-like protein 1a                               224   5e-66    
gb|KHG05671.1|  Thaumatin-like protein 1                                223   5e-66    
ref|XP_009363485.1|  PREDICTED: thaumatin-like protein 1                224   6e-66    
ref|XP_004957250.1|  PREDICTED: pathogenesis-related protein 5-like     224   7e-66    
ref|XP_010536400.1|  PREDICTED: thaumatin-like protein 1b               224   7e-66    
emb|CDX73137.1|  BnaC06g35850D                                          221   7e-66    
ref|XP_002887494.1|  hypothetical protein ARALYDRAFT_476498             221   8e-66    
ref|XP_008444682.1|  PREDICTED: pathogenesis-related protein 5-like     221   8e-66    
ref|XP_004152647.1|  PREDICTED: thaumatin-like protein 1a-like          221   8e-66    
ref|XP_011046468.1|  PREDICTED: pathogenesis-related protein 5-li...    224   8e-66    
gb|KGN62571.1|  hypothetical protein Csa_2G361370                       221   9e-66    
ref|XP_006303313.1|  hypothetical protein CARUB_v10010135mg             221   9e-66    
ref|XP_011046459.1|  PREDICTED: pathogenesis-related protein 5-li...    224   9e-66    
emb|CDP07386.1|  unnamed protein product                                223   9e-66    
ref|XP_003540838.1|  PREDICTED: thaumatin-like protein 1-like           224   9e-66    
ref|XP_006486762.1|  PREDICTED: thaumatin-like protein 1-like           225   9e-66    
ref|XP_007201407.1|  hypothetical protein PRUPE_ppa008035mg             224   9e-66    
ref|XP_008233674.1|  PREDICTED: thaumatin-like protein                  221   1e-65    
ref|XP_002306940.2|  hypothetical protein POPTR_0005s26250g             224   1e-65    
ref|XP_010248229.1|  PREDICTED: pathogenesis-related protein 5-like     221   1e-65    
ref|XP_006425448.1|  hypothetical protein CICLE_v10026139mg             223   1e-65    
ref|XP_007157908.1|  hypothetical protein PHAVU_002G107900g             224   1e-65    
ref|XP_010555234.1|  PREDICTED: thaumatin-like protein 1b               224   1e-65    
gb|KDO84883.1|  hypothetical protein CISIN_1g026056mg                   221   1e-65    
ref|XP_010106041.1|  hypothetical protein L484_021218                   221   1e-65    
ref|XP_011001989.1|  PREDICTED: thaumatin-like protein 1b isoform X2    224   1e-65    
ref|XP_006390535.1|  hypothetical protein EUTSA_v10019050mg             221   1e-65    
ref|XP_011001987.1|  PREDICTED: thaumatin-like protein 1b isoform X1    224   1e-65    
ref|XP_006422635.1|  hypothetical protein CICLE_v10028716mg             224   1e-65    
gb|KDO68004.1|  hypothetical protein CISIN_1g018813mg                   224   1e-65    
ref|XP_006422634.1|  hypothetical protein CICLE_v10028716mg             224   1e-65    
ref|XP_007041884.1|  Pathogenesis-related thaumatin superfamily p...    223   1e-65    
emb|CDO96933.1|  unnamed protein product                                224   1e-65    
ref|XP_008440826.1|  PREDICTED: thaumatin-like protein 1                223   1e-65    
gb|KDO68003.1|  hypothetical protein CISIN_1g018813mg                   224   1e-65    
gb|KDP38462.1|  hypothetical protein JCGZ_04387                         220   2e-65    
ref|XP_006302686.1|  hypothetical protein CARUB_v10020795mg             221   2e-65    
ref|XP_010539098.1|  PREDICTED: thaumatin-like protein 1b               223   2e-65    
ref|XP_004152784.1|  PREDICTED: pathogenesis-related protein 5-like     221   2e-65    
ref|XP_006340942.1|  PREDICTED: pathogenesis-related protein 5-like     223   2e-65    
ref|XP_003538880.1|  PREDICTED: thaumatin-like protein 1-like           222   2e-65    
ref|XP_009767579.1|  PREDICTED: pathogenesis-related protein 5-like     223   2e-65    
ref|XP_010416173.1|  PREDICTED: thaumatin-like protein                  220   2e-65    
gb|KEH26933.1|  pathogenesis-related thaumatin family protein           220   2e-65    
ref|XP_002510549.1|  Zeamatin precursor, putative                       223   2e-65    
ref|XP_009596997.1|  PREDICTED: thaumatin-like protein                  220   2e-65    
emb|CDY59465.1|  BnaCnng34970D                                          220   2e-65    
ref|XP_010041761.1|  PREDICTED: thaumatin-like protein 1b               222   2e-65    
ref|XP_010935078.1|  PREDICTED: thaumatin-like protein 1b               224   2e-65    
ref|XP_010531542.1|  PREDICTED: thaumatin-like protein 1b               223   2e-65    
gb|KEH34729.1|  pathogenesis-related thaumatin family protein           220   3e-65    
ref|XP_003517170.1|  PREDICTED: thaumatin-like protein 1-like           222   3e-65    
ref|XP_008364687.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    219   3e-65    
ref|XP_009149413.1|  PREDICTED: pathogenesis-related protein 5-li...    220   3e-65    
ref|XP_010109991.1|  hypothetical protein L484_021879                   223   3e-65    
ref|XP_009149412.1|  PREDICTED: pathogenesis-related protein 5-li...    220   3e-65    
ref|XP_004169877.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    223   3e-65    
ref|XP_006473672.1|  PREDICTED: thaumatin-like protein 1-like           221   4e-65    
emb|CAN59843.1|  hypothetical protein VITISV_030359                     219   4e-65    
ref|XP_003634206.1|  PREDICTED: thaumatin-like protein                  219   4e-65    
ref|XP_004238220.1|  PREDICTED: pathogenesis-related protein 5          219   4e-65    
ref|XP_006435194.1|  hypothetical protein CICLE_v10001948mg             221   4e-65    
ref|XP_009588211.1|  PREDICTED: thaumatin-like protein 1b               221   4e-65    
gb|AAK63884.1|AC074105_13  Putative thaumatin-like protein              222   4e-65    
emb|CDO98353.1|  unnamed protein product                                219   4e-65    
ref|XP_006575509.1|  PREDICTED: thaumatin-like protein-like             219   4e-65    
ref|XP_010477142.1|  PREDICTED: pathogenesis-related protein 5-like     219   4e-65    
gb|EYU45112.1|  hypothetical protein MIMGU_mgv1a012469mg                219   4e-65    
ref|XP_008377134.1|  PREDICTED: thaumatin-like protein 1b               222   4e-65    
gb|EAZ09619.1|  hypothetical protein OsI_31903                          222   5e-65    
ref|XP_007131695.1|  hypothetical protein PHAVU_011G0342001g            219   5e-65    
ref|XP_008357219.1|  PREDICTED: pathogenesis-related protein 5-like     219   5e-65    
gb|EYU24132.1|  hypothetical protein MIMGU_mgv1a012513mg                219   5e-65    
ref|XP_006366466.1|  PREDICTED: pathogenesis-related protein 5-like     219   5e-65    
gb|KDP46766.1|  hypothetical protein JCGZ_06554                         221   5e-65    
ref|XP_011096945.1|  PREDICTED: thaumatin-like protein 1                221   6e-65    
ref|XP_007041885.1|  Pathogenesis-related thaumatin superfamily p...    223   6e-65    
ref|XP_010928530.1|  PREDICTED: pathogenesis-related protein 5-like     218   6e-65    
ref|XP_011008805.1|  PREDICTED: thaumatin-like protein                  219   7e-65    
ref|XP_010033495.1|  PREDICTED: thaumatin-like protein 1b               221   8e-65    
ref|XP_009623952.1|  PREDICTED: thaumatin-like protein                  219   8e-65    
ref|XP_008372899.1|  PREDICTED: thaumatin-like protein 1b               222   8e-65    
ref|XP_004503196.1|  PREDICTED: thaumatin-like protein-like             219   9e-65    
ref|XP_006573555.1|  PREDICTED: thaumatin-like protein 1-like           220   9e-65    
ref|XP_008448548.1|  PREDICTED: thaumatin-like protein 1                221   9e-65    
ref|XP_011083734.1|  PREDICTED: pathogenesis-related protein 5-like     218   9e-65    
ref|XP_010526801.1|  PREDICTED: thaumatin-like protein 1b               220   9e-65    
ref|XP_003628396.1|  Thaumatin-like protein                             219   1e-64    
ref|XP_009621098.1|  PREDICTED: thaumatin-like protein                  218   1e-64    
ref|XP_009349687.1|  PREDICTED: thaumatin-like protein 1b               222   1e-64    
ref|XP_010477000.1|  PREDICTED: thaumatin-like protein                  218   1e-64    
ref|XP_007041883.1|  Pathogenesis-related thaumatin superfamily p...    222   1e-64    
ref|XP_004135916.1|  PREDICTED: thaumatin-like protein-like             218   1e-64    
ref|XP_002301968.2|  hypothetical protein POPTR_0002s02200g             221   1e-64    
ref|XP_009340234.1|  PREDICTED: thaumatin-like protein 1b               222   1e-64    
ref|XP_002460577.1|  hypothetical protein SORBIDRAFT_02g031130          220   1e-64    
emb|CDY03478.1|  BnaC01g16040D                                          218   1e-64    
ref|XP_002510548.1|  Zeamatin precursor, putative                       220   1e-64    
gb|KEH30510.1|  pathogenesis-related thaumatin family protein           221   1e-64    
ref|XP_004292943.1|  PREDICTED: pathogenesis-related protein 5-like     221   1e-64    
ref|XP_010471424.1|  PREDICTED: thaumatin-like protein                  218   1e-64    
ref|XP_009778054.1|  PREDICTED: pathogenesis-related protein 5-like     218   1e-64    
ref|XP_008461434.1|  PREDICTED: thaumatin-like protein                  217   1e-64    
ref|XP_004301252.1|  PREDICTED: thaumatin-like protein-like             218   2e-64    
gb|KEH40091.1|  pathogenesis-related thaumatin family protein           218   2e-64    
gb|KGN48924.1|  hypothetical protein Csa_6G506010                       220   2e-64    
ref|XP_006482914.1|  PREDICTED: pathogenesis-related protein 5-like     217   2e-64    
ref|XP_008781003.1|  PREDICTED: thaumatin-like protein 1b               219   2e-64    
gb|AAB63607.1|  thaumatin isolog                                        218   3e-64    
ref|XP_009591540.1|  PREDICTED: pathogenesis-related protein 5          220   3e-64    
ref|XP_010274714.1|  PREDICTED: thaumatin-like protein                  217   3e-64    
ref|XP_006342237.1|  PREDICTED: pathogenesis-related protein 5-like     219   3e-64    
ref|XP_007017827.1|  Pathogenesis-related thaumatin superfamily p...    219   3e-64    
gb|EYU26189.1|  hypothetical protein MIMGU_mgv1a023542mg                219   3e-64    
ref|XP_002532822.1|  Protein P21, putative                              217   3e-64    
ref|XP_002274137.1|  PREDICTED: thaumatin-like protein 1b               219   3e-64    
ref|XP_007041882.1|  Pathogenesis-related thaumatin superfamily p...    223   3e-64    
emb|CDP18679.1|  unnamed protein product                                217   3e-64    
dbj|BAJ92744.1|  predicted protein                                      217   3e-64    
ref|XP_002306938.2|  pathogenesis-related thaumatin family protein      219   3e-64    
ref|XP_004231024.1|  PREDICTED: thaumatin-like protein 1                221   3e-64    
ref|XP_004232498.1|  PREDICTED: pathogenesis-related protein 5          219   3e-64    
ref|XP_006375059.1|  hypothetical protein POPTR_0014s04020g             217   4e-64    
ref|XP_002301969.2|  hypothetical protein POPTR_0002s02200g             219   4e-64    
ref|NP_568046.1|  pathogenesis-related thaumatin-like protein           220   4e-64    
ref|XP_002322099.1|  hypothetical protein POPTR_0015s04510g             217   4e-64    
ref|XP_003632671.1|  PREDICTED: thaumatin-like protein                  216   4e-64    
ref|XP_006473671.1|  PREDICTED: thaumatin-like protein 1-like           219   4e-64    
ref|XP_008376861.1|  PREDICTED: thaumatin-like protein 1                218   4e-64    
emb|CAN70296.1|  hypothetical protein VITISV_007440                     216   4e-64    
ref|XP_002317878.2|  hypothetical protein POPTR_0012s04520g             219   4e-64    
ref|XP_008369928.1|  PREDICTED: thaumatin-like protein                  216   5e-64    
ref|XP_011045068.1|  PREDICTED: thaumatin-like protein 1b               219   5e-64    
ref|XP_006480866.1|  PREDICTED: thaumatin-like protein-like             216   5e-64    
ref|XP_002513184.1|  Zeamatin precursor, putative                       216   5e-64    
ref|XP_002868852.1|  hypothetical protein ARALYDRAFT_912315             220   5e-64    
ref|XP_004232497.1|  PREDICTED: thaumatin-like protein 1                218   6e-64    
gb|EYU38795.1|  hypothetical protein MIMGU_mgv1a010603mg                218   6e-64    
ref|XP_011039126.1|  PREDICTED: thaumatin-like protein                  218   6e-64    
ref|XP_006826851.1|  hypothetical protein AMTR_s00010p00113630          216   7e-64    
ref|NP_001268088.1|  SCUTL2 precursor                                   216   7e-64    
gb|KHG02193.1|  Thaumatin-like protein 1                                218   7e-64    
ref|XP_004159719.1|  PREDICTED: thaumatin-like protein 1-like           218   7e-64    
ref|XP_006340742.1|  PREDICTED: thaumatin-like protein 1-like           218   7e-64    
ref|XP_007026966.1|  Pathogenesis-related thaumatin superfamily p...    216   8e-64    
emb|CDY24827.1|  BnaA08g14830D                                          218   8e-64    
ref|XP_003525190.1|  PREDICTED: thaumatin-like protein-like             216   8e-64    
ref|XP_009109259.1|  PREDICTED: thaumatin-like protein 1b               218   8e-64    
emb|CDY34263.1|  BnaA01g13660D                                          216   8e-64    
ref|XP_011031355.1|  PREDICTED: pathogenesis-related protein 5          216   9e-64    
ref|XP_002533803.1|  Protein P21, putative                              218   9e-64    
ref|XP_008448111.1|  PREDICTED: thaumatin-like protein                  216   1e-63    
ref|XP_011035010.1|  PREDICTED: thaumatin-like protein 1                218   1e-63    
gb|KHG18980.1|  hypothetical protein F383_08602                         216   1e-63    
ref|XP_010672697.1|  PREDICTED: thaumatin-like protein                  216   1e-63    
gb|KGN55655.1|  hypothetical protein Csa_3G002750                       218   1e-63    
ref|XP_004238367.1|  PREDICTED: pathogenesis-related protein 5          218   1e-63    
ref|XP_007223736.1|  hypothetical protein PRUPE_ppa010458mg             216   1e-63    
ref|XP_009338610.1|  PREDICTED: thaumatin-like protein                  216   1e-63    
ref|XP_008364957.1|  PREDICTED: pathogenesis-related protein 5-like     216   1e-63    
ref|XP_010246990.1|  PREDICTED: pathogenesis-related protein 5          216   1e-63    
gb|KFK41944.1|  hypothetical protein AALP_AA2G192400                    216   1e-63    
gb|AAM64698.1|  putative thaumatin-like protein                         219   1e-63    
gb|EAY77701.1|  hypothetical protein OsI_32742                          218   1e-63    
ref|XP_010690395.1|  PREDICTED: thaumatin-like protein 1                219   1e-63    
ref|XP_011083579.1|  PREDICTED: thaumatin-like protein 1                218   1e-63    
ref|NP_001031809.1|  pathogenesis-related thaumatin-like protein        218   2e-63    
ref|XP_008394054.1|  PREDICTED: thaumatin-like protein 1                217   2e-63    
ref|XP_009785286.1|  PREDICTED: thaumatin-like protein 1b               218   2e-63    
ref|XP_006846295.1|  hypothetical protein AMTR_s00012p00252040          215   2e-63    
ref|XP_011045069.1|  PREDICTED: thaumatin-like protein 1b               218   2e-63    
ref|XP_004302778.1|  PREDICTED: thaumatin-like protein-like             215   2e-63    
gb|AIU34433.1|  thaumatin-like protein 2                                214   2e-63    
ref|XP_009361238.1|  PREDICTED: thaumatin-like protein 1                217   2e-63    
gb|KDP29626.1|  hypothetical protein JCGZ_18788                         218   2e-63    
ref|XP_009780343.1|  PREDICTED: thaumatin-like protein                  215   2e-63    
ref|XP_010254957.1|  PREDICTED: pathogenesis-related protein 5          215   2e-63    
dbj|BAE71242.1|  putative thaumatin-like protein                        218   2e-63    
ref|XP_010678327.1|  PREDICTED: pathogenesis-related protein 5-like     215   2e-63    
gb|KHG03900.1|  hypothetical protein F383_27474                         215   2e-63    
ref|XP_010239414.1|  PREDICTED: thaumatin-like protein 1b               219   2e-63    
ref|XP_008220752.1|  PREDICTED: pathogenesis-related protein 5          215   2e-63    
ref|XP_007036794.1|  Pathogenesis-related thaumatin superfamily p...    216   2e-63    
ref|XP_001769333.1|  predicted protein                                  215   2e-63    
ref|XP_008377347.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    215   2e-63    
ref|XP_008463807.1|  PREDICTED: thaumatin-like protein                  215   2e-63    
dbj|BAJ86559.1|  predicted protein                                      217   2e-63    
ref|XP_010026075.1|  PREDICTED: thaumatin-like protein 1                214   2e-63    
ref|XP_009137765.1|  PREDICTED: thaumatin-like protein 1b               217   2e-63    
ref|XP_004287804.1|  PREDICTED: thaumatin-like protein 1-like           217   2e-63    
ref|XP_004172986.1|  PREDICTED: thaumatin-like protein-like             217   2e-63    
ref|XP_011035009.1|  PREDICTED: thaumatin-like protein                  217   2e-63    
ref|XP_006383094.1|  hypothetical protein POPTR_0005s11490g             216   3e-63    
gb|EYU30411.1|  hypothetical protein MIMGU_mgv1a010348mg                217   3e-63    
ref|XP_002301966.2|  hypothetical protein POPTR_0002s02190g             217   3e-63    
gb|KFK41500.1|  hypothetical protein AALP_AA2G137800                    217   3e-63    



>ref|XP_009761236.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=288

 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 237/286 (83%), Gaps = 6/286 (2%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             T+  +++ L LAIA GVKLS+C NITIIN CKETVWPGIT  NN SGDGF LK GQSAVF
Sbjct  8     TSSSQVWFLFLAIALGVKLSECANITIINYCKETVWPGITPKNNFSGDGFELKQGQSAVF  67

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP+GW+GRIWGRTGC+FDK+N  +   CQTG CG  LKC+  GQPPA+IA+FTLGETDF
Sbjct  68    TAPTGWSGRIWGRTGCDFDKNNNGT---CQTGRCGTGLKCNEPGQPPASIAEFTLGETDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLPIVVKPVNGKGNCS+ GCD DLR NCPS+LALK   KT+ACRSACNVF+
Sbjct  125   YDVSLVDGFNLPIVVKPVNGKGNCSSAGCDSDLRPNCPSELALKLNNKTIACRSACNVFD  184

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRGA+SSP SCLPTNYS+ FK ACP+AYSFAFDDPTSVITCS+TDYVVSFCSSRN
Sbjct  185   TDEYCCRGAYSSPVSCLPTNYSRIFKTACPVAYSFAFDDPTSVITCSSTDYVVSFCSSRN  244

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             QTQCT+  KNV+C+  A G+   F+   +LL V L T V +LG ++
Sbjct  245   QTQCTYQGKNVTCNG-AYGLKSLFQTMHILL-VGL-TAVISLGGVM  287



>ref|XP_009630599.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana tomentosiformis]
Length=289

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/282 (72%), Positives = 235/282 (83%), Gaps = 5/282 (2%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             K++ LLL+IA G+KLS+C NITIIN CKETVWPGIT  NN SGDGF LK GQSAVF AP+
Sbjct  13    KVWFLLLSIALGIKLSECANITIINYCKETVWPGITPKNNFSGDGFELKQGQSAVFTAPA  72

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGC+FDK++  +   CQTG CG  LKC+  GQPPA+IA+FTLGETDFYDVS
Sbjct  73    GWSGRIWGRTGCDFDKNDNGT---CQTGRCGTGLKCNEPGQPPASIAEFTLGETDFYDVS  129

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLPIVVKPVNGKGNCS+ GCD DLR NCPS+LALK   KT+ACRSACNVF+TDEY
Sbjct  130   LVDGFNLPIVVKPVNGKGNCSSAGCDSDLRPNCPSELALKLDNKTIACRSACNVFDTDEY  189

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG +SSP SCLPTN+S+ FK ACP+AYSFAFDDPTSVITCS+TDYVVSFCSSRNQT+C
Sbjct  190   CCRGTYSSPVSCLPTNFSRIFKTACPVAYSFAFDDPTSVITCSSTDYVVSFCSSRNQTEC  249

Query  456   TFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             T   KNV+C+  A G+   F+P Q+LL V L T +   GV+L
Sbjct  250   TNKGKNVTCNG-AYGLKSLFQPKQILL-VGLTTVISLGGVML  289



>ref|XP_010314840.1| PREDICTED: pathogenesis-related protein 5-like [Solanum lycopersicum]
Length=288

 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 238/288 (83%), Gaps = 8/288 (3%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             T+F  ++ LL AIA GVKLS+CTNITIIN C ETVWPGIT  NN SGDG+ LK G+SAVF
Sbjct  6     TSFTNVWFLLFAIALGVKLSECTNITIINYCTETVWPGITPKNNFSGDGYELKQGESAVF  65

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP+GW+GRIWGRTGC+FDK NG+ +  CQTG CG  LKC   GQPPA+IA+FTLG+TDF
Sbjct  66    TAPAGWSGRIWGRTGCDFDK-NGNGT--CQTGRCGTGLKCREPGQPPASIAEFTLGDTDF  122

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLPIVVKPVNGKGNCS+VGCD DLR NCPS+LALKS GKT+ACRSACNVF+
Sbjct  123   YDVSLVDGFNLPIVVKPVNGKGNCSSVGCDSDLRPNCPSELALKSDGKTIACRSACNVFD  182

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR-  472
             TDEYCCRG FSSP SCLPTNYS  FK ACP+AYSFAFDDPTS+ITCS+TDY+VSFCSSR 
Sbjct  183   TDEYCCRGTFSSPISCLPTNYSTIFKTACPVAYSFAFDDPTSIITCSSTDYLVSFCSSRN  242

Query  471   -NQTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
              NQTQCT H KNV+C+  A G+   FK   +L+ V L  TV +LG L+
Sbjct  243   QNQTQCTNHGKNVTCNG-AYGLNSLFKTRDILM-VGL-ATVISLGGLM  287



>ref|XP_006349436.1| PREDICTED: pathogenesis-related protein 5-like [Solanum tuberosum]
Length=308

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 233/285 (82%), Gaps = 10/285 (4%)
 Frame = -3

Query  1173  LFLLLLAIAS--GVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAP  1000
             LF  +L   S  GVKLS+CTNITIIN C ETVWPGIT  NN SGDG+ LK GQSAVF AP
Sbjct  29    LFFRILTQFSVTGVKLSECTNITIINYCVETVWPGITPKNNFSGDGYELKQGQSAVFTAP  88

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
             +GW+GRIWGRTGC+FDK++  +   CQTG CG  LKC   GQPPA+IA+FTLG+TDFYDV
Sbjct  89    AGWSGRIWGRTGCDFDKNDNGT---CQTGGCGTGLKCREPGQPPASIAEFTLGDTDFYDV  145

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             SLVDGFNLPIVVKPVNGKGNCS+VGCD DLR NC S+LALKS GKT+ACRSACNVFNTDE
Sbjct  146   SLVDGFNLPIVVKPVNGKGNCSSVGCDSDLRPNCSSELALKSDGKTIACRSACNVFNTDE  205

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR--NQ  466
             YCCRG FSSP SCLPTNYS+ FK ACP+AYSFAFDDPTS+ITCS+TDYVVSFCSSR  NQ
Sbjct  206   YCCRGTFSSPVSCLPTNYSRIFKTACPVAYSFAFDDPTSIITCSSTDYVVSFCSSRNQNQ  265

Query  465   TQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             TQCT H KNV+C+  A G+   FK  + LL V L TTV +LG L+
Sbjct  266   TQCTNHGKNVTCNG-AYGLKSLFKT-RHLLMVGL-TTVISLGGLM  307



>emb|CDO97536.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/274 (64%), Positives = 213/274 (78%), Gaps = 12/274 (4%)
 Frame = -3

Query  1134  LSKCTNITIINNCKETVWPGITTNNND------SGDGFALKPGQSAVFAAPSGWNGRIWG  973
             L++ TN+TIIN C ET+WPGIT N+N       SG GF LKP QS VF+AP GWNGRIWG
Sbjct  2     LAESTNLTIINGCNETIWPGITPNDNSAPDTNTSGGGFQLKPDQSVVFSAPPGWNGRIWG  61

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC+FDK     S  C+TG CG  LKC   GQPPA+IA F  G  D+YDVSLVDGFNLP
Sbjct  62    RTGCDFDKE---GSGKCETGDCGSTLKCKTPGQPPASIAQFAFGNLDYYDVSLVDGFNLP  118

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             I VKP++G+GNCS  GCD DLR +CP +LA+ S GK++AC SACNVFNTDEYCCRGAFS+
Sbjct  119   ITVKPISGRGNCSTAGCDSDLRPHCPPELAVNSSGKSIACNSACNVFNTDEYCCRGAFST  178

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
             P +C+PTNYS++FK ACP AYS+A+DDP+S+ITCSATDYVV+FCSSRNQT+CT+HD+ ++
Sbjct  179   PLTCMPTNYSRTFKTACPAAYSYAYDDPSSIITCSATDYVVTFCSSRNQTRCTYHDRTLT  238

Query  432   CSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             C ++AKG   F    +MLL +ALP  V NLG + 
Sbjct  239   C-NEAKGPTTFSPVGKMLL-LALP-AVLNLGSMF  269



>ref|XP_007018987.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY16212.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=283

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/277 (59%), Positives = 211/277 (76%), Gaps = 5/277 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L L++  + SG K+ +C  I TI+N+CKET+WPGIT  +N +G GFALKPGQS VF AP 
Sbjct  7     LVLVMAMLLSGPKMYECARIFTILNSCKETIWPGITPGDNFNGGGFALKPGQSIVFQAPI  66

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGC FDK NG+   PCQT  CG  LKCS +G+ PA++A+FTL E DFYDVS
Sbjct  67    GWSGRIWGRTGCKFDK-NGNG--PCQTADCGNTLKCSASGKTPASLAEFTLSELDFYDVS  123

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+ V P+NG+GNC+  GCD DLR++CPS+L++K+ GK +ACRSAC++FNTDEY
Sbjct  124   LVDGFNLPLAVTPINGRGNCTVAGCDSDLRKSCPSELSVKANGKVIACRSACDIFNTDEY  183

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG + +P  C PT YSK FK+ACP AYS+A+DDPTS+ TCS  DYV++FCS+RNQT C
Sbjct  184   CCRGLYGNPVVCQPTYYSKKFKSACPTAYSYAYDDPTSIFTCSGPDYVITFCSTRNQTVC  243

Query  456   TFHDKNVSCSSDAKGMAPFFKP-WQMLLAVALPTTVF  349
             T+HD  + C + A G  P     W  +LA+ L  +++
Sbjct  244   TYHDHKLICKNKANGTNPLMGTWWSAMLALLLVASLW  280



>emb|CDP12448.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 214/283 (76%), Gaps = 8/283 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L +L+  ++ G K S+   + TIINNCKET+WPG+T   N +G GF+LKPG+S +F AP 
Sbjct  11    LVILMFLLSVGPKYSESARVFTIINNCKETIWPGVTPGENFNGGGFSLKPGESKIFTAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
              W+GRIWGRTGCNFD+ NG+ +  CQTGSCG  LKCS +G+PPA++A+FTL   DFYDVS
Sbjct  71    SWSGRIWGRTGCNFDR-NGNGT--CQTGSCGTTLKCSASGKPPASLAEFTLTAQDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLPIVV P+NG GNCS  GCD DLR +CP +L++K+ GKTVACRSAC+VFNTDEY
Sbjct  128   LVDGFNLPIVVTPINGSGNCSIAGCDNDLRPSCPQELSVKANGKTVACRSACDVFNTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG F +P +C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDYVV+FCSSR Q  C
Sbjct  188   CCRGVFGNPVTCQPTFYSKRFKQACPAAYSYAYDDPTSIFTCTGTDYVVAFCSSRRQPVC  247

Query  456   TFHDKNVSCSSDAKGMAPFF-KPWQMLLAVALPTTVFNLGVLL  331
             T+H+  + C SD+KG+       W M+  +A+ TT  NL + L
Sbjct  248   TYHNHKLVC-SDSKGIKGLIGMQWMMIFGIAILTT--NLWLYL  287



>ref|XP_008218810.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=284

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 210/273 (77%), Gaps = 7/273 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             LF+ +L IA G KL     I TI+N CKET+WPGIT + N SG GF L  GQS V+ AP+
Sbjct  12    LFITIL-IACGAKLYASAKIFTIVNECKETIWPGITHSENFSGSGFTLNQGQSTVYTAPA  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDV  820
              WNGRIW RTGC+FDK NG+    CQTGSCG  + C+G G PPA+IA+FTLG E D+YDV
Sbjct  71    DWNGRIWARTGCSFDK-NGNGK--CQTGSCGTTINCTGPGSPPASIAEFTLGQEIDYYDV  127

Query  819   SLVDGFNLPIVVKPVN-GKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             SLVDGFNLP++VKP N GKGNCS  GCD+DLR++CPS+LA K+ GK +ACRSACNVFNTD
Sbjct  128   SLVDGFNLPVIVKPTNSGKGNCSTAGCDRDLRQSCPSELAAKAEGKVIACRSACNVFNTD  187

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG F +P +CLPTNYS+SFK ACP AYSFA+DDPTSVITCS  D++V+FC+SRNQT
Sbjct  188   EYCCRGTFGNPQTCLPTNYSRSFKQACPAAYSFAYDDPTSVITCSGADFIVTFCASRNQT  247

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
              C++HDK + C+   +  A   + W ++LA  L
Sbjct  248   VCSYHDKQLVCNGSKELKALSQRWWSLILAFPL  280



>ref|XP_007226798.1| hypothetical protein PRUPE_ppa018160mg [Prunus persica]
 gb|EMJ27997.1| hypothetical protein PRUPE_ppa018160mg [Prunus persica]
Length=288

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/273 (63%), Positives = 210/273 (77%), Gaps = 7/273 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             LF+ +L IA G KL +     TI+N CKET+WPGIT + N SG GF LK GQS V+ AP 
Sbjct  12    LFVTIL-IACGAKLYASAKTFTIVNECKETIWPGITHSENFSGSGFTLKQGQSTVYTAPG  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDV  820
              WNGRIW RTGC+FDK NG+    CQTGSCG  + C+G G PPA+IA+FTLG E D+YDV
Sbjct  71    DWNGRIWARTGCSFDK-NGNGK--CQTGSCGTTINCTGPGSPPASIAEFTLGQEIDYYDV  127

Query  819   SLVDGFNLPIVVKPVN-GKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             SLVDGFNLP++VKP N GKGNCS  GCD+DLR++CPS+LA K+ GK +ACRSACNVFNTD
Sbjct  128   SLVDGFNLPVIVKPTNNGKGNCSTAGCDRDLRQSCPSELAAKAEGKVIACRSACNVFNTD  187

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG F +P +CLPTNYS+SFK ACP AYSFA+DDPTS+ITCS  D++V+FC+SRNQT
Sbjct  188   EYCCRGTFGNPQTCLPTNYSRSFKQACPAAYSFAYDDPTSIITCSGADFIVTFCASRNQT  247

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
              C++HDK + C+   +  A   + W ++LA  L
Sbjct  248   VCSYHDKQLVCNGSKELKALSQRWWPLMLAFPL  280



>ref|XP_008233902.1| PREDICTED: pathogenesis-related protein 5 [Prunus mume]
Length=286

 Score =   348 bits (894),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 214/287 (75%), Gaps = 9/287 (3%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
              F  + L+ +AI+SG KLS+   I TIINNCKETVWP +T   + +G GF LKPGQS +F
Sbjct  7     VFLPVLLVFMAISSGPKLSESARIFTIINNCKETVWPAVTPGESFNGGGFMLKPGQSVIF  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP  W+GRIWGRTGCNFD  NG++S  CQTG CGG LKC  +G+ PAT+A+FTL   DF
Sbjct  67    TAPVSWSGRIWGRTGCNFDNKNGNTS--CQTGDCGGTLKCGASGKTPATLAEFTLAAPDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLP+VV P+NG GNCS  GCD DLR +CPS L++K+ GKTV CRSAC+VFN
Sbjct  125   YDVSLVDGFNLPMVVTPLNGTGNCSVSGCDGDLRSSCPSVLSVKANGKTVGCRSACDVFN  184

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRG F +P +C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVV+FCS+R 
Sbjct  185   TDEYCCRGVFGNPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFCSNRK  244

Query  468   QTQCTFHDKNVSCSSD-AKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             Q  CT+H+  + CS++ +KG+      W ++LA+ +   + NL ++ 
Sbjct  245   QPVCTYHNHKLVCSTNGSKGLKSM--RWTVMLALMV---MINLWIIF  286



>ref|XP_007222068.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
 gb|EMJ23267.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
Length=286

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 213/287 (74%), Gaps = 9/287 (3%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
              F  + L+ +AI+SG KLS+   I TIINNCKETVWP +T   + +G GF LK GQS +F
Sbjct  7     VFLPVLLVFMAISSGPKLSESARIFTIINNCKETVWPAVTPGESFNGGGFMLKQGQSVIF  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP  W+GRIWGRTGCNFD  NG++S  CQTG CGG LKC  +G+ PAT+A+FTL   DF
Sbjct  67    TAPVSWSGRIWGRTGCNFDNKNGNTS--CQTGDCGGTLKCGASGKTPATLAEFTLAALDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLP+VV P+NG GNCS  GCD DLR +CPS L++K+ GKTV CRSAC+VFN
Sbjct  125   YDVSLVDGFNLPMVVTPLNGTGNCSVSGCDGDLRSSCPSVLSVKANGKTVGCRSACDVFN  184

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRG F +P +C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVV+FCSSR 
Sbjct  185   TDEYCCRGVFGNPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFCSSRK  244

Query  468   QTQCTFHDKNVSCSSD-AKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             Q  CT+H+  + CS++ +KG+      W ++LA+ +   + NL ++ 
Sbjct  245   QPVCTYHNHKLVCSTNGSKGLKSM--RWTVMLALMV---MINLWIIF  286



>ref|XP_010091351.1| hypothetical protein L484_020153 [Morus notabilis]
 gb|EXB44341.1| hypothetical protein L484_020153 [Morus notabilis]
Length=288

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/280 (58%), Positives = 208/280 (74%), Gaps = 4/280 (1%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P L L+ + I+SG +LS+   + T+INNCKET+WPG+T   N +G GF LKPGQSA+F A
Sbjct  11    PLLVLVHIVISSGPELSEAARVFTVINNCKETIWPGVTPGENFNGGGFVLKPGQSAIFTA  70

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNF+K+      PCQTG+CG ALKC  +G+ PAT+A+FTL   DFYD
Sbjct  71    PVGWSGRIWGRTGCNFNKN---GVGPCQTGACGDALKCGSSGKTPATLAEFTLAGLDFYD  127

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+VV P+NG+GNCS  GCD DLR  CP++L++K+ GKTV CRSAC+VFNTD
Sbjct  128   VSLVDGFNLPMVVTPINGRGNCSIAGCDGDLRTTCPAELSVKANGKTVGCRSACDVFNTD  187

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYV++FC+ R Q 
Sbjct  188   EYCCRGLYGNPVVCQPTYYSKKFKDACPKAYSYAYDDPTSIFTCSGTDYVIAFCTKRTQP  247

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNL  343
              CT+H+  + CS      +   + W ++L + L   ++N+
Sbjct  248   VCTYHNHKLVCSGSESLKSLIGRWWSLMLPLFLLIKLWNV  287



>ref|XP_010274354.1| PREDICTED: pathogenesis-related protein 5-like [Nelumbo nucifera]
Length=286

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 202/271 (75%), Gaps = 4/271 (1%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             + L L+   SGV+LS+   + TI+N CKET+WPGIT   N +G GFALKPGQS VF AP 
Sbjct  11    VLLXLIMTISGVQLSESARVFTIVNYCKETIWPGITPGENFNGGGFALKPGQSMVFTAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW GRIWGRTGCNFDK NG+ +  CQT  CG +LKC  +GQ PA++A+FTL   DFYDVS
Sbjct  71    GWVGRIWGRTGCNFDK-NGNGN--CQTARCGNSLKCKASGQTPASLAEFTLAALDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+VV PVNG GNCS  GCD DLR NCP++L++K GGK +ACRSAC+VF+TDEY
Sbjct  128   LVDGFNLPLVVTPVNGHGNCSVAGCDGDLRPNCPAELSVKYGGKIIACRSACDVFDTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG + +PA C PT YSK FK  CP AYS+A+DDPTS+ TCS  DY++SFCSSR QT C
Sbjct  188   CCRGVYGNPAVCKPTFYSKKFKEVCPAAYSYAYDDPTSIFTCSGPDYIISFCSSRKQTVC  247

Query  456   TFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             T+H+  + CS      +   K W ++LA+ L
Sbjct  248   TYHNNKLICSGSNSLKSLTRKWWIVVLALTL  278



>ref|XP_011088126.1| PREDICTED: thaumatin-like protein [Sesamum indicum]
Length=247

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 194/235 (83%), Gaps = 4/235 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
              FL  L IASG++LS+    TIIN CKET+WPGIT NN  SG GF+LKP QSAVF AP  
Sbjct  8     FFLAFLVIASGIRLSEGVKFTIINYCKETIWPGITPNNF-SGGGFSLKPTQSAVFTAPPA  66

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSL  814
             WNGRIW RTGCNFDK NG+ +  CQTG CG +L+C+G G PPA+IA+F LG+ D+YDVSL
Sbjct  67    WNGRIWARTGCNFDK-NGNGT--CQTGGCGSSLQCTGPGHPPASIAEFALGDIDYYDVSL  123

Query  813   VDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             VDGFNLP+VVKPV GKGNCS+ GCD DLR NC  +L L++ G+TVAC+SAC+VF+TDEYC
Sbjct  124   VDGFNLPVVVKPVGGKGNCSSAGCDADLRPNCLPELTLRADGRTVACQSACSVFDTDEYC  183

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             CRGAFS+P +C PTNYS+SFK ACP AYSFA DDPTS+ITCSATDYVVSFCSSR+
Sbjct  184   CRGAFSTPMACQPTNYSRSFKTACPAAYSFAHDDPTSIITCSATDYVVSFCSSRH  238



>gb|EYU23904.1| hypothetical protein MIMGU_mgv1a011450mg [Erythranthe guttata]
Length=281

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/270 (60%), Positives = 205/270 (76%), Gaps = 6/270 (2%)
 Frame = -3

Query  1146  SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             +G +LS C  I TI+N CKET+WP +T     +G GF LKPGQ+ +F AP  W+GRIW R
Sbjct  15    TGAELSTCARIFTIVNYCKETIWPAVTPGEYFNGGGFVLKPGQTQIFTAPISWSGRIWAR  74

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPI  790
             TGCNFD+ NG+ S  CQTGSCG  LKC  +G+PPA++A+FTL  TDFYDVSLVDGFNLPI
Sbjct  75    TGCNFDR-NGNGS--CQTGSCGSTLKCGASGKPPASLAEFTLAATDFYDVSLVDGFNLPI  131

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
             VV P+NG+GNCS  GCD DLR NCP++LA+K GG+ VACRSAC+VF+TDEYCCRG + +P
Sbjct  132   VVTPLNGRGNCSVAGCDADLRTNCPAELAVKGGGRNVACRSACDVFDTDEYCCRGVYGNP  191

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC  430
              +C PT YSK+FK ACP AYS+A+DDPTS+ TCS TDYVVSFCSSR Q  CT+H+  + C
Sbjct  192   VTCQPTYYSKTFKKACPTAYSYAYDDPTSIFTCSGTDYVVSFCSSRKQPVCTYHNNKLVC  251

Query  429   SSDAKGMAPFFKPWQ-MLLAVALPTTVFNL  343
                + G+ P  K W  M+L + + T ++N+
Sbjct  252   GG-SMGLKPTGKKWWIMILTMIITTALWNI  280



>ref|XP_009598313.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana tomentosiformis]
Length=277

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/269 (61%), Positives = 207/269 (77%), Gaps = 7/269 (3%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             LL+L + SGVKLS+   I TIIN+CKETVWPG+   +N +G GF+LK GQS +F AP G+
Sbjct  12    LLILFVLSGVKLSESARIFTIINHCKETVWPGVFPGDNFNGGGFSLKSGQSIIFTAPVGF  71

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
              GRIWGRTGCNFDK NG+ S  CQTG CG +LKCSGTG+ PA++A+FTL   DFYDVSLV
Sbjct  72    QGRIWGRTGCNFDK-NGNGS--CQTGDCGPSLKCSGTGKTPASLAEFTLASLDFYDVSLV  128

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFN+P+ V P+NGKGNCS  GCD DLR++CP +LA+K+ GK VACRSAC+VF+TDEYCC
Sbjct  129   DGFNVPMSVTPINGKGNCSIAGCDGDLRQDCPKELAVKANGKVVACRSACDVFDTDEYCC  188

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG + +P +C PT YSK FK  CP AYS+A+DDPTS+ TCS TDYV++FCSSRN+  CT+
Sbjct  189   RGNYGNPTTCQPTYYSKKFKQVCPTAYSYAYDDPTSIFTCSGTDYVIAFCSSRNRPVCTY  248

Query  450   HDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             HD  + C   + G+  F   W ++L + L
Sbjct  249   HDHKLVCGG-SNGLRSFM--WMIILGLTL  274



>ref|XP_006579469.1| PREDICTED: uncharacterized protein LOC100818786 isoform X1 [Glycine 
max]
 gb|KHN06503.1| Thaumatin-like protein [Glycine soja]
Length=287

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/285 (61%), Positives = 207/285 (73%), Gaps = 8/285 (3%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             A  KL  + + IAS  +L       T++N CKET+WPGIT ++N SGDGFALK GQS V+
Sbjct  7     ALLKLTSIFIVIASAPELCGSSKTFTLVNYCKETIWPGITRSDNHSGDGFALKSGQSTVY  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP GW+GRIW RTGCNFD +NG+    CQTG CG ++ C+  G PPAT ADFTLGE DF
Sbjct  67    TAPDGWSGRIWARTGCNFD-NNGNGK--CQTGGCGTSINCTVPGSPPATSADFTLGEPDF  123

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLPIVVK +NG GNCS VGCD DLR+NCPS+LA K   K +ACRSAC+VFN
Sbjct  124   YDVSLVDGFNLPIVVKAINGTGNCSTVGCDGDLRQNCPSELASKDNDKVIACRSACDVFN  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRG + +PA+CL +NYSK FK  CP AYSFA DDPTS+ITCS  ++VV FC SRN
Sbjct  184   TDEYCCRGTYGNPATCLASNYSKIFKQVCPAAYSFALDDPTSLITCSKANFVVIFCGSRN  243

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTT-VFNLGV  337
             QT C++ DK V C+   K      + W +L+   LP T VFNL +
Sbjct  244   QTACSYQDKQVVCNRPNKAYKAIPQSWWVLM---LPLTYVFNLRI  285



>ref|XP_009367296.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=287

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 210/283 (74%), Gaps = 8/283 (3%)
 Frame = -3

Query  1182  FPKLFLLLLAI---ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSA  1015
             F +L L LL++    SG KLS+   I TIINNCKETVWP +T   N +G GF LKPGQS 
Sbjct  5     FNRLMLPLLSVFMVLSGPKLSESARIFTIINNCKETVWPAVTPGENFNGGGFVLKPGQSI  64

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET  835
             VF AP  W+GRIWGRTGCNFDK NG+ S  CQTGSCG AL+C  +G+PPAT+A+FTL   
Sbjct  65    VFTAPVSWSGRIWGRTGCNFDK-NGNGS--CQTGSCGSALQCGASGKPPATLAEFTLAAL  121

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDGFNLP+VV P+NGKGNCS  GCD DLR NCP++LA+K+ GKTV CRSAC+V
Sbjct  122   DFYDVSLVDGFNLPLVVTPLNGKGNCSVSGCDGDLRPNCPNELAVKANGKTVGCRSACDV  181

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             F+TDEYCCRG + + A C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVV+FCS+
Sbjct  182   FDTDEYCCRGLYGNAAVCKPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFCST  241

Query  474   RNQTQCTFHDKNVSCSSDAKGMA-PFFKPWQMLLAVALPTTVF  349
             R Q  CT+H+  + C + +  +     + W ++L V +   ++
Sbjct  242   RKQPVCTYHNHKLVCGNGSGSVGLKSLRWWAVMLGVLMMINLW  284



>ref|XP_010272861.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=285

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 206/273 (75%), Gaps = 8/273 (3%)
 Frame = -3

Query  1146  SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             SG KLS+   + TI+N CKET+WPGIT  +N +G GF LKPGQS VF AP GW+GRIWGR
Sbjct  20    SGAKLSESARVFTIVNYCKETIWPGITPGDNFNGGGFVLKPGQSMVFTAPVGWSGRIWGR  79

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPI  790
             TGCNFDK NG+ S  C TGSCG  LKCS +G+PP ++A+FTL   DFYDVSLVDGFN+P+
Sbjct  80    TGCNFDK-NGNGS--CLTGSCGNTLKCSASGEPPTSLAEFTLASPDFYDVSLVDGFNIPV  136

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
             V+ PV G+GNCS  GCD DLR NCP++LA+KS GK VACRSAC+VF TDEYCC+G + +P
Sbjct  137   VITPVKGQGNCSVAGCDGDLRPNCPAELAVKSDGKIVACRSACDVFGTDEYCCKGVYGNP  196

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC  430
              +C PT YSK FK ACP AYS+A+DDPTS+ TCS TDY+VSFCSSR +T CT+H+  + C
Sbjct  197   VTCQPTYYSKKFKEACPAAYSYAYDDPTSIFTCSGTDYIVSFCSSRKRTVCTYHNNKLVC  256

Query  429   SSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             S  +  +  F + W  ++AV   T + NL ++ 
Sbjct  257   SG-SDSLKSFTRKWWAVIAV---TAMINLWIMF  285



>ref|XP_008378490.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=287

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/284 (61%), Positives = 211/284 (74%), Gaps = 10/284 (4%)
 Frame = -3

Query  1182  FPKLFLLLLAI---ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSA  1015
             F +L L LL++    SG KLS+   I TIINNCKETVWP +T   N +G GF LKPGQS 
Sbjct  5     FNRLMLPLLSVFMVLSGPKLSESARIFTIINNCKETVWPAVTPGENFNGGGFVLKPGQSI  64

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET  835
             VF AP  W+GRIWGRTGCNFDK NG+ S  CQTGSCG AL+C  +G+PPAT+A+FTL   
Sbjct  65    VFTAPVSWSGRIWGRTGCNFDK-NGNGS--CQTGSCGSALQCGASGKPPATLAEFTLTAL  121

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDGFNLP+VV P+NGKGNCS  GCD DLR NCP++LA+K+ GKTV CRSAC+V
Sbjct  122   DFYDVSLVDGFNLPLVVTPLNGKGNCSVSGCDMDLRPNCPNELAVKANGKTVGCRSACDV  181

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             F+TDEYCCRG + + A C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVV+FCS+
Sbjct  182   FDTDEYCCRGLYGNAAVCKPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFCST  241

Query  474   RNQTQCTFHDKNVSC--SSDAKGMAPFFKPWQMLLAVALPTTVF  349
             R Q  CT+H+  + C   S + G+    + W ++L V +   ++
Sbjct  242   RKQPVCTYHNHKLVCGNGSGSVGLTS-LRWWAVMLGVLMMINLW  284



>ref|XP_009799009.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=285

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/280 (59%), Positives = 207/280 (74%), Gaps = 7/280 (3%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             LL+L + SGVKLS+   I TIIN+CKETVWPG+   +N +G GF LK GQS +F AP G+
Sbjct  12    LLILFVLSGVKLSESARIFTIINHCKETVWPGVFPGDNFNGGGFTLKSGQSLIFTAPVGF  71

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
              GRIWGRTGCNFDK NG+ S  CQTG CG +LKCSGTG+ PA++A+FTL   DFYDVSLV
Sbjct  72    QGRIWGRTGCNFDK-NGNGS--CQTGDCGPSLKCSGTGKTPASLAEFTLASLDFYDVSLV  128

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFN+PI V P+NGKGNCS  GCD DLR++CP +LA+K+ GK VACRSAC+VF+TDEYCC
Sbjct  129   DGFNVPISVTPINGKGNCSIAGCDGDLRQDCPKELAVKANGKVVACRSACDVFDTDEYCC  188

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG + +P +C PT YSK FK  CP AYS+A+DDPTS+ TCS TDYV++FCSSR +  CT+
Sbjct  189   RGNYGNPTTCQPTYYSKKFKQVCPTAYSYAYDDPTSIYTCSGTDYVIAFCSSRKRPVCTY  248

Query  450   HDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
             HD  + C       +     W ++L + L   + NL ++ 
Sbjct  249   HDHKLVCGGSNGLRSLLSNLWMIILGLTL---IANLNIIF  285



>ref|XP_006386379.1| hypothetical protein POPTR_0002s08760g [Populus trichocarpa]
 gb|ERP64176.1| hypothetical protein POPTR_0002s08760g [Populus trichocarpa]
Length=260

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 196/262 (75%), Gaps = 5/262 (2%)
 Frame = -3

Query  1134  LSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCN  958
             + +C  I TI+N C+ETVWPG+T  +N +G GF LK GQS VF AP GW+GRIWGRTGC 
Sbjct  1     MMECARIFTIVNYCQETVWPGVTPGDNFNGGGFELKSGQSIVFTAPVGWSGRIWGRTGCK  60

Query  957   FDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKP  778
             FDK NGS S  C+TG CG +LKC  +G+ PA++A+FTL   DFYDVSLVDGFNLPI V P
Sbjct  61    FDK-NGSGS--CKTGPCGTSLKCKASGETPASLAEFTLTTLDFYDVSLVDGFNLPIAVTP  117

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCL  598
             VNGKGNCS  GCD DLR+ CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG + +P  C 
Sbjct  118   VNGKGNCSVAGCDADLRDTCPSELAVKSNGKVIACRSACDVFNTDEYCCRGVYGNPVVCQ  177

Query  597   PTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDA  418
             PT YSK FK ACP AYS+A+DDPTS+ TCS TDY+VSFCSSR Q  CT+HD  + CS   
Sbjct  178   PTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFCSSRKQPVCTYHDNKLVCSGSD  237

Query  417   KGMAPFF-KPWQMLLAVALPTT  355
             KG+     + W ++ AV L  T
Sbjct  238   KGLKSLITRWWALVFAVPLLLT  259



>ref|XP_011027593.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=281

 Score =   338 bits (868),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             +SG K+ +C  I TI+N C+ETVWP +T  +N +G GF LK GQS VF AP GW+GRIWG
Sbjct  18    SSGPKMMECARIFTIVNYCQETVWPAVTPGDNFNGGGFELKSGQSIVFTAPVGWSGRIWG  77

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC FDK NGS S  C+TG CG +LKC  +G+ PA++A+FTL   DFYDVSLVDGFNLP
Sbjct  78    RTGCKFDK-NGSGS--CKTGPCGTSLKCKASGETPASLAEFTLTTLDFYDVSLVDGFNLP  134

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             I V PVNGKGNCS  GCD DLR+ CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG + +
Sbjct  135   IAVTPVNGKGNCSVAGCDADLRDTCPSELAVKSNGKVIACRSACDVFNTDEYCCRGVYGN  194

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
             P  C PT YSK FK ACP AYS+A+DDPTS+ TCS TDY+VSFCSSR Q  CT+HD  + 
Sbjct  195   PVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFCSSRKQAVCTYHDNRLV  254

Query  432   CSSDAKGMAPFFKPWQMLLAVALPTT  355
             CS      +   + W ++ AV L  T
Sbjct  255   CSGSEGLESLITRWWALVFAVPLFIT  280



>ref|XP_011012813.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=281

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             +SG K+ +C  I TI+N C+ETVWP +T  +N +G GF LK GQS VF AP GW+GRIWG
Sbjct  18    SSGPKMMECARIFTIVNYCQETVWPAVTPGDNFNGGGFELKSGQSIVFTAPVGWSGRIWG  77

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC FDK NGS S  C+TG CG +LKC  +G+ PA++A+FTL   DFYDVSLVDGFNLP
Sbjct  78    RTGCKFDK-NGSGS--CKTGPCGTSLKCKASGETPASLAEFTLTTLDFYDVSLVDGFNLP  134

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             I V PVNGKGNCS  GCD DLR+ CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG + +
Sbjct  135   IAVTPVNGKGNCSVAGCDADLRDTCPSELAVKSNGKVIACRSACDVFNTDEYCCRGVYGN  194

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
             P  C PT YSK FK ACP AYS+A+DDPTS+ TCS TDY+VSFCSSR Q  CT+HD  + 
Sbjct  195   PVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFCSSRKQAVCTYHDNRLV  254

Query  432   CSSDAKGMAPFFKPWQMLLAVALPTT  355
             CS      +   + W ++ AV L  T
Sbjct  255   CSGSEGLKSLITRWWALVFAVPLFIT  280



>ref|XP_003531305.2| PREDICTED: thaumatin-like protein-like [Glycine max]
 gb|KHN48105.1| Thaumatin-like protein [Glycine soja]
Length=289

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/279 (60%), Positives = 207/279 (74%), Gaps = 5/279 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +F+++ A A  +  S  T  T++N CKET+WPGIT ++N SGDGFALK GQ+ V+ AP G
Sbjct  14    IFIVIFASAPELCGSNKT-FTLVNYCKETIWPGITRSDNHSGDGFALKSGQTTVYTAPDG  72

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSL  814
             W+GRIW RTGC+FD +NG+    C+TG CG ++ C+G G PPAT ADFTLGE DFYDVSL
Sbjct  73    WSGRIWARTGCDFD-NNGNGK--CKTGGCGTSINCTGPGSPPATSADFTLGEPDFYDVSL  129

Query  813   VDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             VDGFNLPIVVK +NG GNCS VGCD DLR+NCPS+LA K   K +ACRSAC+VFNTD+YC
Sbjct  130   VDGFNLPIVVKAINGTGNCSTVGCDGDLRQNCPSELASKDNDKVIACRSACDVFNTDDYC  189

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCT  454
             CRG + +PA+CL +NYSK FK  CP AYSFA DDPTS+ITCS  D+VV FC SRNQT C+
Sbjct  190   CRGTYGNPATCLASNYSKIFKQVCPAAYSFALDDPTSLITCSKADFVVIFCGSRNQTACS  249

Query  453   FHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGV  337
             + DK V C+   K      + W +L+ + L T  FNL +
Sbjct  250   YQDKQVVCNRPNKAYKAIPQSWWVLMLLPL-TYGFNLRI  287



>ref|XP_007159594.1| hypothetical protein PHAVU_002G250400g [Phaseolus vulgaris]
 gb|ESW31588.1| hypothetical protein PHAVU_002G250400g [Phaseolus vulgaris]
Length=286

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 199/271 (73%), Gaps = 5/271 (2%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             A  KL  + + I S  +L       T++N CKET+WPG+T ++N SGDGF LK GQ+ V+
Sbjct  7     ALLKLTSIFIVIVSAPELCGSNKTFTLVNYCKETIWPGVTRSDNHSGDGFTLKSGQTTVY  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP GW+GRIW RTGCNFD S    +  CQTG CG ++ C+G G PPAT ADF+LGE D+
Sbjct  67    TAPDGWSGRIWARTGCNFDSS---GNGKCQTGGCGTSINCTGPGNPPATSADFSLGELDY  123

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLV+GFNLPIVVK +NG GNCS VGCD DLR+NCPS+LA K  GK +AC+SAC+VFN
Sbjct  124   YDVSLVNGFNLPIVVKAINGTGNCSTVGCDGDLRQNCPSELASKDNGKVIACQSACDVFN  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRG + +PA+CLP+NYSK FK  CP AYSFA DDPTS+ITCS  D+VV FC SRN
Sbjct  184   TDEYCCRGTYGNPATCLPSNYSKIFKQVCPAAYSFALDDPTSLITCSKADFVVIFCGSRN  243

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLL  376
             QT C+++DK   C   +KG     + W +L+
Sbjct  244   QTTCSYNDKQAVC-KQSKGYKAIPQSWWILM  273



>ref|XP_002273271.2| PREDICTED: thaumatin-like protein [Vitis vinifera]
 emb|CBI23858.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 209/281 (74%), Gaps = 7/281 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAP  1000
             LFL+ + I  G KL    T  TI+N+C ETVWPGI T   N  G GFALKPGQSA+F A 
Sbjct  11    LFLIAIFILLGGKLCESATTFTIVNDCNETVWPGIITPGLNFHGGGFALKPGQSAIFTAA  70

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
               W GRIWGRTGC+FDK NGS    CQTG+CG  L C+  G+PPA+IA+F LG+ D+YDV
Sbjct  71    DVWGGRIWGRTGCSFDK-NGSGK--CQTGACGTTLNCTSPGKPPASIAEFNLGDIDYYDV  127

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             SLVDGFNLPI + P+ G  NCS  GCD DLR+ CPS+LALK+ GK +AC+SAC  FNTD+
Sbjct  128   SLVDGFNLPITITPMKGTVNCSVAGCDADLRQKCPSELALKTDGKIIACKSACEAFNTDQ  187

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             YCCRGA+ +P SC+ TNYS+SFK ACP+AYS+AFDDPTS++TC+A +Y+V+FC SRNQT 
Sbjct  188   YCCRGAYGNPISCVATNYSRSFKQACPVAYSYAFDDPTSILTCNAPEYIVTFCPSRNQTA  247

Query  459   CTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGV  337
             C++HDK ++C++ +KG       W  LL + L + + NLG+
Sbjct  248   CSYHDKKLNCNA-SKGSKELSHTWWWLLILPLASMI-NLGL  286



>ref|XP_011075024.1| PREDICTED: thaumatin-like protein, partial [Sesamum indicum]
Length=280

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 202/268 (75%), Gaps = 7/268 (3%)
 Frame = -3

Query  1137  KLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             KLS C  I TI+N CKET+WP +T   N +G GF LKPGQ+ VF AP GW GRIWGRTGC
Sbjct  16    KLSDCARIFTIVNYCKETIWPAVTPGENFNGGGFTLKPGQTIVFTAPVGWTGRIWGRTGC  75

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVK  781
             NFD+ NG+ S  CQTG+CG + KCS +G+PPA++A+FTL   DFYDVSLVDGFNLPI V 
Sbjct  76    NFDR-NGNGS--CQTGACGTSYKCSASGKPPASLAEFTLAALDFYDVSLVDGFNLPIAVT  132

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             P+NG+GNCS  GCD DLR NCP++LA+K +GG+ VACRSAC+VFNTDEYCCRG + +P +
Sbjct  133   PINGRGNCSVAGCDTDLRPNCPTELAVKGNGGRNVACRSACDVFNTDEYCCRGVYGNPVT  192

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSS  424
             C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVVSFCSSR Q  CT+H+  + C  
Sbjct  193   CQPTFYSKRFKQACPAAYSYAYDDPTSIFTCSGTDYVVSFCSSRKQPVCTYHNNRLMCGG  252

Query  423   DAKGMAPFFKPWQML-LAVALPTTVFNL  343
              + G+      W M+ LA+ + T + N+
Sbjct  253   -STGLTAIGGKWGMMALALIITTALSNI  279



>ref|XP_010471966.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 199/269 (74%), Gaps = 6/269 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L   SG K S+   + TI+N+C + +WP IT   N +G GF LKPGQS VF A
Sbjct  9     PRILLLFLTFLSGTKWSESARVFTIVNSCDQKIWPAITPGENFNGGGFELKPGQSIVFTA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGC FD S G+ +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCKFD-STGTGT--CETGSCGSTLKCSASGKPPASLAEFTLAAVDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR +CPS+LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSELAVKSNGKVISCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TCSA+DY++SFCSSR + 
Sbjct  186   EYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSASDYIISFCSSRKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLL  376
              CT+HD  + CS+  K M   F  W +L+
Sbjct  246   VCTYHDNKLGCSNGFKTMTGRF--WLVLI  272



>ref|XP_006493528.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
Length=289

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 210/282 (74%), Gaps = 10/282 (4%)
 Frame = -3

Query  1164  LLLAIASGVKL-SKCTNITIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAPSGW  991
             +++ +ASG K+ +   NIT++N C+ET+WPGI T   N  GDGF LKPGQSA +  P GW
Sbjct  14    IIIILASGSKMYASSKNITLVNVCQETIWPGIITQGGNYHGDGFTLKPGQSASYNPPDGW  73

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDVSL  814
             +GRIW RTGCNF+    +S+S C+TGSCG ++ C+  G  P TIA+FTLG   D+YDVSL
Sbjct  74    SGRIWARTGCNFN----NSTSSCKTGSCGSSINCTSPGSLPVTIAEFTLGANVDYYDVSL  129

Query  813   VDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             VDGFN+P+ V+P NGKGNCS  GCD DLR+NCPSDLA+K  GK + CRSAC+ FN+DEYC
Sbjct  130   VDGFNVPVSVRPFNGKGNCSNAGCDGDLRQNCPSDLAVKDNGKVIGCRSACDAFNSDEYC  189

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCT  454
             C+GAF    SCLP+NYSKSFK  CP A S+AFDD TS+ITCSATDY+V FC+SRNQT C+
Sbjct  190   CKGAFGDLTSCLPSNYSKSFKQVCPAASSYAFDDRTSIITCSATDYIVGFCASRNQTVCS  249

Query  453   FHDKNVSCSSDAKGMAPFFKP-WQMLLAVALPTTVFNLGVLL  331
             +HD  + C +++KG   F +  WQ+LL +ALP  + N+  L 
Sbjct  250   YHDNKLFC-NESKGSKAFPQSWWQLLLMLALP-PILNIQALF  289



>ref|XP_010416727.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 200/269 (74%), Gaps = 6/269 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L   SG K S+   + TI+N+C + +WP IT   N +G GF LKPGQS VF A
Sbjct  9     PRILLLFLTFLSGTKWSESARVFTIVNSCDQKIWPAITPGENFNGGGFELKPGQSIVFTA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGC FD S G+ +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCKFD-STGTGT--CETGSCGSTLKCSASGKPPASLAEFTLAAVDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR +CPS+LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSELAVKSNGKVISCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC+A+DY++SFCSSR + 
Sbjct  186   EYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCTASDYIISFCSSRKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLL  376
              CT+HD  + CS+  K M+  F  W +L+
Sbjct  246   VCTYHDNKLGCSNGFKTMSGRF--WLVLI  272



>ref|XP_006431908.1| hypothetical protein CICLE_v10002066mg [Citrus clementina]
 gb|ESR45148.1| hypothetical protein CICLE_v10002066mg [Citrus clementina]
Length=289

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/282 (58%), Positives = 210/282 (74%), Gaps = 10/282 (4%)
 Frame = -3

Query  1164  LLLAIASGVKL-SKCTNITIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAPSGW  991
             +++ +ASG K+ +   NIT++N C+ET+WPGI T   N  GDGF LKPGQSA +  P GW
Sbjct  14    IIIILASGSKMYASAKNITLVNVCQETIWPGIITQGGNYHGDGFTLKPGQSASYNPPDGW  73

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDVSL  814
             +GRIW RTGCNF+    +S+S C+TGSCG ++ C+  G  P TIA+FTLG   D+YDVSL
Sbjct  74    SGRIWARTGCNFN----NSTSSCKTGSCGSSINCTSPGSLPVTIAEFTLGANVDYYDVSL  129

Query  813   VDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             VDGFN+P++V+P NGKGNCS  GCD DLR+NCPSDLA+K  GK + CRSAC+ FN+DEYC
Sbjct  130   VDGFNVPVLVRPFNGKGNCSNAGCDGDLRQNCPSDLAVKDNGKVIGCRSACDAFNSDEYC  189

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCT  454
             C+GAF    SCL +NYSKSFK  CP A S+AFDD TS+ITCSATDY+V FC+SRNQT C+
Sbjct  190   CKGAFGDLTSCLASNYSKSFKQVCPAASSYAFDDRTSIITCSATDYIVGFCASRNQTVCS  249

Query  453   FHDKNVSCSSDAKGMAPFFKP-WQMLLAVALPTTVFNLGVLL  331
             +HD  + C +++KG   F +  WQ+LL +ALP  + N+  L 
Sbjct  250   YHDNKLFC-NESKGSKAFPQSWWQLLLMLALP-PILNIQALF  289



>ref|XP_004513301.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=287

 Score =   331 bits (848),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 196/269 (73%), Gaps = 5/269 (2%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             L+L+ I SG +  +   + TI+N CKETVWP +      +G GF LKPGQS+VF AP  W
Sbjct  13    LVLVIILSGQRTCESARVFTIVNYCKETVWPAVIPGEKFNGGGFVLKPGQSSVFTAPISW  72

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIW RTGCNFD+     + PCQTGSCG  LKC G G+ PA++A+FTL + DFYDVSLV
Sbjct  73    SGRIWARTGCNFDQDG---NGPCQTGSCGTTLKCGGAGKTPASLAEFTLAQPDFYDVSLV  129

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFN+PI VKP+NGKGNCS  GCD DLR  CP +L++K+ GKT+ CRSAC+VFNTDEYCC
Sbjct  130   DGFNVPISVKPLNGKGNCSTAGCDSDLRLTCPKELSVKANGKTIGCRSACDVFNTDEYCC  189

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG F +P++C PT YSK FK ACP +YS+A+DDPTS+ TC+ TDY+++FC+ R +  CT+
Sbjct  190   RGNFGNPSTCRPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYIIAFCADRKKQMCTY  249

Query  450   HDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             HD  + CS  ++G+    + W M + +  
Sbjct  250   HDHKLHCSG-SQGLRSLIRSWWMAMIMVF  277



>ref|XP_008465794.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=285

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 195/251 (78%), Gaps = 5/251 (2%)
 Frame = -3

Query  1173  LFLLLLAI-ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAP  1000
             LFL +L I +SG ++S+   + TIINNCKET+WPGIT   + +G GFALK GQS VF AP
Sbjct  6     LFLFILFIFSSGGRISESARVFTIINNCKETIWPGITPGESFNGGGFALKRGQSIVFNAP  65

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
              GW+GRIWGRTGCNFD+S    +  CQTG+CG +LKCS +G+ PA++A+FTL   DFYDV
Sbjct  66    VGWSGRIWGRTGCNFDESG---TGECQTGACGNSLKCSASGKTPASLAEFTLAALDFYDV  122

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             SLVDGFNLP+ V+P+NG G C   GCD+DLR  CP +LA+KS GK VACRSAC+VF+ DE
Sbjct  123   SLVDGFNLPMAVRPINGTGKCGVAGCDRDLRPECPKELAVKSKGKVVACRSACDVFDKDE  182

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             YCCRG + +P +C PT YSK FK ACP AYS+A+DDPTS+ TCSA DYV++FCS+RNQ  
Sbjct  183   YCCRGVYGNPVTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFCSNRNQPV  242

Query  459   CTFHDKNVSCS  427
             CT+H+  + CS
Sbjct  243   CTYHNHKLVCS  253



>gb|KGN50964.1| hypothetical protein Csa_5G374740 [Cucumis sativus]
Length=307

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/270 (59%), Positives = 201/270 (74%), Gaps = 8/270 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
              F +L+  +SG ++S+   + TIINNCKET+WPGI    N +G GFALK GQS VF AP 
Sbjct  29    FFFVLIIFSSGGRISESARVFTIINNCKETIWPGIFPGENFNGGGFALKRGQSIVFNAPV  88

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGC FD+ NG+    CQTG+CG +LKCSG+G+ PA++A+FTL   DFYDVS
Sbjct  89    GWSGRIWGRTGCTFDE-NGTGE--CQTGACGNSLKCSGSGKTPASLAEFTLAALDFYDVS  145

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+ V+P+NG G C   GCDKDLR  CP +LA+KS GK VACRSAC+VF+ DEY
Sbjct  146   LVDGFNLPMAVRPINGTGKCGVAGCDKDLRPECPKELAVKSKGKVVACRSACDVFDKDEY  205

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG + +P +C PT YSK FK ACP AYS+A+DDPTS+ TCSA DYV++FCS+RNQ  C
Sbjct  206   CCRGVYGNPMTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFCSNRNQPVC  265

Query  456   TFHDKNVSC--SSDAKGMAPFFKPWQMLLA  373
             T+H+  + C  S+  K   P  + W + +A
Sbjct  266   TYHNHKLVCSGSNTLKSFVP--ERWALPMA  293



>ref|XP_010063355.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW70570.1| hypothetical protein EUGRSUZ_F03757 [Eucalyptus grandis]
Length=287

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 194/269 (72%), Gaps = 8/269 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L L+L  +++G   S    I TIIN CKE+VWP IT   N  G GF LK GQS VF AP 
Sbjct  11    LLLILAILSTGPGFSDSARIFTIINKCKESVWPAITPGENFGGGGFILKSGQSIVFTAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGC FDK NG+ +  CQTGSCG  LKC  +G PPAT+A+FTL  TDFYDVS
Sbjct  71    GWSGRIWGRTGCTFDK-NGNGT--CQTGSCGSELKCKASGDPPATLAEFTLTATDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+ V P+NG+GNCS  GCD+DLR  CPS+L++K  GKTV CRSAC+VFNTDEY
Sbjct  128   LVDGFNLPLAVTPINGQGNCSVAGCDRDLRPTCPSELSVKMKGKTVGCRSACDVFNTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CC+G + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC  TDYV++FCS RNQT C
Sbjct  188   CCKGVYGNPVICQPTYYSKLFKQACPTAYSYAYDDPTSIFTCVGTDYVITFCSPRNQTVC  247

Query  456   TFHDKNVSCSSDAKGMAPFFKPWQMLLAV  370
             T+H+  + CS  +      FK    +L +
Sbjct  248   TYHNNKLVCSGSSNN----FKSQTTILGI  272



>ref|XP_010668000.1| PREDICTED: thaumatin-like protein [Beta vulgaris subsp. vulgaris]
Length=294

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 200/279 (72%), Gaps = 6/279 (2%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSA  1015
             S   P  F++ L      +LS+   + TI N+CKET+WP +T   + +G GF LKPGQS 
Sbjct  7     SLLLPFFFIIFLLSQGSWRLSEAARVFTITNHCKETIWPAVTPGESFNGGGFVLKPGQSM  66

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET  835
             VF AP  W+GRIWGRTGCNFD+     + PCQTG+CG  LKC G G  PA++A+FTLG+T
Sbjct  67    VFNAPMTWSGRIWGRTGCNFDQDG---NGPCQTGACGTTLKCGGAGATPASLAEFTLGKT  123

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSG--GKTVACRSAC  661
             DFYDVSLVDGFN+P+ VKP+ G GNC+  GCDKDLR NCP +L++K+   GKTVACRSAC
Sbjct  124   DFYDVSLVDGFNIPVAVKPLKGTGNCTIAGCDKDLRRNCPKELSVKTSNHGKTVACRSAC  183

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             +VF+TDEYCCRG +  P+ C PT YSK FK+ACP AYS+A+DDP+S+ TCS+ DYV++FC
Sbjct  184   DVFDTDEYCCRGLYGGPSVCHPTYYSKLFKSACPTAYSYAYDDPSSIFTCSSADYVITFC  243

Query  480   SSRNQTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             SSR+Q  C +HD  + C+      +     W + +A+AL
Sbjct  244   SSRSQPVCVYHDHRLICNGSTSLKSLLNSRWSLTVAIAL  282



>ref|XP_006472729.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
Length=288

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 203/280 (73%), Gaps = 10/280 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
               ++ + I+SG ++ +   + TI+N+CKET+WP IT   N +  GF LK GQS VF AP 
Sbjct  11    FVMISVIISSGARMGESARVFTIVNDCKETIWPAITPGENFNNGGFPLKSGQSIVFNAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGR+GC FDK NG+ S  C TG+CG +LKCS +G+PPAT+A+FTL   DFYDVS
Sbjct  71    GWSGRIWGRSGCKFDK-NGNGS--CLTGACGTSLKCSASGEPPATLAEFTLSALDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+ VKP+NGKGNCS  GCD DLR  CPS+L++KS GKTVACRSAC+VFNTDEY
Sbjct  128   LVDGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSVKSKGKTVACRSACDVFNTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDYV++FCS R Q  C
Sbjct  188   CCRGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFCSPRKQPVC  247

Query  456   TFHDKNVSCSSD----AKGMAPFFKPWQMLLAVALPTTVF  349
             T+H+  + CS       KG+      W+ +L + +   ++
Sbjct  248   TYHNNKLVCSGSKSNGVKGLTGVI--WRAMLGIMIMVALW  285



>ref|XP_007141088.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
 gb|ESW13082.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
Length=286

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 199/273 (73%), Gaps = 6/273 (2%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSA  1015
              T FP  FLL L + SG K  +C  + TI+N CKET+WP +T      G GF LKPGQS 
Sbjct  6     QTIFPITFLLALLL-SGQKPCECARVFTIVNYCKETLWPAVTPGEKFDGGGFVLKPGQSE  64

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET  835
             VF AP  W+GRIW RTGC FD+ NG     CQTGSCG  LKC  +G+ PA++A+FTL + 
Sbjct  65    VFTAPVSWSGRIWARTGCKFDQ-NGKGQ--CQTGSCGDTLKCGASGKTPASLAEFTLAQP  121

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDGFN+PI V+P+NGKGNCS+ GCD DLR  CP++LALK+ GKTV CRSAC+V
Sbjct  122   DFYDVSLVDGFNVPIAVRPINGKGNCSSAGCDSDLRTTCPNELALKANGKTVGCRSACDV  181

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FNTDEYCCRG + +P++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYV++FCSS
Sbjct  182   FNTDEYCCRGLYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSIFTCSGTDYVIAFCSS  241

Query  474   RNQTQCTFHDKNVSCSSDAKGMAPFFKPWQMLL  376
             R +  CT+H   + CS  ++G+      W +++
Sbjct  242   RKRQVCTYHSNKLHCSG-SQGLKSLIGRWCIVI  273



>ref|XP_002284403.3| PREDICTED: pathogenesis-related protein 5 [Vitis vinifera]
 emb|CBI19063.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 203/277 (73%), Gaps = 7/277 (3%)
 Frame = -3

Query  1179  PKLFLLLLAIASGV-KLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFA  1006
             P  FLL+L + S V ++S+   + TI N+CKET+WP +       G GFALK GQS VF 
Sbjct  32    PLSFLLILIVVSSVPQMSESARVFTITNDCKETIWPAVFPGEYFDGGGFALKTGQSRVFT  91

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFY  826
             AP  W+GRIWGR+GCNFDK+   +   CQTGSCG  +KCS +G+ PAT+A+FTL   DFY
Sbjct  92    APLSWSGRIWGRSGCNFDKTGKGN---CQTGSCGDNIKCSASGKTPATLAEFTLAALDFY  148

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDGFNLP+VVKP+NGKGNCS  GCD +LR+ CPS+LALKS GKTV CRSAC+VFNT
Sbjct  149   DVSLVDGFNLPLVVKPINGKGNCSIAGCDSNLRDTCPSELALKSSGKTVGCRSACDVFNT  208

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSA-TDYVVSFCSSRN  469
             DEYCC+G + + A+C+PT+YSK FK ACP AYS+A+DDP+S+ TCS  TDYV++FC SR 
Sbjct  209   DEYCCKGLYGNAATCVPTSYSKKFKEACPAAYSYAYDDPSSIFTCSGTTDYVITFCGSRR  268

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPT  358
             Q  CT+H+  + CS  +KG+      W  ++   L T
Sbjct  269   QPACTYHNNKLICSG-SKGLRSLIGAWWAVMLTFLLT  304



>ref|XP_010912035.1| PREDICTED: pathogenesis-related protein 5 [Elaeis guineensis]
Length=284

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 201/273 (74%), Gaps = 7/273 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L  +LL I+SG K S+   + T++N CK T+WP IT   N +G G AL+ GQS VF AP 
Sbjct  9     LLTVLLLISSGAKWSEGARVFTLVNECKTTIWPAITPGENFNGGGLALRSGQSVVFTAPV  68

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGCNFD++   S   CQTG+CG ALKCS +G+PPAT+A+FTL   DFYDVS
Sbjct  69    GWSGRIWGRTGCNFDQAGNGS---CQTGACGTALKCSASGEPPATLAEFTLAAMDFYDVS  125

Query  816   LVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             LVDGFNLPI V PVNGKG NCSA GC+ DLR +CP++LA+ + GKTVACRSAC+VF+TD+
Sbjct  126   LVDGFNLPITVMPVNGKGGNCSAAGCNTDLRNSCPTELAVMADGKTVACRSACDVFDTDQ  185

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS-SRNQT  463
             YCCRG + +P +C PT YSK FK ACP AYS+A+DDPTS+ TC   DY+++FC+  R QT
Sbjct  186   YCCRGVYGNPVTCQPTYYSKKFKQACPTAYSYAYDDPTSIFTCLEGDYIITFCAIGRKQT  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
              CT+H+  + CS  + G A     W +L+ + +
Sbjct  246   VCTYHNHRLVCSGSS-GSASLIYKWLVLMLLCM  277



>ref|XP_006434136.1| hypothetical protein CICLE_v10002069mg [Citrus clementina]
 gb|ESR47376.1| hypothetical protein CICLE_v10002069mg [Citrus clementina]
Length=288

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 202/280 (72%), Gaps = 10/280 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
               ++ + I+SG ++ +   + TI+N+CKET+WP IT   N +  GF LK GQS VF AP 
Sbjct  11    FVMISVIISSGARMGESARVFTIVNDCKETIWPAITPGENFNNGGFPLKSGQSIVFNAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGR+GC FDK NG+ S  C TG+CG +LKCS +G PPAT+A+FTL   DFYDVS
Sbjct  71    GWSGRIWGRSGCKFDK-NGNGS--CLTGACGTSLKCSASGAPPATLAEFTLSALDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFNLP+ VKP+NGKGNCS  GCD DLR  CPS+L++KS GKTVACRSAC+VFNTDEY
Sbjct  128   LVDGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSVKSKGKTVACRSACDVFNTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDYV++FCS R Q  C
Sbjct  188   CCRGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFCSPRKQPVC  247

Query  456   TFHDKNVSCSSD----AKGMAPFFKPWQMLLAVALPTTVF  349
             T+H+  + CS       KG+      W+ +L + +   ++
Sbjct  248   TYHNNKLVCSGSKSNGVKGLTGVL--WRAMLGIMIMVALW  285



>gb|KDO80739.1| hypothetical protein CISIN_1g023852mg [Citrus sinensis]
Length=276

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 203/278 (73%), Gaps = 10/278 (4%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             ++ + I+SG ++ +   + TI+N+CKET+WP IT   N +  GF LK GQS VF AP GW
Sbjct  1     MISVIISSGARMGESARVFTIVNDCKETIWPAITPGENFNNGGFPLKSGQSIVFNAPVGW  60

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIWGR+GC FDK NG+ S  C TG+CG +LKCS +G PPAT+A+FTL   DFYDVSLV
Sbjct  61    SGRIWGRSGCKFDK-NGNGS--CLTGACGTSLKCSASGAPPATLAEFTLSALDFYDVSLV  117

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFNLP+ VKP+NGKGNCS  GCD DLR  CPS+L++KS GKTVACRSAC+VFNTDEYCC
Sbjct  118   DGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSVKSKGKTVACRSACDVFNTDEYCC  177

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDYV++FCS R Q  CT+
Sbjct  178   RGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFCSPRKQPVCTY  237

Query  450   HDKNVSC----SSDAKGMAPFFKPWQMLLAVALPTTVF  349
             H+  + C    S+  KG+      W+ +L + +   ++
Sbjct  238   HNNKLVCSGSKSNGVKGLTGVI--WRAMLGIMIMVALW  273



>emb|CDY44520.1| BnaCnng11310D [Brassica napus]
Length=285

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 203/275 (74%), Gaps = 9/275 (3%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L + SG K S+   + TI+N+C +T+WP IT   N +G GF LKPGQS VF A
Sbjct  9     PRILLLFLTLLSGTKWSESARVFTIVNSCDQTIWPAITPGENFNGGGFELKPGQSIVFNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAALDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR  CP +LA+KS GK V+CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRSKCPPELAVKSKGKVVSCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P +C PTNYSK FK ACP AYS+A+DDPTS+ TCS TDYV+SFCSS+ + 
Sbjct  186   EYCCRGVYGNPVTCRPTNYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVISFCSSKKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFF----KPWQMLLAV  370
              CT+HD  ++C SD  G   F     + W +L+++
Sbjct  246   VCTYHDNKLAC-SDGSGSGGFRTMTGRLWLILMSL  279



>ref|XP_002528602.1| Protein P21, putative [Ricinus communis]
 gb|EEF33760.1| Protein P21, putative [Ricinus communis]
Length=290

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 196/266 (74%), Gaps = 5/266 (2%)
 Frame = -3

Query  1152  IASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDGFALKPGQSAVFAAPSGWNGRIW  976
             I SG   S     T++NNCKET+WPGI T  NDS G GF LKPGQ+ +  AP GW+GRIW
Sbjct  19    ITSGQNASSTKTFTLLNNCKETIWPGIITKGNDSDGKGFPLKPGQTNLHYAPIGWSGRIW  78

Query  975   GRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNL  796
              RTGCNFDK NG+ +  CQTGSCG  L CSG   PP TIA+FTLG+ DF+D+SLV+GFNL
Sbjct  79    ARTGCNFDK-NGTGT--CQTGSCGAYLNCSGPSSPPNTIAEFTLGDNDFFDISLVNGFNL  135

Query  795   PIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFS  616
             P+V+ P+N KGNCS  GCD DLR+NCP +L+++S GK +ACRSAC+VFNTD YCCRGA+S
Sbjct  136   PVVISPLNSKGNCSIAGCDGDLRQNCPPELSVRSDGKVIACRSACDVFNTDAYCCRGAYS  195

Query  615   SPASCLPTNYSKSFKAACPIAYSFAFD-DPTSVITCSATDYVVSFCSSRNQTQCTFHDKN  439
              P +C P+NYS+ FK  CP + S+AFD D TS+ITCSA+DYVV+FC+SRNQT C++HD  
Sbjct  196   DPEACAPSNYSRIFKQVCPASSSYAFDRDATSIITCSASDYVVAFCASRNQTFCSYHDNE  255

Query  438   VSCSSDAKGMAPFFKPWQMLLAVALP  361
             V C++ A            +L V LP
Sbjct  256   VQCNTSANDSKALLPHGWWILMVTLP  281



>ref|XP_009128246.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=286

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 201/273 (74%), Gaps = 9/273 (3%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L + SG K S+   + TI+N+C +T+WP IT   N +G GF LKPGQS VF A
Sbjct  9     PRILLLFLTLLSGTKWSESARVFTIVNSCDQTIWPAITPGENFNGGGFELKPGQSIVFNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAALDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR  CP +LA+KS GK V+CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRSKCPPELAVKSKGKVVSCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P +C PTNYSK FK ACP AYS+A+DDPTS+ TCS TDYV+SFCSS+ + 
Sbjct  186   EYCCRGVYGNPVTCRPTNYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVISFCSSKKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFF----KPWQMLL  376
              CT+HD  ++C SD  G   F     + W +L+
Sbjct  246   VCTYHDNKLAC-SDGSGSGGFRTMTGRLWLILM  277



>ref|XP_002303159.2| hypothetical protein POPTR_0003s01430g [Populus trichocarpa]
 gb|EEE78138.2| hypothetical protein POPTR_0003s01430g [Populus trichocarpa]
Length=298

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 209/279 (75%), Gaps = 6/279 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLS-KCTNITIINNCKETVWPGITTN-NNDSGDGFALKPGQSAVFAAP  1000
             + +L +A+A+G   S +  + T++NNC ET+WPGI T  NN +G GFAL+ GQ+A + A 
Sbjct  17    VLILQIAMAAGQNTSTEAKSFTLVNNCNETIWPGILTRGNNSNGYGFALQQGQTAFYNAT  76

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
             +GW+GR+W RTGC+FDK NG+ +  CQTGSCG ++ C+    PP TIA+FTLG+ DFYDV
Sbjct  77    AGWSGRMWARTGCSFDK-NGTGT--CQTGSCGTSINCTVPSNPPNTIAEFTLGDVDFYDV  133

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             SLVDGFNLP+V+ P++GKGNCS  GCD DLR+NC S LA+KS GK +ACRSAC+ FNTDE
Sbjct  134   SLVDGFNLPVVISPIDGKGNCSISGCDGDLRQNCSSGLAVKSDGKVIACRSACDAFNTDE  193

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             YCCRGA++ P +CLPTNYS+SFK  CP A S+AFDD  S+ITCSA++YVV+FC+SRNQ  
Sbjct  194   YCCRGAYADPVACLPTNYSRSFKQVCPAAASYAFDDSISIITCSASEYVVTFCASRNQKV  253

Query  459   CTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNL  343
             C++HD  + C++     A        +L +ALP T +NL
Sbjct  254   CSYHDNKLVCNTSNGSKASPLGLGGWILVLALPLT-YNL  291



>ref|XP_011007951.1| PREDICTED: pathogenesis-related protein 5-like [Populus euphratica]
Length=298

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 213/285 (75%), Gaps = 6/285 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLS-KCTNITIINNCKETVWPGITTN-NNDSGDGFALKPGQSAVFAAP  1000
             + +L +A+A+G   S +  + T++NNC +TVWPGI T  NN +G GFAL+ GQ+A ++A 
Sbjct  17    VLILQIAMAAGQNTSTEAKSFTLVNNCNDTVWPGILTRGNNSNGYGFALQQGQTAFYSAT  76

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
             +GW+GR+W RTGC+FDK NG+ +  CQTGSCG ++ C+   +PP TIA+FTLG+ DFYDV
Sbjct  77    AGWSGRMWARTGCSFDK-NGTGT--CQTGSCGTSINCTVPSKPPNTIAEFTLGDVDFYDV  133

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             SLVDGFNLPIV+ P++GKGNCS  GCD DLR+NC S LA+KS GK +ACRSAC+ FNTDE
Sbjct  134   SLVDGFNLPIVISPIDGKGNCSIAGCDGDLRQNCSSGLAVKSDGKVIACRSACDAFNTDE  193

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             YCCRGA++ P +CLPTN+S+SFK  CP A S+AFDD  S+ITCSA++Y+V+FC+SRNQ  
Sbjct  194   YCCRGAYADPVACLPTNFSRSFKQVCPAAASYAFDDSISIITCSASEYIVTFCASRNQKV  253

Query  459   CTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL*H  325
             C++HD  + C++     A        ++ +ALP T +NL +   H
Sbjct  254   CSYHDNKLVCNTSNGSKASPLGLGGWIVVLALPLT-YNLKMKFYH  297



>ref|XP_006369356.1| hypothetical protein POPTR_0001s21790g [Populus trichocarpa]
 gb|ERP65925.1| hypothetical protein POPTR_0001s21790g [Populus trichocarpa]
Length=299

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 198/254 (78%), Gaps = 7/254 (3%)
 Frame = -3

Query  1113  TIINNCKETVWPGITTN-NNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
             T++NNCKE +WPGI T  +++ G+GFALKPGQ+A++ A  GW+GRIW RTGCNFDK+   
Sbjct  41    TLVNNCKEMIWPGIITKGDSNRGEGFALKPGQTAIYNATVGWSGRIWARTGCNFDKT---  97

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGE-TDFYDVSLVDGFNLPIVVKPVNGKGN  760
              +  CQTGSCG +L C+G   PP TIA+FTLG+  DFYD+SLVDG+NLPIV+ P+NGKGN
Sbjct  98    GTGTCQTGSCGTSLNCTGPSNPPNTIAEFTLGDDVDFYDLSLVDGYNLPIVISPINGKGN  157

Query  759   CSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSK  580
             CS  GC+ DLR+NC S+LA+KS GK +ACRSACN FNTDEYCCRGAF+ PA+C P+NYS+
Sbjct  158   CSIAGCEGDLRQNCSSELAVKSNGKVIACRSACNAFNTDEYCCRGAFADPAACQPSNYSR  217

Query  579   SFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMAPF  400
             SFK  CP A S+AFDD  S+ITCSA++Y++ FC+SRNQ+ C++HDK + C++     AP 
Sbjct  218   SFKQVCPAASSYAFDDRASIITCSASEYIIIFCASRNQSVCSYHDKKLVCNTSTGSTAPP  277

Query  399   FKP--WQMLLAVAL  364
                  W  +L++++
Sbjct  278   LDLGGWIRMLSLSM  291



>gb|KDO50915.1| hypothetical protein CISIN_1g024541mg [Citrus sinensis]
Length=266

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 200/266 (75%), Gaps = 9/266 (3%)
 Frame = -3

Query  1119  NITIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSN  943
             NIT++N C+ET+WPGI T   N  GDGF LKPGQSA +  P GW+GRIW RTGCNF+   
Sbjct  7     NITLVNVCQETIWPGIITQGGNYHGDGFTLKPGQSASYNPPDGWSGRIWARTGCNFN---  63

Query  942   GSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKPVNGK  766
              +S+S C+TGSCG ++ C+  G  P TIA+FTLG   D+YDVSLVDGFN+P++V+P NGK
Sbjct  64    -NSTSSCKTGSCGSSINCTSPGSLPVTIAEFTLGANVDYYDVSLVDGFNVPVLVRPFNGK  122

Query  765   GNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNY  586
             GNCS  GCD DLR+NCPSDLA+K  GK + CRSAC+ FN+DEYCC+GAF    SCL +NY
Sbjct  123   GNCSNAGCDGDLRQNCPSDLAVKDNGKVIGCRSACDAFNSDEYCCKGAFGDLTSCLASNY  182

Query  585   SKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMA  406
             SKSFK  CP A S+AFDD TS+ITCSATDY+V FC+SRNQT C++HD  + C +++KG  
Sbjct  183   SKSFKQVCPAASSYAFDDRTSIITCSATDYIVGFCASRNQTVCSYHDNKLFC-NESKGSK  241

Query  405   PFFKP-WQMLLAVALPTTVFNLGVLL  331
              F +  WQ+LL +ALP  + N+  L 
Sbjct  242   AFPQSWWQLLLMLALP-PILNIQALF  266



>ref|XP_011001430.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=285

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 196/263 (75%), Gaps = 5/263 (2%)
 Frame = -3

Query  1155  AIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRI  979
             A++SG K+ +   + TI N CKETVWPGI    N +G GF LKPGQS+V  AP GW+GRI
Sbjct  20    AVSSGPKMIESLRVFTITNYCKETVWPGIFPGENFNGGGFELKPGQSSVLNAPVGWSGRI  79

Query  978   WGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFN  799
             WGRTGC FDK NG+ S  C+TG+CG  LKC  +G+ PA++A+FTL   DFYDVSLVDGFN
Sbjct  80    WGRTGCRFDK-NGNGS--CKTGTCGSFLKCRASGETPASLAEFTLTTLDFYDVSLVDGFN  136

Query  798   LPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAF  619
             LPI V P+NGKGNCS  GCD DLR  CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG +
Sbjct  137   LPITVTPINGKGNCSVAGCDADLRNTCPSELAVKSKGKVIACRSACDVFNTDEYCCRGLY  196

Query  618   SSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKN  439
              +P  C PT YSK FK ACP AYS+A+DDP+S+ TC+ TDYV++FCSSR +  CT+H+  
Sbjct  197   GNPRVCQPTFYSKKFKEACPTAYSYAYDDPSSICTCAGTDYVITFCSSRKRGVCTYHNNK  256

Query  438   VSCSSDAKGMAPFFKPWQMLLAV  370
             + CS  ++G+    + W  L+ V
Sbjct  257   LVCSG-SRGLKSLIERWWALVFV  278



>gb|KDP38887.1| hypothetical protein JCGZ_05044 [Jatropha curcas]
Length=289

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 204/269 (76%), Gaps = 7/269 (3%)
 Frame = -3

Query  1158  LAIASGVKLSKCTN-ITIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAPSGWNG  985
             +AI SG   S  T   T+ NNCKET+WPGI T   N  G GF LK GQ+A ++AP+GW+G
Sbjct  16    IAIVSGQNTSTSTKTFTLYNNCKETIWPGIITKGYNSHGAGFVLKSGQTAFYSAPTGWSG  75

Query  984   RIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDG  805
             RIW RTGC+FDK NG+ S  CQTGSCG +L CS    PP +IA+FTLG+ DFYDVSLVDG
Sbjct  76    RIWARTGCDFDK-NGNGS--CQTGSCGTSLNCSSPSSPPNSIAEFTLGDVDFYDVSLVDG  132

Query  804   FNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRG  625
             FN+PIV+ P+ GKGNCS  GCD D+R+NCPSDLA+KS GK +ACRSAC+VFN+DEYCCRG
Sbjct  133   FNVPIVISPLKGKGNCSIAGCDGDVRQNCPSDLAVKSDGKVIACRSACDVFNSDEYCCRG  192

Query  624   AFSSPASCLPTNYSKSFKAACPIAYSFAFD-DPTSVITCSATDYVVSFCSSRNQTQCTFH  448
             A+S P +C+P+NYSK FK  CP A S+AFD D TS+ITCSATDY+VSFC++RNQT C++H
Sbjct  193   AYSDPVACVPSNYSKGFKQVCPSASSYAFDRDQTSIITCSATDYIVSFCATRNQTFCSYH  252

Query  447   DKNVSCSSDAKGMAPFFKPWQMLLAVALP  361
             D  V C++     A   K W  L+ VALP
Sbjct  253   DNKVVCNTTNGSKALVPKGWWNLM-VALP  280



>ref|XP_002307423.1| hypothetical protein POPTR_0005s16030g [Populus trichocarpa]
 gb|EEE94419.1| hypothetical protein POPTR_0005s16030g [Populus trichocarpa]
Length=281

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 196/261 (75%), Gaps = 5/261 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             +SG K+ +   + TI N CKETVWPGI    N +G GF LKPGQS+V  AP GW+GRIWG
Sbjct  18    SSGPKMMESLRVFTITNYCKETVWPGIFPGENFNGGGFELKPGQSSVLNAPVGWSGRIWG  77

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC+FDK NG+ +  C+TG+CG  LKC  +G+ PA++A+FTL   DFYDVSLVDGFNLP
Sbjct  78    RTGCSFDK-NGNGT--CKTGTCGSFLKCRASGETPASLAEFTLTTLDFYDVSLVDGFNLP  134

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             I V P+NGKGNCS  GCD DLR+ CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG + +
Sbjct  135   IAVTPINGKGNCSVAGCDADLRDTCPSELAVKSKGKVIACRSACDVFNTDEYCCRGLYGN  194

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
             P  C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDYV++FCSSR +  CT+H+  + 
Sbjct  195   PRVCQPTFYSKKFKEACPTAYSYAYDDPTSICTCAGTDYVITFCSSRKREACTYHNNKLI  254

Query  432   CSSDAKGMAPFFKPWQMLLAV  370
             CS  ++G+    + W  L+ V
Sbjct  255   CSG-SRGLKSLIERWWALVFV  274



>ref|XP_009341686.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=238

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 185/234 (79%), Gaps = 4/234 (2%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
              L +  + SG KLS+   I TIINNCKETVWP +T   N +G GF LKPGQS VF AP  
Sbjct  4     LLSVFMVLSGPKLSESARIFTIINNCKETVWPAVTPGENFNGGGFVLKPGQSIVFTAPVS  63

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSL  814
             W+GRIWGRTGCNFDK NG+ S  CQTGSCG AL+C  +G+PPAT+A+FTL   DFYDVSL
Sbjct  64    WSGRIWGRTGCNFDK-NGNGS--CQTGSCGSALQCGASGKPPATLAEFTLAALDFYDVSL  120

Query  813   VDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             VDGFNLP+VV P+NGKGNCS  GCD DLR NCP++LA+K+ GKTV CRSAC+VF+TDEYC
Sbjct  121   VDGFNLPLVVTPLNGKGNCSVSGCDGDLRPNCPNELAVKANGKTVGCRSACDVFDTDEYC  180

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             CRG + + A C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYVV+FCS+R
Sbjct  181   CRGLYGNAAVCKPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFCSTR  234



>ref|XP_002447372.1| hypothetical protein SORBIDRAFT_06g033910 [Sorghum bicolor]
 gb|EES11700.1| hypothetical protein SORBIDRAFT_06g033910 [Sorghum bicolor]
Length=285

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 5/238 (2%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS-NG  940
              TIIN CK  +WP +T   N  G GFAL+PGQS +F AP GW+GRIWGRT CNFD   NG
Sbjct  31    FTIINQCKTVIWPAVTPGENFGGGGFALRPGQSMMFTAPVGWSGRIWGRTDCNFDAGGNG  90

Query  939   SSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGN  760
             S    C TGSCG ALKC  +G  PA++A+FTL   D+YDVSLVDGFNLP+V+KPVNG+GN
Sbjct  91    S----CATGSCGSALKCGSSGATPASLAEFTLASVDYYDVSLVDGFNLPMVIKPVNGQGN  146

Query  759   CSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSK  580
             CSA GCD DLR +CPS+LA+K+ G+TVACRSAC+VF+TD+YCCRG F +PA C PT YSK
Sbjct  147   CSAAGCDGDLRLSCPSELAVKANGRTVACRSACDVFDTDQYCCRGLFGNPAKCQPTFYSK  206

Query  579   SFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMA  406
              FKAACP AYS+A+DDPTS+ TCS  DYV++FCS+R Q+ C++H+  ++CS  ++ +A
Sbjct  207   KFKAACPTAYSYAYDDPTSIFTCSNADYVITFCSNRKQSVCSYHNNQLACSDSSRSLA  264



>ref|XP_009414593.1| PREDICTED: pathogenesis-related protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=277

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/277 (57%), Positives = 203/277 (73%), Gaps = 12/277 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L+++LL + SG K S+   + TI+N CK T+WPGI    + +G GFALK GQS V  AP 
Sbjct  4     LWIVLLLVFSGAKPSEGARVFTIVNECKTTIWPGIIPGESFNGGGFALKQGQSVVVKAPV  63

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGCNFD+ NG+ S  CQTGSCG +LKCSG+G+ PAT+A+FTL   DFYDVS
Sbjct  64    GWSGRIWGRTGCNFDQ-NGNGS--CQTGSCGSSLKCSGSGETPATLAEFTLAALDFYDVS  120

Query  816   LVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             LVDGFNLP+VV PVN +G NCS+ GCD DLR+ CPS+LA+    +TVACRSAC+VFNTD+
Sbjct  121   LVDGFNLPVVVTPVNAQGGNCSSAGCDGDLRQTCPSELAVMVKRETVACRSACDVFNTDQ  180

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             YCCRG + +P++C PT YSK FK ACP AYS+A+DDP+S+ TCS  DY+V+FCS+R    
Sbjct  181   YCCRGVYGNPSTCQPTYYSKKFKTACPTAYSYAYDDPSSIFTCSQADYIVTFCSNRKSRV  240

Query  459   CTFHDKNVSCSSDAKG-------MAPFFKPWQMLLAV  370
             C++HD  ++CS    G       +A F   W  LL +
Sbjct  241   CSYHDNKLTCSGTDGGASTCKWLIAMFLGLWGSLLVL  277



>ref|XP_004140385.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=295

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 194/260 (75%), Gaps = 4/260 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             A G ++S+   + TIINNCKET+WPGI    N +G GFALK GQS VF AP GW+GRIWG
Sbjct  25    AKGGRISESARVFTIINNCKETIWPGIFPGENFNGGGFALKRGQSIVFNAPVGWSGRIWG  84

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC FD+ NG+    CQTG+CG +LKCSG+G+ PA++A+FTL   DFYDVSLVDGFNLP
Sbjct  85    RTGCTFDE-NGTGE--CQTGACGNSLKCSGSGKTPASLAEFTLAALDFYDVSLVDGFNLP  141

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             + V+P+NG G C   GCDKDLR  CP +LA+KS GK VACRSAC+VF+ DEYCCRG + +
Sbjct  142   MAVRPINGTGKCGVAGCDKDLRPECPKELAVKSKGKVVACRSACDVFDKDEYCCRGVYGN  201

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
             P +C PT YSK FK ACP AYS+A+DDPTS+ TCSA DYV++FCS+RNQ  CT+H+  + 
Sbjct  202   PMTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFCSNRNQPVCTYHNHKLV  261

Query  432   CSSDAKGMAPFFKPWQMLLA  373
             CS      +   + W + +A
Sbjct  262   CSGSNTLKSFVPERWALPMA  281



>ref|XP_011005199.1| PREDICTED: pathogenesis-related protein 5-like [Populus euphratica]
Length=299

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 197/254 (78%), Gaps = 7/254 (3%)
 Frame = -3

Query  1113  TIINNCKETVWPGITTNN-NDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
             T++NNCKE +WPGI     ++ G+GFALKPGQ+AV+ A  GW+GRIW RTGCNFDK+   
Sbjct  41    TLVNNCKEMIWPGIIRKGGSNHGEGFALKPGQTAVYNATLGWSGRIWARTGCNFDKT---  97

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGE-TDFYDVSLVDGFNLPIVVKPVNGKGN  760
             S+  CQTG+CG +L C+G   PP TIA+FTLG+  DFYD+SLVDG+NLPIV+ P+NGKGN
Sbjct  98    STGTCQTGNCGTSLNCTGPSNPPNTIAEFTLGDDVDFYDLSLVDGYNLPIVISPINGKGN  157

Query  759   CSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSK  580
             CS  GC+ DLR+NCPS+LA+KS GK +ACRSAC+ FNTDEYCCRGAF+ PA+C P+NYS+
Sbjct  158   CSIAGCEGDLRQNCPSELAVKSNGKVIACRSACDAFNTDEYCCRGAFADPAACQPSNYSR  217

Query  579   SFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMAPF  400
             SFK  CP A S+AFDD  S+ITCSA++Y++ FC+SRNQ+ C++HD  + C++     AP 
Sbjct  218   SFKQVCPAASSYAFDDRASIITCSASEYIIIFCASRNQSVCSYHDNKLVCNTSTGSTAPP  277

Query  399   FKP--WQMLLAVAL  364
                  W  +L+++L
Sbjct  278   LDLGGWIRMLSLSL  291



>ref|XP_003544148.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=287

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             L+L  I SG +  +C  + TI+N CKET+WP +T   N +G GF LKPGQS VF AP  W
Sbjct  13    LVLAIILSGQRTCECARVFTIVNYCKETLWPAVTPGENFNGGGFVLKPGQSTVFTAPVSW  72

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIW RTGC F++ NG+ +  CQTGSCG  LKCS +G+ PA++A+FTL + D+YDVSLV
Sbjct  73    SGRIWARTGCKFNQ-NGNGN--CQTGSCGTTLKCSASGKTPASLAEFTLAQVDYYDVSLV  129

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFN+P+ VKP+NGKGNC+  GCD DLR  CP++LA+K  GKTV CRSAC+V+NTDEYCC
Sbjct  130   DGFNVPLFVKPINGKGNCTTAGCDSDLRATCPNELAVKVNGKTVGCRSACDVYNTDEYCC  189

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG + +P++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYVV+FC+SR Q  C++
Sbjct  190   RGNYGNPSTCNPTFYSKKFKEACPTSYSYAYDDPTSIFTCSGTDYVVAFCASRKQQVCSY  249

Query  450   HDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             H   + CS  + G+      W +++ + +
Sbjct  250   HSNKLHCSG-SLGLKSLTGRWWIVMMITV  277



>ref|XP_003543788.1| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
 gb|KHN26034.1| Pathogenesis-related protein 5 [Glycine soja]
Length=287

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 204/271 (75%), Gaps = 6/271 (2%)
 Frame = -3

Query  1170  FLLLLAIA-SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             F+L+LAI  SG +      + TI+N CKET+WP +T   + +G GF LKPG+SAVF AP 
Sbjct  11    FILVLAIILSGQRTCDSARVFTIVNYCKETLWPAVTPGESFNGGGFVLKPGESAVFTAPV  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
              W+GRIW RTGC FD+ NG+ +  CQTGSCG  LKCS +G+ PA++A+FTL + DFYDVS
Sbjct  71    SWSGRIWARTGCKFDQ-NGNGN--CQTGSCGTTLKCSASGKTPASLAEFTLAQPDFYDVS  127

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             LVDGFN+P+ VKP+NGKGNCS  GCD DLR +CP +L+L++ GKTV CRSAC+VFNTDEY
Sbjct  128   LVDGFNVPMAVKPINGKGNCSTAGCDSDLRNSCPKELSLRANGKTVGCRSACDVFNTDEY  187

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQC  457
             CC+G + +P++C PT YSK FK ACP +YS+A+DDPTS+ TC+ TDYV++FCSSR Q  C
Sbjct  188   CCKGNYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYVIAFCSSRKQQVC  247

Query  456   TFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             ++H+  + CS  ++G+      W +++ + +
Sbjct  248   SYHNNKLHCSG-SQGLKSLTGRWWIVMMITV  277



>ref|XP_004172611.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=268

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 187/248 (75%), Gaps = 3/248 (1%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TIINNCKET+WPGI    N +G GFALK GQS VF AP GW+GRIWGRTGC FD+ NG+
Sbjct  10    FTIINNCKETIWPGIFPGENFNGGGFALKRGQSIVFNAPVGWSGRIWGRTGCTFDE-NGT  68

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
                 CQTG+CG +LKCSG+G+ PA++A+FTL   DFYDVSLVDGFNLP+ V+P+NG G C
Sbjct  69    GE--CQTGACGNSLKCSGSGKTPASLAEFTLAALDFYDVSLVDGFNLPMAVRPINGTGKC  126

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
                GCDKDLR  CP +LA+KS GK VACRSAC+VF+ DEYCCRG + +P +C PT YSK 
Sbjct  127   GVAGCDKDLRPECPKELAVKSKGKVVACRSACDVFDKDEYCCRGVYGNPMTCRPTFYSKK  186

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMAPFF  397
             FK ACP AYS+A+DDPTS+ TCSA DYV++FCS+RNQ  CT+H+  + CS      +   
Sbjct  187   FKDACPTAYSYAYDDPTSIFTCSAADYVITFCSNRNQPVCTYHNHKLVCSGSNTLKSFVP  246

Query  396   KPWQMLLA  373
             + W + +A
Sbjct  247   ERWALPMA  254



>ref|XP_010428854.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=279

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 195/269 (72%), Gaps = 6/269 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P+  LL L   SG K S+   + TI+N+C + +WP IT   N +G GF LKPGQS VF A
Sbjct  9     PRFLLLFLTFLSGTKWSESARVFTIVNSCDQKIWPAITPGENFNGGGFELKPGQSIVFTA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGC FD +    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCKFDSTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAAVDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR +CPS+LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSELAVKSNGKVISCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TCSA DY++SFCSSR + 
Sbjct  186   EYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSAADYIISFCSSRKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLL  376
              CT+HD  + CS+  + M   F  W +L+
Sbjct  246   VCTYHDNKLGCSNGFRTMTGGF--WLVLI  272



>ref|XP_003614785.1| Pathogenesis-related protein [Medicago truncatula]
 gb|AES97743.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=282

 Score =   320 bits (820),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 194/269 (72%), Gaps = 5/269 (2%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             L+L  I SG +  +   + TI+N CKET+WP +    + +G GF LK GQS+VF AP  W
Sbjct  13    LVLAIILSGQRTCESARVFTIVNYCKETLWPAVFPGEHFNGGGFVLKQGQSSVFTAPVSW  72

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIW RTGCNFD+ NG     CQTG+CG  LKC G G+ PA++A+FTL + DFYDVSLV
Sbjct  73    SGRIWARTGCNFDQ-NGDGQ--CQTGACGTTLKCGGAGKTPASLAEFTLAQPDFYDVSLV  129

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFN+PI VKP+NGKGNCS  GCD DLR  CP +L+++S GKTV CRSAC+VFNTDEYCC
Sbjct  130   DGFNVPISVKPINGKGNCSTAGCDSDLRLTCPKELSVRSNGKTVGCRSACDVFNTDEYCC  189

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG F +P++C PT YSK FK ACP +YS+A+DDPTS+ TC+ TDYVV+FC+ R +  CT+
Sbjct  190   RGNFGNPSTCRPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYVVAFCADRKKQMCTY  249

Query  450   HDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             HD  + CS  ++G+      W + + +  
Sbjct  250   HDHKLHCSG-SQGLRSLIGSWWIAMIMVF  277



>ref|XP_004250343.2| PREDICTED: pathogenesis-related protein 5 [Solanum lycopersicum]
Length=287

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 195/261 (75%), Gaps = 4/261 (2%)
 Frame = -3

Query  1143  GVKLSK-CTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRT  967
             GVK S+     TI+N+CKET+WPG+   +N +G GF LK GQS VF AP  ++GRIWGRT
Sbjct  21    GVKFSESARTFTIVNSCKETIWPGVFPGDNFNGGGFILKSGQSMVFTAPVSFSGRIWGRT  80

Query  966   GCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIV  787
             GCNFDK NG+ S  C TG CG +LKC+GTG+ PA++A+FTL   DFYDVSLVDGFN+PI 
Sbjct  81    GCNFDK-NGNGS--CLTGDCGPSLKCTGTGKTPASLAEFTLANLDFYDVSLVDGFNVPIS  137

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPA  607
             V P+NGKGNCS  GC+ DLR+NCPS+LA+K+ GK + CRSAC+VFNTDEYCCRG + +P+
Sbjct  138   VTPLNGKGNCSVAGCNGDLRQNCPSELAVKNDGKVIGCRSACDVFNTDEYCCRGNYGNPS  197

Query  606   SCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCS  427
             +C PT YSK FK  CP AYS+A+DDPTS+ TCS TDYVV+FCSSR +  CT+H++ + CS
Sbjct  198   TCQPTFYSKKFKEDCPTAYSYAYDDPTSIFTCSGTDYVVTFCSSRKKPVCTYHNRKLFCS  257

Query  426   SDAKGMAPFFKPWQMLLAVAL  364
                   +     W + L + L
Sbjct  258   GSKGLRSLISNLWMIFLGLTL  278



>ref|XP_006302655.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
 gb|EOA35553.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
Length=280

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 192/258 (74%), Gaps = 5/258 (2%)
 Frame = -3

Query  1146  SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             SG K S+   + TI+N+C + +WP IT   N +G GF LKPGQS VF AP GW+GRIWGR
Sbjct  20    SGTKWSESARVFTIVNSCDQKIWPAITPGENFNGGGFELKPGQSIVFTAPVGWSGRIWGR  79

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPI  790
             TGCNFD +    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYDVSLVDGFNLP+
Sbjct  80    TGCNFDSTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAALDFYDVSLVDGFNLPM  136

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
              V P NGKGNCS  GC  DLR +CPS+LA+KS GK ++CRSAC+VF+ DEYCCRG + +P
Sbjct  137   SVNPRNGKGNCSVAGCVADLRPHCPSELAVKSNGKVISCRSACDVFDRDEYCCRGVYGNP  196

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC  430
               C PT YSK FK ACP AYS+A+DDPTS+ TCSA+DY+++FCSSRN+  CT+HD  + C
Sbjct  197   VVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSASDYIITFCSSRNKPVCTYHDNKLGC  256

Query  429   SSDAKGMAPFFKPWQMLL  376
             S   K +A   + W +L+
Sbjct  257   SDGFKTVAT-GRFWLVLI  273



>ref|XP_007041520.1| Pathogenesis-related thaumatin superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX97351.1| Pathogenesis-related thaumatin superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=287

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 203/284 (71%), Gaps = 7/284 (2%)
 Frame = -3

Query  1173  LFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNN--NDSGDGFALKPGQSAVFAA  1003
             LF + + +ASG K+ +   N T++N CKET+WP   T+   N  G+ F L+PGQ+A++ A
Sbjct  8     LFCIFVFLASGAKMYANAKNFTLVNQCKETIWPATITDGSGNFHGEDFKLEPGQTAIYNA  67

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
                W+GRIWGRTGC FD   G  +  CQTGSCG ++ C+  G  P +IA+FTLG+TDFYD
Sbjct  68    SDTWSGRIWGRTGCKFDNKTGDGT--CQTGSCGTSINCTSAGSLPVSIAEFTLGDTDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLPIV+KP  GKGNCS  GCD DLR+NC SDLA+K+ G  V CRSAC+ FN D
Sbjct  126   VSLVDGFNLPIVIKPGGGKGNCSTAGCDGDLRQNCSSDLAVKNNGNVVGCRSACDAFNKD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG +  P SCLPTNYSKSFK  CP A S+A+D+  S+ITCSA+DY+V+FC+ RN T
Sbjct  186   EYCCRGTYGDPVSCLPTNYSKSFKQVCPAASSYAYDNRVSIITCSASDYLVAFCALRNST  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL  331
              C++ ++   CS+ ++G   F + W++++ +A P  V  L +LL
Sbjct  246   ICSYQNQKFVCSTTSEGFKAFSQSWRIVM-LAFP-LVSILQILL  287



>ref|XP_008785871.1| PREDICTED: pathogenesis-related protein 5 [Phoenix dactylifera]
Length=284

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 199/273 (73%), Gaps = 7/273 (3%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPS  997
             L  +LL I+SG K ++   + T++N+C  T+WP IT   N +G G AL+ GQS VF AP 
Sbjct  9     LLTVLLFISSGAKWAEGARVFTLVNDCMTTIWPAITPGENFNGGGLALRRGQSVVFNAPV  68

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVS  817
             GW+GRIWGRTGCNFD++   S   CQTG+CG  LKC   G+PPAT+A+FTL   DFYDVS
Sbjct  69    GWSGRIWGRTGCNFDQAGNGS---CQTGACGTTLKCGAAGKPPATLAEFTLASMDFYDVS  125

Query  816   LVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDE  640
             LVDGFNLP+ V PVNGKG NCS+ GC+ DLR NCPS+LA+K+ GKTVACRSAC+VF+TD+
Sbjct  126   LVDGFNLPMTVTPVNGKGGNCSSAGCNSDLRNNCPSELAVKADGKTVACRSACDVFDTDQ  185

Query  639   YCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS-SRNQT  463
             YCCRG + +P +C PT YSK FK ACP AYS+A+DDPTS+ TC   DY+++FC+  R QT
Sbjct  186   YCCRGVYGNPVTCQPTFYSKKFKQACPTAYSYAYDDPTSIFTCIEGDYIITFCAPGRKQT  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
              CT+HD  + CS  ++  A     W +L+ + +
Sbjct  246   VCTYHDNRLICSGSSRS-ALLICKWFVLMLLCM  277



>ref|XP_009419395.1| PREDICTED: pathogenesis-related protein 5-like isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419396.1| PREDICTED: pathogenesis-related protein 5-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=286

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 192/272 (71%), Gaps = 10/272 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             L + LL  A G ++      TIIN CK T+WPGIT  N+ +G GF LKPG+S VF AP G
Sbjct  14    LIVFLLEAAEGARV-----FTIINYCKTTIWPGITPGNSFNGGGFPLKPGESVVFTAPVG  68

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSL  814
             W+GRIWGRTGC+FD+    S   CQTG+CG  LKCS +GQ PAT+A+FTL   DFYDVSL
Sbjct  69    WSGRIWGRTGCDFDRDGNGS---CQTGACGSVLKCSASGQTPATLAEFTLAPLDFYDVSL  125

Query  813   VDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEY  637
             VDGFNLPI V PVNG+G NCS+ GCD DLR+NCPS+LA+K  GKTVACRSAC+VFNTD+Y
Sbjct  126   VDGFNLPITVTPVNGQGGNCSSAGCDGDLRDNCPSELAVKFDGKTVACRSACDVFNTDQY  185

Query  636   CCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS-SRNQTQ  460
             CCRG F +   C PT YSK FK ACP AYS+A+DDPTS+ TC   DY+VSFCS SR Q  
Sbjct  186   CCRGVFGNSVICQPTYYSKIFKQACPGAYSYAYDDPTSIFTCVGGDYIVSFCSKSRKQRV  245

Query  459   CTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             CT+H   + CS      A     W  +L + L
Sbjct  246   CTYHINKLICSGSPGRGASSTGKWLAVLLLGL  277



>ref|XP_003574984.1| PREDICTED: pathogenesis-related protein 5-like [Brachypodium 
distachyon]
Length=290

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 202/275 (73%), Gaps = 11/275 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGV-KLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAP  1000
             L L L+   SG  +L++   + TIIN CK TVWP  T  ++  G GFALKPGQSAVF AP
Sbjct  12    LALPLICFLSGTARLAESARVFTIINQCKTTVWPAATPGDSFGGGGFALKPGQSAVFTAP  71

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDV  820
               W+GRIWGRT C+FD ++G+    C TG+CG  LKC  +G PPA++A+FTL   DFYDV
Sbjct  72    PKWSGRIWGRTDCSFDATSGTGK--CGTGACGDTLKCGASGDPPASLAEFTLASPDFYDV  129

Query  819   SLVDGFNLPIVVKPVNGK--GNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVFN  649
             SLVDGFNLPI V+PVNG+  GNCSA GCD DLRE CP +LA+K +GGKT+ACRSAC+VFN
Sbjct  130   SLVDGFNLPITVRPVNGRAPGNCSAAGCDGDLRETCPDELAVKGAGGKTIACRSACDVFN  189

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TDEYCCRG F +P++C PT YSK FK ACP AYS+A+DDP+S+ +CS +DY+V+FCS+R 
Sbjct  190   TDEYCCRGQFGNPSTCPPTKYSKKFKEACPTAYSYAYDDPSSLFSCSGSDYIVTFCSNRK  249

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             Q+ C++H+  + CS  ++    +      LLAV L
Sbjct  250   QSACSYHNNQLVCSGSSR----YLPVVSALLAVLL  280



>gb|KDP32764.1| hypothetical protein JCGZ_12056 [Jatropha curcas]
Length=285

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 193/267 (72%), Gaps = 5/267 (2%)
 Frame = -3

Query  1158  LAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGR  982
               I+S  K+++   I TIIN CKET+WPGIT  +N +G GFALK GQS VF AP GW+GR
Sbjct  15    FIISSETKVTESARIFTIINYCKETIWPGITPGDNFNGGGFALKRGQSIVFNAPVGWSGR  74

Query  981   IWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGF  802
             IW RTGC+FDK NG+ S  CQTGSCG +LKC  +G  P ++A+FTL   DFYDVSLVDGF
Sbjct  75    IWARTGCSFDK-NGNGS--CQTGSCGTSLKCGASGATPVSLAEFTLATPDFYDVSLVDGF  131

Query  801   NLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGA  622
             NLP++V P+NG GNCS  GC  DLR  CPS+LA+KS GK +ACRSAC+VFNTDEYCCRG 
Sbjct  132   NLPLLVTPINGVGNCSVAGCYMDLRSTCPSELAVKSNGKVIACRSACDVFNTDEYCCRGV  191

Query  621   FSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC-SSRNQTQCTFHD  445
             + +P  C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYV++FC SS+ Q  CT+H+
Sbjct  192   YGNPVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVITFCPSSQKQQVCTYHN  251

Query  444   KNVSCSSDAKGMAPFFKPWQMLLAVAL  364
               + C       +     W ++LA + 
Sbjct  252   NKLVCGGSQGLKSLIGSSWVLVLAFSF  278



>ref|XP_009419393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419394.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 193/276 (70%), Gaps = 10/276 (4%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFA  1006
             A   +FLL    A G ++      TIIN CK T+WPGIT  N+ +G GF LKPG+S VF 
Sbjct  12    ALLIVFLLGAEAAEGARV-----FTIINYCKTTIWPGITPGNSFNGGGFPLKPGESVVFT  66

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFY  826
             AP GW+GRIWGRTGC+FD+    S   CQTG+CG  LKCS +GQ PAT+A+FTL   DFY
Sbjct  67    APVGWSGRIWGRTGCDFDRDGNGS---CQTGACGSVLKCSASGQTPATLAEFTLAPLDFY  123

Query  825   DVSLVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             DVSLVDGFNLPI V PVNG+G NCS+ GCD DLR+NCPS+LA+K  GKTVACRSAC+VFN
Sbjct  124   DVSLVDGFNLPITVTPVNGQGGNCSSAGCDGDLRDNCPSELAVKFDGKTVACRSACDVFN  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS-SR  472
             TD+YCCRG F +   C PT YSK FK ACP AYS+A+DDPTS+ TC   DY+VSFCS SR
Sbjct  184   TDQYCCRGVFGNSVICQPTYYSKIFKQACPGAYSYAYDDPTSIFTCVGGDYIVSFCSKSR  243

Query  471   NQTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
              Q  CT+H   + CS      A     W  +L + L
Sbjct  244   KQRVCTYHINKLICSGSPGRGASSTGKWLAVLLLGL  279



>ref|XP_009419392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 194/271 (72%), Gaps = 6/271 (2%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             LLL ++  G + ++   + TIIN CK T+WPGIT  N+ +G GF LKPG+S VF AP GW
Sbjct  40    LLLPSLKQGAEAAEGARVFTIINYCKTTIWPGITPGNSFNGGGFPLKPGESVVFTAPVGW  99

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIWGRTGC+FD+    S   CQTG+CG  LKCS +GQ PAT+A+FTL   DFYDVSLV
Sbjct  100   SGRIWGRTGCDFDRDGNGS---CQTGACGSVLKCSASGQTPATLAEFTLAPLDFYDVSLV  156

Query  810   DGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYC  634
             DGFNLPI V PVNG+G NCS+ GCD DLR+NCPS+LA+K  GKTVACRSAC+VFNTD+YC
Sbjct  157   DGFNLPITVTPVNGQGGNCSSAGCDGDLRDNCPSELAVKFDGKTVACRSACDVFNTDQYC  216

Query  633   CRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS-SRNQTQC  457
             CRG F +   C PT YSK FK ACP AYS+A+DDPTS+ TC   DY+VSFCS SR Q  C
Sbjct  217   CRGVFGNSVICQPTYYSKIFKQACPGAYSYAYDDPTSIFTCVGGDYIVSFCSKSRKQRVC  276

Query  456   TFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             T+H   + CS      A     W  +L + L
Sbjct  277   TYHINKLICSGSPGRGASSTGKWLAVLLLGL  307



>emb|CDX68047.1| BnaA07g20870D [Brassica napus]
Length=284

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 194/261 (74%), Gaps = 4/261 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L + SG K S    + TI+N+C + VWP IT   + +G GF LKPGQS VF A
Sbjct  9     PRILLLFLTLLSGTKWSDSARVFTIVNSCNQVVWPAITPGESFNGGGFELKPGQSMVFNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLATLDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR  CP +LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPRELAVKSNGKVISCRSACDVFDKD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYV+SFCS++ + 
Sbjct  186   EYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFCSAKKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPF  400
              CT+HD  + CS  + G + F
Sbjct  246   VCTYHDNKLVCSDGSAGSSGF  266



>ref|XP_010065499.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Eucalyptus 
grandis]
Length=288

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/268 (60%), Positives = 193/268 (72%), Gaps = 5/268 (2%)
 Frame = -3

Query  1155  AIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIW  976
              IA+ V        TI NNCKETVWPGIT   + +  GF LKPGQSAV++  + W+GRIW
Sbjct  16    GIAATVASQGNRKFTIQNNCKETVWPGITNGESFNRSGFELKPGQSAVYSPSATWSGRIW  75

Query  975   GRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNL  796
             GRTGCNFDK NG+ +  CQTG+CG +L C G G  P +IA+FTLG+ D+YDVSLV GFNL
Sbjct  76    GRTGCNFDK-NGNGA--CQTGACGNSLSCLGPGSSPVSIAEFTLGDPDYYDVSLVSGFNL  132

Query  795   PIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFS  616
             PIV+KPVN K NCS  GCD DLR NCPS+L +KS GK +AC SAC+ FNTDEYCCRGAF 
Sbjct  133   PIVIKPVNAKVNCSTAGCDGDLRSNCPSELTVKSNGKVIACDSACDKFNTDEYCCRGAFG  192

Query  615   SPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNV  436
             +  SC P+NYSK+FK+ CP AYS+A DDPTS+ TCS+ +Y+VSFCSSRN T C+ HD  +
Sbjct  193   TADSCQPSNYSKAFKSFCPDAYSYAKDDPTSLKTCSSPEYIVSFCSSRNGTVCSVHDGTL  252

Query  435   SCSSDAKGMAPFFKPWQMLLAVALPTTV  352
              CS      AP +  W   LA+ LP  V
Sbjct  253   KCSGSTDLRAPSYGWW--FLAIVLPMIV  278



>emb|CDX79230.1| BnaC06g20730D [Brassica napus]
Length=292

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 203/285 (71%), Gaps = 6/285 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L + SG K S    + TI+N+C + VWP IT   + +G GF LKPGQS VF A
Sbjct  9     PRILLLCLTLLSGTKWSDSARVFTIVNSCNQVVWPAITPGESFNGGGFELKPGQSMVFNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLATPDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR  CP +LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPRELAVKSNGKVISCRSACDVFDKD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYV+SFCS++ + 
Sbjct  186   EYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFCSAKKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPT-TVFNLGVLL  331
              CT+HD  + C SD  G + F      L  V L +  VF   V+L
Sbjct  246   VCTYHDNKLVC-SDGSGSSGFRTMIGGLWLVPLLSLVVFLTNVIL  289



>ref|XP_010065498.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW63007.1| hypothetical protein EUGRSUZ_G00607 [Eucalyptus grandis]
Length=289

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 189/255 (74%), Gaps = 5/255 (2%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TI NNCKETVWPGIT   + +  GF LKPGQSAV++  + W+GRIWGRTGCNFDK NG+
Sbjct  30    FTIQNNCKETVWPGITNGESFNRSGFELKPGQSAVYSPSATWSGRIWGRTGCNFDK-NGN  88

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
              +  CQTG+CG +L C G G  P +IA+FTLG+ D+YDVSLV GFNLPIV+KPVN K NC
Sbjct  89    GA--CQTGACGNSLSCLGPGSSPVSIAEFTLGDPDYYDVSLVSGFNLPIVIKPVNAKVNC  146

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             S  GCD DLR NCPS+L +KS GK +AC SAC+ FNTDEYCCRGAF +  SC P+NYSK+
Sbjct  147   STAGCDGDLRSNCPSELTVKSNGKVIACDSACDKFNTDEYCCRGAFGTADSCQPSNYSKA  206

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMAPFF  397
             FK+ CP AYS+A DDPTS+ TCS+ +Y+VSFCSSRN T C+ HD  + CS      AP +
Sbjct  207   FKSFCPDAYSYAKDDPTSLKTCSSPEYIVSFCSSRNGTVCSVHDGTLKCSGSTDLRAPSY  266

Query  396   KPWQMLLAVALPTTV  352
               W   LA+ LP  V
Sbjct  267   GWW--FLAIVLPMIV  279



>ref|XP_010103888.1| hypothetical protein L484_024191 [Morus notabilis]
 gb|EXB97329.1| hypothetical protein L484_024191 [Morus notabilis]
Length=259

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 187/240 (78%), Gaps = 8/240 (3%)
 Frame = -3

Query  1179  PKLFLLLLAIASGV--KLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             P LF++++ IASGV   LS+   + T++N CKE +WP IT   N +G GFALKPGQSAV+
Sbjct  12    PSLFIVIV-IASGVPYTLSESARVFTVVNYCKEAIWPAITNAENITGGGFALKPGQSAVY  70

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP GW+GRIWGRTGCNFDK NG+    C+TGSCG  L C+  G PP +IA+FTLG+ DF
Sbjct  71    TAPLGWHGRIWGRTGCNFDK-NGNGK--CETGSCGTLLNCTRPGDPPTSIAEFTLGDIDF  127

Query  828   YDVSLVDGFNLPIVVKP-VNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVF  652
             YDVSLVDGFNLP+VVKP  NGKGNCS  GCD DLR+NCP +L  K  GK +ACRSAC+VF
Sbjct  128   YDVSLVDGFNLPMVVKPNSNGKGNCSTAGCDGDLRQNCPPELQAKDDGKVIACRSACDVF  187

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             NTD+YCCRG F +P +CLPTNYS+SFK  CP AYS+A+DD TS+ITCS TDY VSFC SR
Sbjct  188   NTDDYCCRGMFGNPMTCLPTNYSRSFKQFCPAAYSYAYDDRTSIITCSGTDYTVSFCGSR  247



>ref|XP_006653913.1| PREDICTED: pathogenesis-related protein 5-like [Oryza brachyantha]
Length=283

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 182/231 (79%), Gaps = 3/231 (1%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TIIN CK  VWP IT   +  G GFAL+PGQS VF AP GW+GRIWGRTGC+FD++   
Sbjct  30    FTIINQCKTVVWPAITPGESFGGGGFALRPGQSMVFTAPVGWSGRIWGRTGCSFDQAGNG  89

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
             S   C TG+CG AL+C G+G  PAT+A+FTL   DFYDVSLVDGFNLP+VV+P+NG+GNC
Sbjct  90    S---CATGACGTALQCGGSGATPATLAEFTLASKDFYDVSLVDGFNLPMVVRPLNGQGNC  146

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             +A GCD DLRE CPS+LA+K GG+TVACRSAC+VF+TD+YCCRG + +P++C PT YSK 
Sbjct  147   TAAGCDGDLRERCPSELAMKVGGRTVACRSACDVFDTDQYCCRGLYGNPSTCQPTFYSKK  206

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSS  424
             FK ACP AYS+A+DDP+S+ TCS  DY ++FCS+  ++ CT+H+  + CS+
Sbjct  207   FKDACPTAYSYAYDDPSSIFTCSNADYTITFCSNTKRSVCTYHNNRLICSA  257



>ref|XP_006390065.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
 gb|ESQ27351.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
Length=254

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 180/238 (76%), Gaps = 4/238 (2%)
 Frame = -3

Query  1146  SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             SG K S+   + TI+N+C + +WP IT   N +G GF LKPGQS VF AP GW+GRIWGR
Sbjct  20    SGTKWSESARVFTIVNSCNQIIWPAITPGENFNGGGFELKPGQSIVFNAPVGWSGRIWGR  79

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPI  790
             TGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYDVSLVDGFNLP+
Sbjct  80    TGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAAVDFYDVSLVDGFNLPM  136

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
              V P+NGKGNCS  GC  DLR  CP +LA+KS GK ++CRSAC+VF+ DEYCCRG + +P
Sbjct  137   SVTPMNGKGNCSVAGCVADLRPQCPKELAVKSNGKVISCRSACDVFDRDEYCCRGVYGNP  196

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNV  436
               C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYV+SFCSSR +  CT+HD  +
Sbjct  197   VVCQPTFYSKIFKQACPTAYSYAYDDPTSIFTCSGTDYVISFCSSRKKPVCTYHDNKL  254



>gb|KHN34468.1| Pathogenesis-related protein 5 [Glycine soja]
Length=291

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 194/262 (74%), Gaps = 5/262 (2%)
 Frame = -3

Query  1146  SGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             SG +  +C  + TI+N CKET+WP +T   N +  GF LKPGQS VF AP  W+GRIW R
Sbjct  24    SGQRTCECARVFTIVNYCKETLWPAVTPGENFNDGGFVLKPGQSTVFTAPVSWSGRIWAR  83

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPI  790
             TGC F++ NG+ +  CQTGSCG  LKCS +G+ PA++A+FTL + D+YDVSLVDGFN+P+
Sbjct  84    TGCKFNQ-NGNGN--CQTGSCGTTLKCSASGKTPASLAEFTLAQVDYYDVSLVDGFNVPL  140

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
              VKP+NGKGNC+  GCD DLR  CP++LA+K  GKTV CRSAC+V+NTDEYCCRG + +P
Sbjct  141   FVKPINGKGNCTTAGCDSDLRATCPNELAVKVNGKTVGCRSACDVYNTDEYCCRGNYGNP  200

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC  430
             ++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYVV+FC+SR Q  C++H   + C
Sbjct  201   STCNPTFYSKKFKEACPTSYSYAYDDPTSIFTCSGTDYVVAFCASRKQQVCSYHSNKLHC  260

Query  429   SSDAKGMAPFFKPWQMLLAVAL  364
             S  + G+      W +++ + +
Sbjct  261   SG-SLGLKSLTGRWWIVMMITV  281



>gb|EEC78305.1| hypothetical protein OsI_18027 [Oryza sativa Indica Group]
Length=278

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS-NG  940
              TIIN CK  VWP +T   + SG GFALKPGQS VF AP GW+GRIWGRT C+FD++ NG
Sbjct  28    FTIINQCKTMVWPAVTPGESFSGGGFALKPGQSMVFTAPVGWSGRIWGRTECDFDQAGNG  87

Query  939   SSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGN  760
             S    C TGSCG  LKC G+G  PAT+A+FTL   DFYDVSLVDGFNLP+VV+P+NG+GN
Sbjct  88    S----CATGSCGSELKCGGSGATPATLAEFTLATKDFYDVSLVDGFNLPMVVRPLNGEGN  143

Query  759   CSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSK  580
             CS  GCD DLR++CPS+L+ K  G+TVACRSAC+VF+TD+YCCRG + +P++C PT YSK
Sbjct  144   CSVAGCDGDLRDSCPSELSKKVNGRTVACRSACDVFDTDQYCCRGMYGNPSTCQPTFYSK  203

Query  579   SFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAK  415
              FKAACP AYS+A+DDPTS+ TCS  DY ++FCS+R +  CT+H+  + CS+  +
Sbjct  204   KFKAACPTAYSYAYDDPTSIFTCSNADYTITFCSTRKRPVCTYHNNRLICSASTR  258



>ref|XP_010521235.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=306

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 191/276 (69%), Gaps = 7/276 (3%)
 Frame = -3

Query  1182  FPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFA  1006
             FPK  LLL+ I  G K S+   + TI+N CK  +WP I    + +G GF LK GQS VF 
Sbjct  20    FPKS-LLLVIILYGAKSSEGARVFTIVNACKYKIWPAIMPGEHFNGGGFELKSGQSIVFR  78

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFY  826
             AP  W+GRIW RTGCNFD         C TG+CG +L+C+ +G+PPAT+ +FTL   DFY
Sbjct  79    APVAWSGRIWARTGCNFD---AKGKGKCLTGACGSSLRCTASGEPPATLTEFTLATPDFY  135

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSG--GKTVACRSACNVF  652
             DVSLVDGFNLP++V PVNG+GNCSA GCD D+   CP +LA+KSG  GK VAC+SAC VF
Sbjct  136   DVSLVDGFNLPVLVTPVNGQGNCSAAGCDGDVNGECPPELAVKSGKGGKAVACKSACEVF  195

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             + DEYCCRG + +P  C PT YSK FK ACP AYS+A+DDPTS+ TC+ TDY+++FCSSR
Sbjct  196   DRDEYCCRGVYGNPVVCQPTYYSKIFKKACPTAYSYAYDDPTSIFTCTGTDYIITFCSSR  255

Query  471   NQTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVAL  364
             NQ+ CTFHD  +SC   + G       W ++  + L
Sbjct  256   NQSVCTFHDNKLSCGHTSDGFKLVNGGWWLVTMLIL  291



>ref|XP_004292680.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=247

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 185/238 (78%), Gaps = 4/238 (2%)
 Frame = -3

Query  1182  FPKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFA  1006
              P L + ++ I+SG KLS+   I TI+NNCKET+WP +    N +G GF LKPGQ+ VF 
Sbjct  10    LPVLLVSMIIISSGPKLSESARIFTIVNNCKETIWPAVFPGENFNGGGFPLKPGQAIVFT  69

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFY  826
             AP  W+GRIWGRTGCNFDK NG+ +  CQTG+CG +LKC  +G+PPA++A+FTL + DFY
Sbjct  70    APVSWSGRIWGRTGCNFDK-NGNGT--CQTGACGSSLKCGASGKPPASLAEFTLAQPDFY  126

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDGFNLP+ + PVNG G C A GCD DLR  CP++L++KS GKT+ CRSAC+V+NT
Sbjct  127   DVSLVDGFNLPLTITPVNGSGKCGASGCDGDLRTTCPNELSVKSNGKTIGCRSACDVYNT  186

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             DEYCCRG + + A C PT YSK FK ACP AYS+A+DDP+S+ TC+ TDY+V+FCSSR
Sbjct  187   DEYCCRGVYGNAAVCQPTYYSKKFKEACPTAYSYAYDDPSSIFTCTGTDYIVAFCSSR  244



>ref|NP_001054348.1| Os04g0689900 [Oryza sativa Japonica Group]
 emb|CAE01803.2| OSJNBa0039K24.22 [Oryza sativa Japonica Group]
 dbj|BAF16262.1| Os04g0689900 [Oryza sativa Japonica Group]
 dbj|BAG87668.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61958.1| hypothetical protein OsJ_16724 [Oryza sativa Japonica Group]
Length=278

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 180/234 (77%), Gaps = 3/234 (1%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TIIN CK  VWP +T   +  G GFALKPGQS VF AP GW+GRIWGRT C+FD++   
Sbjct  28    FTIINQCKTMVWPAVTPGESFGGGGFALKPGQSMVFTAPVGWSGRIWGRTECDFDQAGNG  87

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
             S   C TGSCG  LKC G+G  PAT+A+FTL   DFYDVSLVDGFNLP+VV+P+NG+GNC
Sbjct  88    S---CATGSCGSELKCGGSGATPATLAEFTLATKDFYDVSLVDGFNLPMVVRPLNGEGNC  144

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             S  GCD DLR++CPS+L+ K  G+TVACRSAC+VF+TD+YCCRG + +P++C PT YSK 
Sbjct  145   SVAGCDGDLRDSCPSELSKKVNGRTVACRSACDVFDTDQYCCRGMYGNPSTCQPTFYSKK  204

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAK  415
             FKAACP AYS+A+DDPTS+ TCS  DY ++FCS+R +  CT+H+  + CS+  +
Sbjct  205   FKAACPTAYSYAYDDPTSIFTCSNADYTITFCSTRKRPVCTYHNNRLICSASTR  258



>ref|XP_009104608.1| PREDICTED: thaumatin-like protein [Brassica rapa]
Length=284

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 192/261 (74%), Gaps = 4/261 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P++ LL L + SG K S    + TI+N+C + VWP IT   + +G GF LK G S VF A
Sbjct  9     PRILLLFLTLLSGTKWSDSARVFTIVNSCNQVVWPAITPGESFNGGGFELKTGPSMVFNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGCNFDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCNFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLATLDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLP+ V P+NGKGNCS  GC  DLR  CP +LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPRELAVKSNGKVISCRSACDVFDKD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + +P++C PT YSK FK ACP +YS+A+DDPTS+ TCS TDYV+SFCS++ + 
Sbjct  186   EYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFCSAKKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPF  400
              CT+HD  + CS  + G + F
Sbjct  246   VCTYHDNKLVCSDGSAGSSGF  266



>ref|XP_008456085.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Cucumis 
melo]
Length=291

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 186/254 (73%), Gaps = 7/254 (3%)
 Frame = -3

Query  1134  LSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNF  955
             L      TI+N CK+T+WP IT   N +G GF+LK G+SAV+  P  W GRIW RTGC+F
Sbjct  24    LESTRTFTIVNTCKDTIWPAITPGGNITGGGFSLKRGESAVYTIPDSWTGRIWARTGCDF  83

Query  954   DKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPV  775
             DK NG+    C+TGSCG  L C+G G  PAT+ADFTLG  D+YDVS+VDGFNLPI ++P 
Sbjct  84    DK-NGNGK--CRTGSCGEVLNCTGPGSRPATLADFTLGSIDYYDVSVVDGFNLPIAIQPS  140

Query  774   NGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLP  595
              GKGNCS+ GCD DLR+NCP +LA+K  GK VACRSAC+VF+T EYCC G F +P +CLP
Sbjct  141   GGKGNCSSGGCDGDLRDNCPQELAVKEEGKVVACRSACDVFHTGEYCCTGQFDNPMTCLP  200

Query  594   TNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC---SS  424
             TNYS+SFK  CP AYSF +DDPTS++TCS+ DYVV+FC++RNQ  C++ DK++ C   SS
Sbjct  201   TNYSRSFKQVCPAAYSFGYDDPTSILTCSSADYVVAFCATRNQKVCSYDDKHLKCKVESS  260

Query  423   DAKGMAPFF-KPWQ  385
              A    P   + WQ
Sbjct  261   KASTTLPTISQRWQ  274



>gb|EPS67898.1| hypothetical protein M569_06877, partial [Genlisea aurea]
Length=241

 Score =   309 bits (791),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 183/244 (75%), Gaps = 10/244 (4%)
 Frame = -3

Query  1137  KLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             KL++   I TI+N C +T+WP IT  +N SG GFAL+PGQ+ V  AP GW GRIW RTGC
Sbjct  1     KLAESVRIFTIVNYCSQTIWPAITPGDNFSGGGFALRPGQTIVLTAPVGWVGRIWARTGC  60

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVK  781
             NFD+ NG+ S  CQTG CG  L+C+  G PPAT+A+FTL   DFYDVSLVDGFNLP+VV 
Sbjct  61    NFDR-NGNGS--CQTGGCGSLLRCNSPGTPPATLAEFTLAGLDFYDVSLVDGFNLPLVVT  117

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLALKSGG------KTVACRSACNVFNTDEYCCRGAF  619
             P+NG+GNCS  GCD+DLR+NCP +LAL  GG        +AC SAC V NTDEYCCRG +
Sbjct  118   PLNGRGNCSIAGCDRDLRQNCPPELALLGGGGGGGRTTVMACNSACTVLNTDEYCCRGVY  177

Query  618   SSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKN  439
              +P +C PT YS+ FK ACP AYS+A+DDPTS+ TCS TDY++SFCSSRNQT CT+H+  
Sbjct  178   GNPVTCQPTYYSRLFKQACPAAYSYAYDDPTSIFTCSGTDYIISFCSSRNQTVCTYHNNA  237

Query  438   VSCS  427
             + CS
Sbjct  238   LVCS  241



>gb|KFK42166.1| hypothetical protein AALP_AA2G219700 [Arabis alpina]
Length=292

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 190/261 (73%), Gaps = 5/261 (2%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAA  1003
             P+  LL L   SG K S+   + TI+N+CK+ +WP IT   + +G GF LKPGQS V  A
Sbjct  9     PRFLLLFLTFLSGTKWSESARVFTIVNSCKQVIWPAITPGEDFNGGGFELKPGQSIVLNA  68

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYD  823
             P GW+GRIWGRTGC FDK+    +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYD
Sbjct  69    PVGWSGRIWGRTGCTFDKTG---TGTCETGSCGSTLKCSASGKPPASLAEFTLAALDFYD  125

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDGFNLPI V P+NG+GNCS  GC  DLR  CP +LA+KS GK ++CRSAC+VF+ D
Sbjct  126   VSLVDGFNLPISVTPMNGRGNCSVAGCIADLRPRCPPELAVKSNGKVISCRSACDVFDRD  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQT  463
             EYCCRG + + A+C PT YS+ FK ACP AYS+A+DDPTS+ TC+ TDY++SFCSSR + 
Sbjct  186   EYCCRGVYGNSATCQPTYYSRIFKQACPTAYSYAYDDPTSIFTCTGTDYIISFCSSRKKP  245

Query  462   QCTFHDKNVSCSSDAKGMAPF  400
              CT HD  + C SD  G + F
Sbjct  246   VCTNHDNKLIC-SDGSGSSGF  265



>ref|XP_008352662.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=274

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 193/269 (72%), Gaps = 10/269 (4%)
 Frame = -3

Query  1161  LLAIAS--GVKLSKCTN-ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             + A+AS  G KLS+     TI+NNCKETVWP +   +N +   F LKPGQS +F AP  W
Sbjct  1     MTAVASYPGPKLSESARTFTIVNNCKETVWPAVIPADNFTAGSFVLKPGQSILFTAPVSW  60

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLV  811
             +GRIWGRTGCNFDK NG+ S  CQTG CG   +C  + +PPAT+A+FTL + DFYDVSLV
Sbjct  61    SGRIWGRTGCNFDK-NGNGS--CQTG-CGSTHQCGASAKPPATLAEFTLAKQDFYDVSLV  116

Query  810   DGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCC  631
             DGFNLP+VV P+NG GNCS  GCD DLR NCP +LA+K+ GK + CRSAC+VFNTDEYCC
Sbjct  117   DGFNLPLVVTPLNGTGNCSVSGCDTDLRPNCPKELAVKANGKNIGCRSACDVFNTDEYCC  176

Query  630   RGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTF  451
             RG + + A C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYV++FCS+R Q  CT+
Sbjct  177   RGRYGNAAVCKPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVIAFCSTRKQPMCTY  236

Query  450   HDKNVSCS--SDAKGMAPFFKPWQMLLAV  370
                 + C   S + G+    + W ++L +
Sbjct  237   RHHKIPCPNVSGSVGLKS-LRWWAVMLGL  264



>ref|XP_004149961.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004160466.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN57567.1| hypothetical protein Csa_3G214070 [Cucumis sativus]
Length=291

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 178/239 (74%), Gaps = 3/239 (1%)
 Frame = -3

Query  1134  LSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNF  955
             L      TI+N CK+T+WP IT   N +G GF+LK G+SAV+  P  W GRIW RTGC+F
Sbjct  24    LESTRTFTIVNTCKDTIWPAITPGGNVTGGGFSLKRGESAVYTIPDSWTGRIWARTGCDF  83

Query  954   DKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPV  775
             DK     +  C+TGSCG  L C+G G  PAT+ADFTLG  D+YDVS+VDGFNLPI ++P 
Sbjct  84    DKDG---NGKCRTGSCGEVLNCTGPGSRPATLADFTLGSIDYYDVSVVDGFNLPIAIQPS  140

Query  774   NGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLP  595
              GKGNCS+ GCD DLR+NCP +LA+K  GK VACRSAC+VF+T EYCC G F +P +CLP
Sbjct  141   GGKGNCSSGGCDGDLRDNCPPELAVKDDGKVVACRSACDVFHTGEYCCTGQFDNPMTCLP  200

Query  594   TNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDA  418
             TNYS+SFK  CP AYSF +DDPTS++TCS+ DYVV+FC++RNQ  C++ DK + C  ++
Sbjct  201   TNYSRSFKQVCPAAYSFGYDDPTSILTCSSADYVVAFCATRNQKVCSYDDKQLKCKVES  259



>ref|XP_002459540.1| hypothetical protein SORBIDRAFT_02g006300 [Sorghum bicolor]
 gb|EER96061.1| hypothetical protein SORBIDRAFT_02g006300 [Sorghum bicolor]
Length=291

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 191/269 (71%), Gaps = 11/269 (4%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAP  1000
             P+L +LL  + S   +      TIIN CK T+WP  T  ++  G GFAL+PGQSAVF AP
Sbjct  9     PRLAVLLCFVLSSTTVESAGVFTIINQCKTTIWPAATPGDSFGGGGFALRPGQSAVFKAP  68

Query  999   SG-WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFY  826
             +G W+GRIWGRTGC FD S   S   C TGSCG  LKC  +G  P ++A+FTL  + DFY
Sbjct  69    AGGWSGRIWGRTGCAFDASGNGS---CATGSCGTTLKCGTSGATPVSLAEFTLAADRDFY  125

Query  825   DVSLVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             DVSLVDGFNLP+ V+PVNG+G NCSA GCD DLRE CPS+LA+K GG+TVACRSAC+VF+
Sbjct  126   DVSLVDGFNLPVTVRPVNGRGGNCSAAGCDGDLRETCPSELAVKVGGQTVACRSACDVFD  185

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TD+YCCRG F S  +C PT YSK FK ACP AYS+A+DD +S+ TCS  DY+++FC+SR 
Sbjct  186   TDQYCCRGKFGSQPTCPPTPYSKKFKDACPTAYSYAYDDASSLFTCSGADYIITFCASRK  245

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQM  382
             Q  C++H+  + CS      A   +PW +
Sbjct  246   QQACSYHNNQLVCSG-----ASSRRPWPI  269



>emb|CAB53479.1| CAA30376.1 protein [Oryza sativa]
Length=749

 Score =   319 bits (818),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 183/234 (78%), Gaps = 5/234 (2%)
 Frame = -3

Query  1113  TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS-NGS  937
             TIIN CK  VWP +T   + SG GFALKPGQS VF AP GW+GRIWGRT C+FD++ NGS
Sbjct  500   TIINQCKTMVWPAVTPGESFSGGGFALKPGQSMVFTAPVGWSGRIWGRTECDFDQAGNGS  559

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
                 C TGSCG  LKC G+G  PAT+A+FTL   DFYDVSLVDGFNLP+VV+P+NG+GNC
Sbjct  560   ----CATGSCGSELKCGGSGATPATLAEFTLATKDFYDVSLVDGFNLPMVVRPLNGEGNC  615

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             S  GCD DLR++CPS+L+ K  G+TVACRSAC+VF+TD+YCCRG + +P++C PT YSK 
Sbjct  616   SVAGCDGDLRDSCPSELSKKVNGRTVACRSACDVFDTDQYCCRGMYGNPSTCQPTFYSKK  675

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAK  415
             FKAACP AYS+A+DDPTS+ TCS  DY ++FCS+R +  CT+H+  + CS+  +
Sbjct  676   FKAACPTAYSYAYDDPTSIFTCSNADYTITFCSTRKRPVCTYHNNRLICSASTR  729



>ref|NP_177893.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
 gb|AAG51631.1|AC012193_13 thaumatin-like protein; 12104-13574 [Arabidopsis thaliana]
 gb|AEE36011.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
Length=356

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 178/227 (78%), Gaps = 4/227 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             ++G K S+   + TIIN+C +T+WP IT   N +G GF LKPGQS VF AP GW+GRIWG
Sbjct  79    STGTKWSESARVFTIINSCDQTIWPAITPGENFNGGGFELKPGQSIVFHAPVGWSGRIWG  138

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGC FD S G+ +  C+TGSCG  LKCS +G+PPA++A+FTL   DFYDVSLVDGFNLP
Sbjct  139   RTGCKFD-STGTGT--CETGSCGSTLKCSASGKPPASLAEFTLAALDFYDVSLVDGFNLP  195

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             + V P+NGKGNCS  GC  DLR +CP +LA+KS GK ++CRSAC+VF+ DEYCCRG + +
Sbjct  196   MSVTPMNGKGNCSVAGCVADLRPHCPQELAVKSNGKVISCRSACDVFDRDEYCCRGVYGN  255

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             P  C PT YSK FK ACP AYS+A+DDPTS++TC+A+DYV+SFCSSR
Sbjct  256   PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIMTCTASDYVISFCSSR  302



>ref|XP_007041521.1| Pathogenesis-related thaumatin superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOX97352.1| Pathogenesis-related thaumatin superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=265

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 190/265 (72%), Gaps = 8/265 (3%)
 Frame = -3

Query  1119  NITIINNCKETVWPGITTNN--NDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS  946
             N T++N CKET+WP   T+   N  G+ F L+PGQ+A++ A   W+GRIWGRTGC FD  
Sbjct  7     NFTLVNQCKETIWPATITDGSGNFHGEDFKLEPGQTAIYNASDTWSGRIWGRTGCKFDNK  66

Query  945   NGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGK  766
              G  +  CQTGSCG ++ C+  G  P +IA+FTLG+TDFYDVSLVDGFNLPIV+KP  GK
Sbjct  67    TGDGT--CQTGSCGTSINCTSAGSLPVSIAEFTLGDTDFYDVSLVDGFNLPIVIKPGGGK  124

Query  765   GNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNY  586
             GNCS  GCD DLR+NC SDLA+K+ G  V CRSAC+ FN DEYCCRG +  P SCLPTNY
Sbjct  125   GNCSTAGCDGDLRQNCSSDLAVKNNGNVVGCRSACDAFNKDEYCCRGTYGDPVSCLPTNY  184

Query  585   SKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAKGMA  406
             SKSFK  CP A S+A+D+  S+ITCSA+DY+V+FC+    T C++ ++   CS+ ++G  
Sbjct  185   SKSFKQVCPAASSYAYDNRVSIITCSASDYLVAFCAL--STICSYQNQKFVCSTTSEGFK  242

Query  405   PFFKPWQMLLAVALPTTVFNLGVLL  331
              F + W++++ +A P  V  L +LL
Sbjct  243   AFSQSWRIVM-LAFP-LVSILQILL  265



>dbj|BAJ93087.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 185/267 (69%), Gaps = 4/267 (1%)
 Frame = -3

Query  1140  VKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             ++       TIIN C+ TVWP  T  ++ +G GF LK G+S+VF  P  W+GRIWGRT C
Sbjct  24    MRAESARKFTIINKCEATVWPAATPGDSFNGGGFELKTGESSVFTVPQAWSGRIWGRTDC  83

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVK  781
              FD++    +  C TGSCG ALKC  +G PPA++A+FTL   DFYDVSLVDGFNLPI V 
Sbjct  84    AFDQAG---TGKCGTGSCGAALKCGASGDPPASLAEFTLASPDFYDVSLVDGFNLPITVT  140

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLALKS-GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             PVNG+GNCS  GCD DLR+ CP++L++K   GKT ACRSAC+VFNTD+YCCRG F  P++
Sbjct  141   PVNGRGNCSVAGCDGDLRDTCPAELSVKGPSGKTAACRSACDVFNTDQYCCRGKFGGPST  200

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSS  424
             C PT YSK FK ACP AYS+A+DDP+S+  CS  DY+++FC++R Q+ CT HD  + CS 
Sbjct  201   CPPTPYSKKFKEACPSAYSYAYDDPSSLFQCSGADYIITFCANRKQSVCTHHDNKLECSG  260

Query  423   DAKGMAPFFKPWQMLLAVALPTTVFNL  343
              ++ +        ++L V+L    F +
Sbjct  261   SSRRLPIMSAMTLLVLLVSLGAMQFVM  287



>emb|CAJ86348.1| H0814G11.15 [Oryza sativa Indica Group]
Length=257

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TIIN CK  VWP +T   + SG GFALKPGQS VF AP GW+GRIWGRT C+FD++   
Sbjct  28    FTIINQCKTMVWPAVTPGESFSGGGFALKPGQSMVFTAPVGWSGRIWGRTECDFDQAGNG  87

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
             S   C TGSCG  LKC G+G  PAT+A+FTL   DFYDVSLVDGFNLP+VV+P+NG+GNC
Sbjct  88    S---CATGSCGSELKCGGSGATPATLAEFTLATKDFYDVSLVDGFNLPMVVRPLNGEGNC  144

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             S  GCD DLR++CPS+L+ K  G+TVACRSAC+VF+TD+YCCRG + +P++C PT YSK 
Sbjct  145   SVAGCDGDLRDSCPSELSKKVNGRTVACRSACDVFDTDQYCCRGMYGNPSTCQPTFYSKK  204

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             FKAACP AYS+A+DDPTS+ TCS  DY ++FCS+R
Sbjct  205   FKAACPTAYSYAYDDPTSIFTCSNADYTITFCSTR  239



>ref|XP_002887695.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63954.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 177/229 (77%), Gaps = 4/229 (2%)
 Frame = -3

Query  1158  LAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGR  982
             L  ++G K S+   + TIIN+C + +WP IT   N +G GF LKPGQS VF AP GW+GR
Sbjct  34    LLYSTGTKWSESARVFTIINSCDQKIWPAITPGENFNGGGFELKPGQSIVFNAPVGWSGR  93

Query  981   IWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGF  802
             IWGRTGC FD S G+ +  C+TGSCG  LKCS +G+PPA++A+FTL + DFYDVSLVDGF
Sbjct  94    IWGRTGCKFD-STGTGT--CETGSCGSTLKCSASGKPPASLAEFTLAKLDFYDVSLVDGF  150

Query  801   NLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGA  622
             NLP+ V P+NG GNCS  GC  DLR +CP +LA+KS GK ++CRSAC+VF+ DEYCCRG 
Sbjct  151   NLPMSVTPMNGIGNCSVAGCVADLRPHCPQELAVKSNGKVISCRSACDVFDRDEYCCRGV  210

Query  621   FSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             + +P  C PT YSK FK ACP AYS+A+DDPTS++TC+A+DYV+SFCSS
Sbjct  211   YGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIMTCTASDYVISFCSS  259



>ref|XP_008361553.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=308

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 176/241 (73%), Gaps = 5/241 (2%)
 Frame = -3

Query  1149  ASGVKLSKCTN-ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWG  973
             ++G KLS+     TI+NNCKETVWP +   +N +   F LKPGQS +F AP  W+GRIWG
Sbjct  39    SAGPKLSESARTFTIVNNCKETVWPAVIPADNFTAGSFVLKPGQSILFTAPVSWSGRIWG  98

Query  972   RTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLP  793
             RTGCNFDK NG+ S  CQTG CG   +C  + +PPAT+A+FTL + DFYDVSLVDGFNLP
Sbjct  99    RTGCNFDK-NGNGS--CQTG-CGSTHQCGASAKPPATLAEFTLAKQDFYDVSLVDGFNLP  154

Query  792   IVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSS  613
             +VV P+NG GNCS  GCD DLR NCP +LA+ + GK + CRSAC+VFNTDEYCCRG + +
Sbjct  155   LVVTPLNGTGNCSVSGCDTDLRPNCPKELAVXANGKNIGCRSACDVFNTDEYCCRGRYGN  214

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVS  433
              A C PT YSK FK ACP AYS+A+DDPTS+ TCS TDYV++FCS+R     T     + 
Sbjct  215   AAVCKPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVIAFCSTRKXPMXTXRHHKIP  274

Query  432   C  430
             C
Sbjct  275   C  275



>ref|XP_008456086.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Cucumis 
melo]
Length=255

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 170/222 (77%), Gaps = 3/222 (1%)
 Frame = -3

Query  1134  LSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNF  955
             L      TI+N CK+T+WP IT   N +G GF+LK G+SAV+  P  W GRIW RTGC+F
Sbjct  24    LESTRTFTIVNTCKDTIWPAITPGGNITGGGFSLKRGESAVYTIPDSWTGRIWARTGCDF  83

Query  954   DKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPV  775
             DK NG+    C+TGSCG  L C+G G  PAT+ADFTLG  D+YDVS+VDGFNLPI ++P 
Sbjct  84    DK-NGNGK--CRTGSCGEVLNCTGPGSRPATLADFTLGSIDYYDVSVVDGFNLPIAIQPS  140

Query  774   NGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLP  595
              GKGNCS+ GCD DLR+NCP +LA+K  GK VACRSAC+VF+T EYCC G F +P +CLP
Sbjct  141   GGKGNCSSGGCDGDLRDNCPQELAVKEEGKVVACRSACDVFHTGEYCCTGQFDNPMTCLP  200

Query  594   TNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             TNYS+SFK  CP AYSF +DDPTS++TCS+ DYVV+FC++RN
Sbjct  201   TNYSRSFKQVCPAAYSFGYDDPTSILTCSSADYVVAFCATRN  242



>ref|XP_004959962.1| PREDICTED: pathogenesis-related protein 5-like [Setaria italica]
Length=281

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 195/259 (75%), Gaps = 4/259 (2%)
 Frame = -3

Query  1131  SKCTNI-TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNF  955
             ++C  + TIIN CK  +WP +T   +  G GF+L+PGQS VF AP GW+GRIWGRT C+F
Sbjct  23    AECARVFTIINQCKTVIWPAVTPGESFGGGGFSLRPGQSMVFTAPVGWSGRIWGRTDCSF  82

Query  954   DKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPV  775
             D S   S S   TGSCG +L+C  +G PPA++A+FTL   D+YDVSLVDGFNLP+V+KPV
Sbjct  83    DASGNGSCS---TGSCGSSLRCGASGAPPASLAEFTLAAVDYYDVSLVDGFNLPMVIKPV  139

Query  774   NGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLP  595
             NG+GNCSA GCD DLR+ CPS+LA+++ G+TVACRSAC+VFNTD+YCCRG F +PA+C P
Sbjct  140   NGQGNCSAAGCDGDLRQTCPSELAVRANGRTVACRSACDVFNTDQYCCRGQFGNPATCQP  199

Query  594   TNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAK  415
             T YSK FK ACP AYS+A+DDPTS+ TCS  DY+++FCSSR Q+ C++H+  + CSS + 
Sbjct  200   TFYSKKFKEACPTAYSYAYDDPTSIFTCSNADYIITFCSSRKQSACSYHNNRLVCSSASS  259

Query  414   GMAPFFKPWQMLLAVALPT  358
              ++  F    +L+   L T
Sbjct  260   LLSRSFISSTLLMLALLFT  278



>ref|XP_006847064.1| hypothetical protein AMTR_s00017p00203890 [Amborella trichopoda]
 gb|ERN08645.1| hypothetical protein AMTR_s00017p00203890 [Amborella trichopoda]
Length=340

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 170/214 (79%), Gaps = 5/214 (2%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS-NG  940
              TI+N+CKETVWPGIT     +G GFALKPGQS +  AP+GW+GRIWGRTGC+FD + NG
Sbjct  33    FTIVNDCKETVWPGITPGEALAGGGFALKPGQSRILTAPTGWSGRIWGRTGCSFDDTGNG  92

Query  939   SSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGN  760
             S    CQTG CG +LKC G+G  PAT+A+FTLG  DFYDVSLVDGFNLP+VV PV+G+GN
Sbjct  93    S----CQTGGCGSSLKCGGSGNTPATLAEFTLGARDFYDVSLVDGFNLPMVVTPVHGQGN  148

Query  759   CSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSK  580
             CS+ GCD DLR+ CPS+LA+K+G +TV CRSACNVF +++YCC G  ++  +C PT+YSK
Sbjct  149   CSSAGCDGDLRDTCPSELAVKAGSQTVGCRSACNVFGSEQYCCTGMHANSLTCQPTSYSK  208

Query  579   SFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FK ACP AYS+A+DDPTS+  C   DY+V+FCS
Sbjct  209   KFKEACPAAYSYAYDDPTSIFICVDADYIVTFCS  242



>ref|XP_006847062.1| hypothetical protein AMTR_s00017p00203180 [Amborella trichopoda]
 gb|ERN08643.1| hypothetical protein AMTR_s00017p00203180 [Amborella trichopoda]
Length=224

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 165/215 (77%), Gaps = 3/215 (1%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSNGS  937
              TI+N+CKETVW  IT     +G GFAL+PGQS +  AP+GW+GRIWG TGC+FD S   
Sbjct  13    FTIVNDCKETVWARITPGEALAGGGFALEPGQSRILTAPTGWSGRIWGSTGCSFDNSGNG  72

Query  936   SSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNC  757
             S   C TG CG +LKC G+G  PAT+A+FTLG  DFYDVSLV GFNLP+VV PV+G+GNC
Sbjct  73    S---CLTGGCGSSLKCGGSGGTPATLAEFTLGALDFYDVSLVYGFNLPMVVTPVHGRGNC  129

Query  756   SAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKS  577
             S+ GCD DLR+ CPS+LA+KSGG+TV CRSAC+VF +++YCC G   +  +C PT+YSK 
Sbjct  130   SSAGCDGDLRDTCPSELAVKSGGQTVGCRSACDVFGSEQYCCTGVHGNSLTCQPTSYSKK  189

Query  576   FKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             FK ACP AYS+A+DDP S+ TC+  DY+V+FCS R
Sbjct  190   FKEACPAAYSYAYDDPASIFTCADADYIVTFCSKR  224



>ref|XP_008650876.1| PREDICTED: putative thaumatin domain family protein isoform X1 
[Zea mays]
 tpg|DAA59991.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=295

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 179/242 (74%), Gaps = 7/242 (3%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG-WNGRIWGRTGCNFDKSNG  940
              TIIN CK T+WP  T  ++  G GFAL+PGQSAVF AP+G W+GRIWGRTGC+FD S  
Sbjct  34    FTIINRCKTTIWPAATPGDSFGGGGFALRPGQSAVFKAPAGGWSGRIWGRTGCSFDASGN  93

Query  939   SSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKPVNGKG  763
              +   C TGSCG +L+C  +G  P ++A+FTL  + DFYDVSLVDGFNLP+ V+PVNG+G
Sbjct  94    GT---CATGSCGTSLRCGASGATPVSLAEFTLASDRDFYDVSLVDGFNLPVTVRPVNGRG  150

Query  762   -NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNY  586
              NCSA GCD DLR+ CP +LA+++G   VACRSAC+VF+TD+YCCRG F S  +C PT Y
Sbjct  151   GNCSAAGCDGDLRQTCPPELAVRAGDAVVACRSACDVFDTDQYCCRGKFGSQPTCPPTPY  210

Query  585   SKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC-SSRNQTQCTFHDKNVSCSSDAKGM  409
             SK FK ACP AYS+A+DD +S+ TCS  DY+++FC SSR Q  C++H+  + CS  ++  
Sbjct  211   SKRFKDACPTAYSYAYDDASSLFTCSGADYIITFCASSRKQQACSYHNNRLVCSDASRRS  270

Query  408   AP  403
              P
Sbjct  271   WP  272



>ref|XP_004973784.1| PREDICTED: thaumatin-like protein-like [Setaria italica]
Length=301

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 177/239 (74%), Gaps = 8/239 (3%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNND--SGDGFALKPGQSAVFAAPSG-WNGRIWGRTGCNFDKS  946
              TI+N C+  +WP +T  +    +G GF L+P QS VF AP+G W+GRIW RTGC FD S
Sbjct  43    FTIVNLCETVIWPAVTPGSETFGAGGGFELRPRQSMVFTAPAGGWSGRIWARTGCTFDAS  102

Query  945   NGSSSSPCQTGSCGGALKCSG-TGQPPATIADFTLGE-TDFYDVSLVDGFNLPIVVKPVN  772
                S   C TG+CG ALKC G +G+PPA++A+FTL   +DFYDVSLVDGFNLP+ V+PVN
Sbjct  103   GNGS---CATGACGTALKCGGASGEPPASLAEFTLASPSDFYDVSLVDGFNLPVAVEPVN  159

Query  771   GKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPT  592
             G+GNCSA GCD DLR  CP +LA+K+GG+TVACRSAC+VF+TD YCCRG F  P +C  T
Sbjct  160   GRGNCSAAGCDGDLRRTCPPELAVKAGGRTVACRSACDVFDTDRYCCRGQFGGPGTCNAT  219

Query  591   NYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSCSSDAK  415
              YSK FK ACP AYS+A+DD +S++TCS  DY+++FCS R +  C++H+  + CS  ++
Sbjct  220   AYSKKFKDACPTAYSYAYDDRSSLLTCSNADYIITFCSDRKKRVCSYHNNRLVCSDSSR  278



>ref|NP_001131821.2| putative thaumatin domain family protein precursor [Zea mays]
 gb|ACF80402.2| unknown [Zea mays]
 tpg|DAA59990.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=252

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 167/222 (75%), Gaps = 6/222 (3%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG-WNGRIWGRTGCNFDKSNG  940
              TIIN CK T+WP  T  ++  G GFAL+PGQSAVF AP+G W+GRIWGRTGC+FD S  
Sbjct  34    FTIINRCKTTIWPAATPGDSFGGGGFALRPGQSAVFKAPAGGWSGRIWGRTGCSFDASGN  93

Query  939   SSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKPVNGKG  763
              +   C TGSCG +L+C  +G  P ++A+FTL  + DFYDVSLVDGFNLP+ V+PVNG+G
Sbjct  94    GT---CATGSCGTSLRCGASGATPVSLAEFTLASDRDFYDVSLVDGFNLPVTVRPVNGRG  150

Query  762   -NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNY  586
              NCSA GCD DLR+ CP +LA+++G   VACRSAC+VF+TD+YCCRG F S  +C PT Y
Sbjct  151   GNCSAAGCDGDLRQTCPPELAVRAGDAVVACRSACDVFDTDQYCCRGKFGSQPTCPPTPY  210

Query  585   SKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             SK FK ACP AYS+A+DD +S+ TCS  DY+++FC+S    +
Sbjct  211   SKRFKDACPTAYSYAYDDASSLFTCSGADYIITFCASSRYAR  252



>ref|NP_001242274.1| uncharacterized protein LOC100818786 precursor [Glycine max]
 gb|ACU17485.1| unknown [Glycine max]
 gb|ACU20131.1| unknown [Glycine max]
Length=225

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKL-SKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             A  KL  + + IAS  +L       T++N CKET+WPGIT ++N SGDGFALK GQS V+
Sbjct  7     ALLKLTSIFIVIASAPELCGSSKTFTLVNYCKETIWPGITRSDNHSGDGFALKSGQSTVY  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP GW+GRIW RTGCNFD +NG+    CQTG CG +  C+  G PPAT ADFTLGE DF
Sbjct  67    TAPDGWSGRIWARTGCNFD-NNGNGK--CQTGGCGTSRNCTVPGSPPATSADFTLGEPDF  123

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDGFNLPIVVK +NG GNCS VGCD DLR+NCPS+LA K   K +ACRSAC+VFN
Sbjct  124   YDVSLVDGFNLPIVVKAINGTGNCSTVGCDGDLRQNCPSELASKDNDKVIACRSACDVFN  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAY  550
             TDEYCCRG + +PA+CL +NYSK F   C + +
Sbjct  184   TDEYCCRGTYGNPATCLASNYSK-FSNKCALQH  215



>ref|XP_010240659.1| PREDICTED: pathogenesis-related protein 5-like [Brachypodium 
distachyon]
Length=287

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 179/267 (67%), Gaps = 19/267 (7%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNI-TIINNCKETVWPGITTNNNDS----GDGFALKPGQSAVFAA  1003
             +LL       +L     + TIIN CK  +WP +T +  +S      GF L+ GQS VF A
Sbjct  1     MLLTKSTGAARLVDSARVFTIINQCKTDIWPAVTPSGGESFGASDGGFLLRAGQSMVFTA  60

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPAT--IADFTLGETDF  829
             P+GW GR+W RTGC+FD +   +   C+TGSCG +L CS +        +A+FTL   D+
Sbjct  61    PAGWVGRVWARTGCDFDAAGNGT---CETGSCGTSLHCSASASAAPPASLAEFTLASVDY  117

Query  828   YDVSLVDGFNLPIVVKP-------VNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVAC  673
             YDVSLVDGFNLP+V+ P         G G+C+  GCD DLR++CP +L +K +GGKTVAC
Sbjct  118   YDVSLVDGFNLPMVITPSLPSNSSGGGNGSCTVAGCDGDLRKDCPPELEVKGAGGKTVAC  177

Query  672   RSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSAT-DY  496
             RSAC+VF TDEYCCRG +++P +C P+ YSK FKAACP AYS+A+DDPTS+ TCS + DY
Sbjct  178   RSACDVFGTDEYCCRGQYANPVTCQPSFYSKRFKAACPAAYSYAYDDPTSIFTCSQSPDY  237

Query  495   VVSFCSSRNQTQCTFHDKNVSCSSDAK  415
              ++FCS+R Q+ C++H++ + CS   +
Sbjct  238   TIAFCSNRKQSVCSYHNERLVCSGSGR  264



>ref|NP_177642.2| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
 gb|ABE65774.1| thaumatin-like protein/pathogenesis-like protein [Arabidopsis 
thaliana]
 gb|AEE35666.1| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
Length=246

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 161/241 (67%), Gaps = 10/241 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L L+ I SG+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP+
Sbjct  9     ILFLVFITSGIAVSAATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTAPA  68

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  DFY
Sbjct  69    GWSGRFWARTGCNFDASGHGN---CGTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKDFY  125

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNVF  652
             DVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L L     G   AC+SAC  F
Sbjct  126   DVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRLMDPHTGIIAACKSACAAF  185

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             N++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TC+ ++Y++SFC +R
Sbjct  186   NSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLISFCPTR  245

Query  471   N  469
             N
Sbjct  246   N  246



>ref|XP_003545287.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=246

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 159/240 (66%), Gaps = 11/240 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAA  1003
             LF LLL I   V  +  T  T+ N+C  TVWPG  + N  +  GDG F + PG S    A
Sbjct  12    LFHLLLFILGNVAYA--TVFTLENHCSYTVWPGTLSGNGAATIGDGGFPMAPGSSVQLTA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE--TDF  829
             PSGW+GR+W RTGCNFD S    +  C TG C G ++C+G G PPAT+A+FT+G    DF
Sbjct  70    PSGWSGRLWPRTGCNFDASG---NGKCLTGYCAGGMRCTGGGVPPATLAEFTIGSGGKDF  126

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVF  652
             YDVSLVDG+N+ + V+   G G+C   GC +DL   CP++L +K  GG  VAC+SAC  F
Sbjct  127   YDVSLVDGYNVGVGVRATGGTGDCKYAGCSEDLNPACPAELQVKDGGGAVVACKSACAAF  186

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             NT E+CC G  SSP +C PT YSK FK ACP AYS+A+DDP+S+ TCS +DYV++FC S 
Sbjct  187   NTAEFCCTGDHSSPQTCSPTRYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITFCPSH  246



>ref|XP_003545288.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=250

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 161/244 (66%), Gaps = 15/244 (6%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAA  1003
             LF LLL I   +  +  T  T+ N+C  TVWPG  + N  +  GDG F + PG SA   A
Sbjct  12    LFHLLLFILGNIAYA--TVFTLENHCSYTVWPGTLSGNGVATLGDGGFPMAPGSSAQLTA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----  835
             PSGW+GR+W RTGC+FD S    +  C TG C G ++C+G G PPAT+A+FT+G      
Sbjct  70    PSGWSGRLWARTGCSFDASG---NGKCLTGDCAGGMRCTGAGVPPATLAEFTVGSAGKGG  126

Query  834   --DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSA  664
               DFYDVSLVDG+N+ + V+   G G+C   GC +DL   CP++L +K  GG+ VAC+SA
Sbjct  127   GKDFYDVSLVDGYNVGVGVRATGGTGDCKYAGCSEDLNAACPAELQVKDGGGEVVACKSA  186

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FNT E+CC G  SSP +C PT YSK FK ACP AYS+A+DDP+S+ TCS +DYV++F
Sbjct  187   CAAFNTAEFCCTGDHSSPQTCSPTLYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITF  246

Query  483   CSSR  472
             C S 
Sbjct  247   CPSH  250



>gb|AAG51919.1|AC013258_13 thaumatin-like protein; 23251-22305 [Arabidopsis thaliana]
Length=257

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 165/247 (67%), Gaps = 12/247 (5%)
 Frame = -3

Query  1182  FPKLFLLLL--AIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSA  1015
             F  +F++++   IA G+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S 
Sbjct  14    FITIFIVVVCFEIAGGIAVSAATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASV  73

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---  844
                AP+GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   
Sbjct  74    QLTAPAGWSGRFWARTGCNFDASGHGN---CGTGDCGGVLKCNGGGVPPVTLAEFTLVGD  130

Query  843   GETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACR  670
             G  DFYDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L L     G   AC+
Sbjct  131   GGKDFYDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRLMDPHTGIIAACK  190

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  FN++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TC+ ++Y++
Sbjct  191   SACAAFNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLI  250

Query  489   SFCSSRN  469
             SFC +RN
Sbjct  251   SFCPTRN  257



>ref|NP_001147654.1| LOC100281263 precursor [Zea mays]
 gb|ACG28263.1| thaumatin-like protein precursor [Zea mays]
 gb|ACL54179.1| unknown [Zea mays]
 gb|AFW69212.1| putative thaumatin domain family protein [Zea mays]
Length=249

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 157/250 (63%), Gaps = 12/250 (5%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQ  1021
             + A   +   LL +A+ V  +  + + + N C ETVWPGI  +      +  G  L PG+
Sbjct  3     TMALRAVATALLVVAASVCGASASTLVLYNRCGETVWPGIQPSAGKEVLARGGLQLAPGR  62

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTL  844
             SA    P+GW+GR+WGR GC+FD +       C TG CGGAL C G G  PPAT+A+ TL
Sbjct  63    SASVRLPAGWSGRVWGRQGCSFDAAG---RGRCATGDCGGALYCGGAGGAPPATLAEITL  119

Query  843   G---ETDFYDVSLVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVA  676
             G     DFYDVSLVDG+N+PI + PV+G G  C+A GC  DL   CP+ LA++  G+ V 
Sbjct  120   GTASSQDFYDVSLVDGYNIPIAMTPVHGSGARCAAAGCVSDLNRVCPAGLAVRGEGRVVG  179

Query  675   CRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSA-TD  499
             CRSAC  +   +YCC G F SP  C PT YS+ FK+ACP AYS+A+DDPTS++TCSA   
Sbjct  180   CRSACAAYGAPQYCCTGQFGSPQQCKPTAYSRLFKSACPKAYSYAYDDPTSILTCSAGAS  239

Query  498   YVVSFCSSRN  469
             YVV+FC  R 
Sbjct  240   YVVTFCPHRR  249



>gb|ABL86687.1| TLP1 [Gossypium barbadense]
Length=244

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 147/226 (65%), Gaps = 8/226 (4%)
 Frame = -3

Query  1143  GVKLSKCTNITIINNCKETVWPG-ITTNNNDSGDG-FALKPGQSAVFAAPSGWNGRIWGR  970
             G   S  T+ T+ N C  TVWPG +T N    GDG FAL PG S+    P GW+GR WGR
Sbjct  19    GAIFSSATSFTLENRCSFTVWPGSLTANGPPLGDGGFALAPGSSSRLHPPPGWSGRFWGR  78

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG---ETDFYDVSLVDGFN  799
             TGCNFD S    S  C TG CGGALKC+G G PP ++ +FTL      DFYD+SLVDG+N
Sbjct  79    TGCNFDNSG---SGKCVTGDCGGALKCNGGGIPPVSLIEFTLNGHDNKDFYDISLVDGYN  135

Query  798   LPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAF  619
             + + VK V G G C   GC  DL  NCP++L +   G  VAC+SAC  FNT EYCC GA 
Sbjct  136   MAVAVKAVGGTGTCQYAGCVNDLNTNCPAELQMTDSGSVVACKSACAAFNTPEYCCTGAH  195

Query  618   SSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              +P +C PT YS+ FK ACP AYS+A+DD TS +TC+  DY+++FC
Sbjct  196   GTPQTCSPTMYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFC  241



>ref|XP_006301180.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
 gb|EOA34078.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
Length=247

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 162/242 (67%), Gaps = 11/242 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAP  1000
             LF   + IASG+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP
Sbjct  10    LFFFFVFIASGIAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTAP  68

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDF  829
             +GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  DF
Sbjct  69    AGWSGRFWARTGCNFDASGHGN---CVTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKDF  125

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC  
Sbjct  126   YDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAA  185

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FN++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TCS ++Y++SFC +
Sbjct  186   FNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSRSNYLISFCPT  245

Query  474   RN  469
             R+
Sbjct  246   RS  247



>gb|KHG08802.1| hypothetical protein F383_35963 [Gossypium arboreum]
Length=236

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 146/223 (65%), Gaps = 8/223 (4%)
 Frame = -3

Query  1134  LSKCTNITIINNCKETVWPG-ITTNNNDSGDG-FALKPGQSAVFAAPSGWNGRIWGRTGC  961
              S  T+ T+ N C  TVWPG +T N    GDG FAL PG S+    P GW+GR WGRTGC
Sbjct  14    FSSATSFTLENRCSFTVWPGSLTANGPPLGDGGFALAPGSSSRLHPPPGWSGRFWGRTGC  73

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG---ETDFYDVSLVDGFNLPI  790
             NFD S    S  C TG CGGALKC+G G PP ++ +FTL      DFYD+SLVDG+N+ +
Sbjct  74    NFDNSG---SGKCVTGDCGGALKCNGGGIPPVSLIEFTLNGHDNKDFYDISLVDGYNMAV  130

Query  789   VVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
              VK V G G C   GC  DL  NCP++L +   G  VAC+SAC  FNT EYCC GA  +P
Sbjct  131   AVKAVGGTGTCQYAGCVNDLNTNCPAELQMTDSGSVVACKSACAAFNTPEYCCTGAHGTP  190

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              +C PT YS+ FK ACP AYS+A+DD TS +TC+  DY+++FC
Sbjct  191   QTCSPTKYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFC  233



>gb|KFK44066.1| hypothetical protein AALP_AA1G211800 [Arabis alpina]
Length=244

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 152/237 (64%), Gaps = 9/237 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND--SGDGFALKPGQSAVFAAP  1000
             LF   L  +  + +      TI N+C  TVWPGI T N    S  GF L PG S     P
Sbjct  10    LFFSFLIASGTISVVSGAVFTIRNSCSFTVWPGILTGNGAQLSDGGFTLAPGASVTVTPP  69

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE---TD  832
             +GW+GRIWGRTGCNFD   GS +  CQTG CG  LKC+G G  PPAT+A+FT+G     D
Sbjct  70    AGWSGRIWGRTGCNFD---GSGAGSCQTGDCGNKLKCNGAGGAPPATLAEFTIGNGGAND  126

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVF  652
             FYDVSLVDG+N+ + +    G GNC  VGC  DL  NCP+DL + + G  VAC+SAC  F
Sbjct  127   FYDVSLVDGYNVKMGITTSGGSGNCQNVGCTSDLNANCPNDLRVSASGNVVACKSACEAF  186

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
                EYCC GAF++P +C PT+YS+ FK+ACP AYS+A+DD +S  TC+  +Y + FC
Sbjct  187   GKPEYCCTGAFNTPQTCPPTDYSRIFKSACPKAYSYAYDDASSTFTCANANYAIVFC  243



>ref|XP_010471608.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=247

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 162/242 (67%), Gaps = 11/242 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAP  1000
             L   L+ I SGV +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP
Sbjct  10    LSFFLVVITSGVAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTAP  68

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDF  829
             +GW+GR W RTGCNFD S   +   C+TG CGG LKC+G G PP T+A+FTL   G  DF
Sbjct  69    AGWSGRFWARTGCNFDASGHGN---CETGDCGGVLKCNGGGFPPVTLAEFTLVGDGGKDF  125

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC  
Sbjct  126   YDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAA  185

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FN++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TCS ++Y++SFC +
Sbjct  186   FNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCPT  245

Query  474   RN  469
             R+
Sbjct  246   RS  247



>ref|XP_006473452.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
 gb|KDO84436.1| hypothetical protein CISIN_1g026001mg [Citrus sinensis]
Length=245

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAAPS  997
             LL++  + G+  +  T  T+ N+C  TVWPG    N  +  GDG FAL  G S  F  P+
Sbjct  11    LLIMLFSLGIVATTATVFTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPA  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----ETDF  829
              W+GRIWGRTGCNFD S    +  C TG CGG LKC+G G PP ++ +FT+     E DF
Sbjct  71    AWSGRIWGRTGCNFDASG---TGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDF  127

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+N+ + VK V GKG+C   GC  DL  NCP++L +   G  VAC+SAC  FN
Sbjct  128   YDVSLVDGYNIGLGVKAVGGKGDCQYAGCVADLNGNCPAELQVTDSGSVVACKSACAAFN  187

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             T E+CC G  ++P +C PT YS+ FK ACP AYS+A+DD +S  TCS +DY+++FC S
Sbjct  188   TPEFCCTGDHATPDTCSPTQYSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCPS  245



>ref|XP_006434928.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
 gb|ESR48168.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
Length=245

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAAPS  997
             LL++  + G+  +  T  T+ N+C  TVWPG    N  +  GDG FAL  G S  F  P+
Sbjct  11    LLIMLFSLGIVATTATVFTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPA  70

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----ETDF  829
              W+GRIWGRTGCNFD S    +  C TG CGG LKC+G G PP ++ +FT+     E DF
Sbjct  71    TWSGRIWGRTGCNFDASG---TGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDF  127

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+N+ + VK V GKG+C   GC  DL  NCP++L +   G  VAC+SAC  FN
Sbjct  128   YDVSLVDGYNIGLGVKAVGGKGDCQYAGCVADLNGNCPAELQVTDSGSVVACKSACAAFN  187

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             T E+CC G  ++P +C PT YS+ FK ACP AYS+A+DD +S  TCS +DY+++FC S
Sbjct  188   TPEFCCTGDHATPDTCSPTQYSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCPS  245



>ref|XP_009595245.1| PREDICTED: pathogenesis-related protein 5 [Nicotiana tomentosiformis]
Length=248

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 157/242 (65%), Gaps = 14/242 (6%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN--NDSGD-GFALKPGQSAVF  1009
             P L L+ L +   + +S  T  T+ NNC  TVWPG  + N  + SGD GFAL PG +   
Sbjct  8     PLLLLIALFMFKAIAVSA-TQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQL  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----  841
             +AP GW+GR W RTGC+FD S    +  C+TG CG ALKC G G+PP ++ +FT+     
Sbjct  67    SAPGGWSGRFWARTGCSFDDSG---NGKCKTGDCG-ALKCIGGGEPPVSLVEFTIANANG  122

Query  840   --ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
               + DFYDVSLVDG+N+ I V+P  G G+C   GC  DL  NCP +L +   G  VAC+S
Sbjct  123   NDQKDFYDVSLVDGYNVGIGVRPTGGSGDCQYAGCVNDLNLNCPKELQVIDTGAVVACKS  182

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  FNT EYCC G  ++PA+C PT YSK FK ACP AYS+A+DD TS  TCS TDY+++
Sbjct  183   ACAQFNTSEYCCTGDHATPATCSPTQYSKMFKDACPTAYSYAYDDATSTCTCSGTDYLIT  242

Query  486   FC  481
             FC
Sbjct  243   FC  244



>ref|XP_009417646.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=251

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 152/243 (63%), Gaps = 14/243 (6%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFAA  1003
             L  L LAIA     S    +   N C+ETVWPGI  +   +     GF L P Q+     
Sbjct  14    LLFLTLAIAG---PSSAATLAFYNKCRETVWPGIQPSAGKAVLARGGFQLLPSQAYSLRL  70

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE---T  835
             P GW+GR+WGR GC+FD + G     C TG CGG L C+G G +PPAT+A+ TLGE    
Sbjct  71    PEGWSGRVWGRQGCSFDPATGRGR--CATGDCGGVLYCNGIGGEPPATLAEITLGEGRQQ  128

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRSAC  661
             DFYDVSLVDG+NL + + P  G G C   GC  DL E CP+ LA+++G   + VAC+SAC
Sbjct  129   DFYDVSLVDGYNLGMSMAPFRGSGQCGRAGCVSDLNEVCPAGLAVRAGSDHRVVACKSAC  188

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             + F +  YCC G+F  P  C PT YS+ FKAACP AYS+AFDDPTS++TC+   Y+++FC
Sbjct  189   SAFGSPRYCCTGSFGGPQQCKPTAYSRLFKAACPRAYSYAFDDPTSILTCTGASYLITFC  248

Query  480   SSR  472
               R
Sbjct  249   PQR  251



>emb|CDY46016.1| BnaA02g17100D [Brassica napus]
Length=247

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 159/243 (65%), Gaps = 13/243 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN-NDSGDG-FALKPGQSAVFAAPS  997
              L    I SGV +S  T  T+ N+C  TVWPGI + N N  G+G F L PG S    AP 
Sbjct  9     ILFFAFITSGVAVSA-TVFTLENSCPYTVWPGILSGNANTLGEGGFPLTPGASVELNAPP  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR W RTGCNFD S   +   C TG CGGALKC+G G PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWARTGCNFDSSGHGT---CVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK---SGGKTVACRSACN  658
             YDVSLVDG+N+ + ++P  G G+C   GC  D+ E CPS+L +    +GG   AC+SAC 
Sbjct  125   YDVSLVDGYNVKMGIRPQGGSGDCRYAGCVSDINEICPSELRIMDPLNGGIVAACKSACA  184

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS  TC+  +YV++FC 
Sbjct  185   AFNSPEFCCTGAHATPQTCSPTQYSAMFKNACPTAYSYAYDDATSTFTCNGANYVITFCP  244

Query  477   SRN  469
             +R+
Sbjct  245   ARS  247



>gb|ABR17407.1| unknown [Picea sitchensis]
Length=246

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 153/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS--GDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDK  949
             T  T++N C ET+WPG+  N   S  G GFAL  GQS    AP+GW+GR WGRTGC F  
Sbjct  24    TVFTLVNRCSETIWPGLAGNGGTSLAGGGFALSTGQSVPVNAPTGWSGRFWGRTGCAFSA  83

Query  948   SNGSSSSPCQTGSCGGALKCSG-TGQPPATIADFTLGE---TDFYDVSLVDGFNLPIVVK  781
             S   S   C TG+C   LKC+G TG+PPAT+A+FT+G     DFYDVSLVDG+N+P+ ++
Sbjct  84    SGVGS---CATGNCVHGLKCAGSTGEPPATLAEFTIGGDAGKDFYDVSLVDGYNVPLSIR  140

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
                G G+C   GC  DLR +CP++L++K S G+ +ACRSACN F + EYCC G   +P +
Sbjct  141   AAGGTGDCRTAGCSSDLRSSCPAELSVKGSDGRVIACRSACNAFGSAEYCCTGDHGNPQT  200

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             C P  YS+ FKAACP AYS+A+DD +S++TC+  DY ++FC S
Sbjct  201   CSPNKYSQIFKAACPTAYSYAYDDASSLVTCTHADYTITFCPS  243



>ref|XP_010428505.1| PREDICTED: pathogenesis-related protein 5 isoform X1 [Camelina 
sativa]
Length=245

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 161/241 (67%), Gaps = 11/241 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L L+ I SG+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP+
Sbjct  9     ILFLVFITSGIAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTAPA  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  DFY
Sbjct  68    GWSGRFWARTGCNFDASGHGN---CVTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKDFY  124

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNVF  652
             DVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC  F
Sbjct  125   DVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAF  184

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             N++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TCS ++Y++SFC +R
Sbjct  185   NSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCPTR  244

Query  471   N  469
             +
Sbjct  245   S  245



>ref|XP_002264550.2| PREDICTED: pathogenesis-related protein 5-like [Vitis vinifera]
Length=235

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 150/240 (63%), Gaps = 11/240 (5%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSA  1015
             A   L LLL+    GV  +     T+ N C E++WPGI   +        GF L+PG+S 
Sbjct  2     ALRHLHLLLVFCVFGVDAAV---FTLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESV  58

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE  838
                AP GW+GR WGR  C+FD S   S   C TG CGG LKC+G G  PPAT+A+FTL  
Sbjct  59    DITAPEGWSGRFWGRRRCSFDDSGKGS---CVTGDCGGVLKCAGAGGAPPATLAEFTLDS  115

Query  837   -TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSAC  661
               DFYDVSLVDG+N+P+ + P  G G C  V C  DL ++CP DL +   G+ VAC SAC
Sbjct  116   PVDFYDVSLVDGYNMPVSILPSGGSGECKTVRCVSDLNQHCPKDLQVLRDGRVVACNSAC  175

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
               FN  EYCC GAFS+P +C PT YSK FKA+CP +YS+A+DDPTS  TC   +Y++ FC
Sbjct  176   MAFNKPEYCCSGAFSTPDTCKPTEYSKVFKASCPTSYSYAYDDPTSTFTCKGANYLIRFC  235



>ref|XP_009110283.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 156/238 (66%), Gaps = 10/238 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             LF   +     + +   T  TI+N C   VWPGI T +N    +G GFAL  G S   AA
Sbjct  10    LFFSFIIATGALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE---T  835
             P+GW+GRIWGRTGCNFD     S   C TG+CG  ++CSG G  PPAT+A+FT+G     
Sbjct  70    PAGWSGRIWGRTGCNFDAFGTGS---CLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGAM  126

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDG+N+ + +K   G G+C  VGC  DL + CP++L++ SGG  VAC+SAC  
Sbjct  127   DFYDVSLVDGYNVQMEIKTQGGSGDCQNVGCVSDLNKICPTELSVLSGGSVVACKSACEA  186

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F + +YCC GAF+ P +C PT+YS+ FKAACP AYS+A+DD TS  TC+  +Y + FC
Sbjct  187   FGSPQYCCTGAFNKPETCPPTDYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFC  244



>emb|CDX83771.1| BnaC08g18740D [Brassica napus]
Length=247

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 153/238 (64%), Gaps = 10/238 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             LF   +     + +   T  TI+N C   VWPGI T +N    +G GFAL PG S   AA
Sbjct  10    LFFSFIIATCAISVVSGTVFTIVNRCSFPVWPGILTGDNGVQLNGGGFALTPGASVDVAA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE---T  835
             P+GW+GRIWGRTGCNFD      S  C TG CG  L+CSG G   PAT+A+FT+G     
Sbjct  70    PAGWSGRIWGRTGCNFDAFG---SGSCLTGDCGNKLQCSGAGGVSPATLAEFTIGHGGAM  126

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDG+N+ + +K   G G+C  VGC  DL   CP++L++ +GG  VAC+SAC  
Sbjct  127   DFYDVSLVDGYNVQMEIKTRGGSGDCQNVGCVSDLNRICPNELSVPNGGSVVACKSACEA  186

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F T +YCC GAF  P +C PT+YS+ FKAACP AYS+A+DD TS  TC+  +Y + FC
Sbjct  187   FGTPQYCCTGAFDKPETCPPTDYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFC  244



>ref|XP_002529658.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF32745.1| Zeamatin precursor, putative [Ricinus communis]
Length=316

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 154/237 (65%), Gaps = 10/237 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             LF + L   S +K + C   T+IN C  TVWPGI  N      GF L  G S  F AP+G
Sbjct  4     LFFISLTFLSFLKGATCATFTLINKCDYTVWPGILGNPKLDSTGFELPKGSSRSFQAPTG  63

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGA-LKCSG-TGQPPATIADFTLGE--TDFY  826
             W+GR WGRTGC FD S   S   C T  CG + L+C+G +  PPAT+A+FTLG    DFY
Sbjct  64    WSGRFWGRTGCTFDTSGHGS---CSTADCGSSQLECNGNSAAPPATLAEFTLGSGSQDFY  120

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C++ GC  DL   CP++L ++ GG   ACRSAC  F  
Sbjct  121   DVSLVDGYNLPMLVEVNGGSGECASTGCVADLNRKCPTELRVEGGG---ACRSACEAFGN  177

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              EYCC GA+SSP++C P+ YS+ FK+ACP +YS+AFDD +S  TC+  DY ++FC S
Sbjct  178   PEYCCSGAYSSPSTCKPSTYSQVFKSACPKSYSYAFDDASSTFTCTGADYTITFCPS  234



>emb|CDX73133.1| BnaC06g35810D [Brassica napus]
Length=243

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 154/237 (65%), Gaps = 9/237 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN--NDSGDG-FALKPGQSAVFAAP  1000
              L L+ I SGV +S  T  T+ NNC  TVWPG  T N  N  GDG + L PG S    AP
Sbjct  9     ILFLVFITSGVAVST-TEFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAP  67

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGETDFYD  823
              GW GR W RTGCNFD S    +  C TG CGG LKC+G G  PP T+A+FT+GE D+YD
Sbjct  68    PGWTGRFWARTGCNFDSS---GNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTVGEKDYYD  124

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVA-CRSACNVFNT  646
             VSLVDG+N+ + +KP  G G+C   GC  DL   CP++L +      VA C+SAC  FN 
Sbjct  125   VSLVDGYNVKMGIKPQGGFGDCDYAGCVSDLNMVCPNELRVMDPQNNVAACKSACAAFNK  184

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             +EYCC GA S+P +C PT YS +FK ACP AYS+A+DD TS  TC+  +Y+++FC++
Sbjct  185   EEYCCTGAHSTPQTCSPTTYSMTFKKACPDAYSYAYDDETSTFTCAGANYLITFCAT  241



>ref|XP_002890328.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66587.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 155/244 (64%), Gaps = 15/244 (6%)
 Frame = -3

Query  1182  FPKLFLLLLA--IASGVKLSKCTNITIINNCKETVWPGI-TTNNNDSGDG-FALKPGQSA  1015
             F KL LL  +  IA+ +     T+ T+ N+C  T+WPGI T N    GDG FAL  G S 
Sbjct  4     FSKLHLLFFSFIIATCIISVSGTDFTLTNHCSSTIWPGILTANGTPIGDGGFALAAGSSV  63

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE  838
                  +GW+GR WGRTGCNFD S    S  C TG CGG LKC+G G  PPAT+A+FT+G 
Sbjct  64    TLTVSAGWSGRFWGRTGCNFDASG---SGKCTTGDCGGKLKCAGAGGAPPATLAEFTIGS  120

Query  837   T-------DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTV  679
             +       DFYDVSLVDG+N+ + + P  G GNC   GC  D+   CP++L +      V
Sbjct  121   SGKKNAVQDFYDVSLVDGYNVQMKITPQGGSGNCQTAGCVSDVNAICPNELRVTDAAGVV  180

Query  678   ACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATD  499
             AC+SAC  FN  EYCC GA+S+PA+C PTNYSK FK ACP AYS+A+DD +S  TC+  +
Sbjct  181   ACKSACEAFNKPEYCCTGAYSTPATCPPTNYSKIFKQACPSAYSYAYDDASSTFTCTNAN  240

Query  498   YVVS  487
             YV+S
Sbjct  241   YVIS  244



>ref|XP_010416369.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 161/243 (66%), Gaps = 11/243 (5%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAA  1003
             ++  L+  I S + +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    A
Sbjct  8     QILFLVFFITSAIAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTA  66

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETD  832
             P+GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  D
Sbjct  67    PAGWSGRFWARTGCNFDASGHGN---CVTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACN  658
             FYDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC 
Sbjct  124   FYDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACA  183

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TCS ++Y++SFC 
Sbjct  184   AFNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  243

Query  477   SRN  469
             +R+
Sbjct  244   TRS  246



>ref|XP_009128072.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 158/243 (65%), Gaps = 13/243 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN-NDSGDG-FALKPGQSAVFAAPS  997
              L    I SGV +S  T  T+ N+C   VWPGI + N N  G+G F L PG S    AP 
Sbjct  9     ILFFAFITSGVAVSA-TVFTLENSCPYIVWPGILSGNANTLGEGGFPLTPGASVELNAPP  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR W RTGCNFD S   +   C TG CGGALKC+G G PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWARTGCNFDSSGHGT---CVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK---SGGKTVACRSACN  658
             YDVSLVDG+N+ + ++P  G G+C   GC  D+ E CPS+L +    +GG   AC+SAC 
Sbjct  125   YDVSLVDGYNVKMGIRPQGGSGDCRYAGCVSDINEICPSELRIMDPLNGGIVAACKSACA  184

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS  TC+  +YV++FC 
Sbjct  185   AFNSPEFCCTGAHATPQTCSPTQYSAMFKNACPTAYSYAYDDATSTFTCNGANYVITFCP  244

Query  477   SRN  469
             +R+
Sbjct  245   ARS  247



>ref|XP_009760388.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=248

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 156/242 (64%), Gaps = 14/242 (6%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN--NDSGD-GFALKPGQSAVF  1009
             P L L+ L +   + +S  T  T+ NNC  TVWPG  + N  + SGD GFAL PG +   
Sbjct  8     PLLLLIALFMFKAIAVSA-TQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQL  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----  841
             +AP GW+GR W RTGC+FD S    +  C TG CG ALKC G G+PP ++ +FT+     
Sbjct  67    SAPGGWSGRFWARTGCSFDDSG---NGKCTTGDCG-ALKCIGGGEPPVSLVEFTIANANG  122

Query  840   --ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
               + DFYDVSLVDG+N+ I V+P  G G+C   GC  DL  NCP +L +   G  VAC+S
Sbjct  123   NDQKDFYDVSLVDGYNVGIGVRPTGGSGDCQYAGCVNDLNLNCPKELQVMDNGAVVACKS  182

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  FNT EYCC G  ++PA+C PT YSK FK ACP AYS+A+DD TS  TCS +DY+++
Sbjct  183   ACAQFNTSEYCCTGDHATPATCSPTQYSKLFKDACPSAYSYAYDDATSTCTCSGSDYLIT  242

Query  486   FC  481
             FC
Sbjct  243   FC  244



>ref|XP_006574674.1| PREDICTED: thaumatin-like protein 1-like [Glycine max]
Length=309

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 155/235 (66%), Gaps = 12/235 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+LA   GV++S  T  T +N C  TVWPGI    +    GF LK G +  F  P G
Sbjct  17    IFLLILAF-RGVRVSA-TTFTFVNKCDHTVWPGILGKPDIGTTGFELKRGSTRTFDGPPG  74

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFY  826
             W+GR WGRTGC FD+S   +   C TG CG G + C+G G  PPAT+A+FTLGE   D+Y
Sbjct  75    WSGRFWGRTGCQFDQSGQGT---CATGDCGSGQVTCNGAGATPPATLAEFTLGEGAPDYY  131

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V    G G C+A GC  DL   CP++L +  G    AC+SAC  F  
Sbjct  132   DVSLVDGYNLPMMVDASGGSGACAATGCGADLNRRCPAELRVDGGD---ACQSACRAFGK  188

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              E+CC GAF+SPA+C P+ YS+ FKAACP +YS+AFDD TS  TC+A DY V+FC
Sbjct  189   PEFCCSGAFNSPAACAPSMYSQIFKAACPKSYSYAFDDATSTFTCTAADYTVTFC  243



>ref|XP_009391386.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=247

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 156/243 (64%), Gaps = 13/243 (5%)
 Frame = -3

Query  1176  KLFLL--LLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAV  1012
             +L++L  LL++ +    S    + + N C+ETVWPGI  +   +     GF L P Q+  
Sbjct  4     RLWILGVLLSVLANAGPSSAATLALYNKCRETVWPGIQPSAGKAVLARGGFQLLPNQAYS  63

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE-  838
                P+GW+GR+WGR GC FD + G     C TG CGGAL C+G G  PPAT+A+FTLG+ 
Sbjct  64    LRLPAGWSGRVWGRRGCAFDPATGRGR--CATGDCGGALYCNGLGGAPPATLAEFTLGQG  121

Query  837   --TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSG--GKTVACR  670
                DFYDVSLVDG+NL + + P  G G C   GC  DL E CP+ LA++ G   + VAC+
Sbjct  122   RQQDFYDVSLVDGYNLGMSMTPFRGSGQCGRAGCVSDLNEVCPAGLAVRGGTDNRVVACK  181

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC+ F +  YCC G+F  P  C PT YS+ FKAACP AYS+A+DDPTS++TC+   Y+V
Sbjct  182   SACSAFGSPRYCCTGSFGGPQQCKPTAYSRLFKAACPRAYSYAYDDPTSILTCTGASYLV  241

Query  489   SFC  481
             +FC
Sbjct  242   TFC  244



>ref|XP_010428506.1| PREDICTED: pathogenesis-related protein 5 isoform X2 [Camelina 
sativa]
Length=246

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 161/243 (66%), Gaps = 11/243 (5%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAA  1003
             ++  L+  I  G+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    A
Sbjct  8     QILFLVFFITCGIAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTA  66

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETD  832
             P+GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  D
Sbjct  67    PAGWSGRFWARTGCNFDASGHGN---CVTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACN  658
             FYDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC 
Sbjct  124   FYDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACA  183

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TCS ++Y++SFC 
Sbjct  184   AFNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  243

Query  477   SRN  469
             +R+
Sbjct  244   TRS  246



>ref|XP_009106158.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=243

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 154/237 (65%), Gaps = 9/237 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN--NDSGDG-FALKPGQSAVFAAP  1000
              L L+ I SGV +S  T  T+ NNC  TVWPG  T N  N  GDG + L PG S    AP
Sbjct  9     ILFLVFITSGVAVST-TEFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAP  67

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGETDFYD  823
              GW GR W RTGCNFD S    +  C TG CGG LKC+G G  PP T+A+FT+GE D+YD
Sbjct  68    PGWTGRFWARTGCNFDSS---GNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTVGEKDYYD  124

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVA-CRSACNVFNT  646
             VSLVDG+N+ + +KP  G G+C   GC  DL   CP++L +      VA C+SAC  FN 
Sbjct  125   VSLVDGYNVKMGIKPQGGFGDCKYAGCVSDLNMICPNELRVMDPQNNVAACKSACAAFNK  184

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             +EYCC GA S+P +C PT YS +FK ACP AYS+A+DD TS  TC+  +Y+++FC++
Sbjct  185   EEYCCTGAHSTPQTCSPTTYSMTFKKACPDAYSYAYDDETSTFTCAGANYLITFCAN  241



>gb|KFK41942.1| hypothetical protein AALP_AA2G192200 [Arabis alpina]
Length=240

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 154/237 (65%), Gaps = 8/237 (3%)
 Frame = -3

Query  1182  FPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNN--NDSGDGFALKPGQSAVF  1009
             F  LF + + I SGV +S  T  T+ N+C  T+WPGI T N  N  G+G  L  G S   
Sbjct  7     FHILFFVFI-ITSGVAVSA-TEFTLQNSCPYTIWPGILTGNGGNPIGEGTPLNTGDSVQL  64

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGETDF  829
              AP GW+GR W RTGC FD S   +   C TG CGG  KC+GTG PP T+A+FT+G+ DF
Sbjct  65    RAPPGWSGRFWARTGCTFDASGHGN---CVTGDCGGVQKCTGTGAPPVTLAEFTVGDKDF  121

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTV-ACRSACNVF  652
             YDVSLVDG+N+ + +KP  G G+C   GC  DL  NCP++L +      V AC+SAC  F
Sbjct  122   YDVSLVDGYNVKLGIKPQGGFGDCKYAGCVADLNTNCPNELRVMDPHNNVAACKSACAAF  181

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             N +EYCC GA ++P +C PTNYS  FK ACP AYS+A+DD TS  TC+  +Y+++FC
Sbjct  182   NKEEYCCSGAHATPQTCSPTNYSVIFKKACPDAYSYAYDDETSTFTCAGANYLITFC  238



>ref|XP_002887572.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63831.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 161/241 (67%), Gaps = 11/241 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L L+ I +G+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP+
Sbjct  9     ILFLVFITNGIAVSA-TVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLTPGASVQLTAPA  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PP T+A+FTL   G  DFY
Sbjct  68    GWSGRFWARTGCNFDASGHGN---CVTGDCGGVLKCNGGGVPPVTLAEFTLVGDGGKDFY  124

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNVF  652
             DVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC  F
Sbjct  125   DVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAF  184

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             N++E+CC GA ++P +C PT+YS  FK+ACP AYS+A+DD TS  TC+ ++Y++SFC +R
Sbjct  185   NSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLISFCPTR  244

Query  471   N  469
             +
Sbjct  245   S  245



>ref|XP_006856120.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
 gb|ERN17587.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
Length=234

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 154/240 (64%), Gaps = 13/240 (5%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND--SGDGFALKPGQSAV  1012
             A  ++F+L L       ++   N  I+N C   VWP   +         GF L  G S  
Sbjct  2     AILQVFVLFLT----ASMASAANFNIVNKCGYGVWPATLSGAGTITPAGGFYLASGASTS  57

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCS--GTGQPPATIADFTLGE  838
              +AP+GW+GRIWGRT C+FD S    +  C TG CG +L+C+    GQPP T+A+FT+G 
Sbjct  58    LSAPTGWSGRIWGRTDCSFDASG---AGKCDTGDCG-SLQCNPNAGGQPPVTLAEFTIGN  113

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSAC  661
              DFYDVSLVDG+NLP+ V  V+G GNC   GC  DLR  CP++L LK   G+TVAC+SAC
Sbjct  114   MDFYDVSLVDGYNLPMGVNAVHGTGNCQYAGCTADLRTTCPTELVLKGQSGQTVACKSAC  173

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
               FNT EYCC GA+ SP +C PT YS+ FK ACP AYS+A+DD +S  TC+ +DYVV+FC
Sbjct  174   MAFNTPEYCCTGAYGSPTTCKPTKYSQIFKTACPDAYSYAYDDESSTRTCTGSDYVVTFC  233



>ref|XP_008670298.1| PREDICTED: thaumatin-like protein 1b [Zea mays]
 tpg|DAA40436.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=329

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 151/240 (63%), Gaps = 11/240 (5%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTN---NNDSGDGFALKPGQSAVFA  1006
             +L LL L +     +S     TI N C   +WPG       +  S  GF L+PGQ+A  A
Sbjct  8     RLCLLALVLVQWHHVSVAMTFTISNYCPHPIWPGTLAGAGTSQLSTTGFKLEPGQTAQLA  67

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE---  838
             AP+GW+GRIW RTGC FD      +  CQTG CGG ++C G+G  PPAT+ + TLG+   
Sbjct  68    APAGWSGRIWARTGCVFDAEG---AGVCQTGDCGGRVECRGSGATPPATLFEVTLGQGGG  124

Query  837   -TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSAC  661
               DFYDVSLVDG+NLP+V  P   +G C+A GC  DL  +CP++L +  GG  +ACRSAC
Sbjct  125   QLDFYDVSLVDGYNLPVVAIPRARQGACNATGCMADLNRSCPTELQVDCGGGAIACRSAC  184

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
               F  D YCC GA+ +P +C PT YS  FK+ACP AYS+A+DD TS  TC A DY ++FC
Sbjct  185   EAFGQDRYCCSGAYGTPDACHPTVYSSIFKSACPRAYSYAYDDSTSTFTCKALDYTIAFC  244



>ref|XP_010929479.1| PREDICTED: pathogenesis-related protein 5-like [Elaeis guineensis]
Length=310

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 144/239 (60%), Gaps = 10/239 (4%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFA  1006
             K+F  +L      +LS C   TI NNC  T+WPG          S  GF L+PG+S   A
Sbjct  6     KVFTSVLVFVLSFQLSMCCTFTIYNNCPHTIWPGTLAGAGTPQLSTTGFQLEPGRSVRMA  65

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG---E  838
             AP GW+GR+W RTGC FD     +   CQTG CGG ++C G G  PPAT+ + TLG   +
Sbjct  66    APPGWSGRMWARTGCEFDAQGAGT---CQTGDCGGRMECGGAGALPPATLFEITLGKGKD  122

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              D+YDVSLVDG+NLP+   P   +G C+A GC  DL   CP +L +   G  VAC+SAC 
Sbjct  123   PDYYDVSLVDGYNLPVAAAPRVPRGRCNATGCAADLNRACPKELQVDGDGGVVACKSACE  182

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              F  DEYCC G F SP +C P+ YS  FK ACP AYS+AFDD TS  TC A DY + FC
Sbjct  183   AFGLDEYCCSGEFGSPGTCKPSFYSSIFKNACPRAYSYAFDDGTSTFTCKAYDYTIIFC  241



>emb|CDX83773.1| BnaC08g18720D [Brassica napus]
Length=247

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             LF   +     + +   T  TI+N C   VWPGI T +N    +G GFALK G S   AA
Sbjct  10    LFFSFIIATGAISVVSGTVFTIVNRCSFPVWPGILTGDNGVQLNGGGFALKTGASVDVAA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE---T  835
             P+GW+GRIWGRTGCNFD     S   C TG CG  L+CSG G  PPAT+A+FT+G     
Sbjct  70    PAGWSGRIWGRTGCNFDAFGTGS---CLTGDCGNKLQCSGAGGVPPATLAEFTIGHGGAM  126

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDG+N+ + +K   G G+C  VGC  DL + CP++L++ +GG  VAC+SAC  
Sbjct  127   DFYDVSLVDGYNVQMEIKTRGGSGDCQNVGCVSDLNKICPNELSVLNGGSVVACKSACEA  186

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F + +YCC GAF+   +C PT+YS+ FKAACP AYS+A+DD TS  TC+  +Y + FC
Sbjct  187   FGSPQYCCTGAFNKAETCPPTDYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFC  244



>ref|XP_002513767.1| naringenin-chalcone synthase, putative [Ricinus communis]
 gb|EEF48350.1| naringenin-chalcone synthase, putative [Ricinus communis]
Length=396

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = -3

Query  915  GSCGGALKCSGTGQPPATIADFTLGETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDK  736
            G+CG +LKCS   Q PA++A+FTL   DFYDVSLVDGF LPI V P++G GNCS  GCD 
Sbjct  18   GACGTSLKCSAADQAPASLAEFTLAALDFYDVSLVDGFKLPISVTPIHGNGNCSVAGCDA  77

Query  735  DLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPI  556
            DLR NCPS+L++KS GK +ACRSAC+VFNTDEYCCRG + +P  C P   SK FK +CPI
Sbjct  78   DLRINCPSELSVKSKGKAIACRSACDVFNTDEYCCRGVYGNPVVCQPAYCSKKFKESCPI  137

Query  555  AYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHDKNVSC---SSDAKGMAPFFKPWQ  385
            AYS+A+DDPTS+ TCS TDYV+SFCSSR+Q  CT+H+  + C   +  ++G+  F   W 
Sbjct  138  AYSYAYDDPTSIFTCSGTDYVISFCSSRDQQVCTYHNNKLVCGRSTGGSQGLKSFVGRWM  197

Query  384  MLL  376
            +++
Sbjct  198  VVM  200



>ref|XP_007017454.1| Thaumatin-like protein 3 [Theobroma cacao]
 gb|EOY14679.1| Thaumatin-like protein 3 [Theobroma cacao]
Length=247

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 159/247 (64%), Gaps = 12/247 (5%)
 Frame = -3

Query  1182  FPKLFLLLLA---IASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQS  1018
             F +++L+L     ++ G   +  T  T+ N+C  TVWPG  + N+ + GDG FAL PG S
Sbjct  4     FSRVYLVLFLFNLLSFGTIFASATLFTLQNHCSFTVWPGSLSGNSAALGDGGFALPPGSS  63

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG-  841
             A + AP GW+GR WGRTGC FD S    S  C TG C G LKC+G G PP T+ +FT+  
Sbjct  64    AKYQAPPGWSGRFWGRTGCTFDNSG---SGKCITGDCDGVLKCTGGGAPPVTLVEFTIAG  120

Query  840   ---ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACR  670
                + DFYDVSLVDG+N+ + VK V G G+C   GC  DL  NCP++L +   G  VAC+
Sbjct  121   DSSDKDFYDVSLVDGYNVALGVKAVGGTGDCQYAGCVTDLNTNCPTELRVMDSGSIVACK  180

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  FN  E+CC G  ++P +C PT YS+ FK ACP AYS+A+DD +S  TCS +DY++
Sbjct  181   SACAAFNAPEFCCTGDHATPQTCSPTQYSEMFKNACPTAYSYAYDDASSTRTCSGSDYLI  240

Query  489   SFCSSRN  469
             +FC + +
Sbjct  241   TFCPTES  247



>ref|XP_002460468.1| hypothetical protein SORBIDRAFT_02g028890 [Sorghum bicolor]
 gb|EER96989.1| hypothetical protein SORBIDRAFT_02g028890 [Sorghum bicolor]
Length=343

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 149/239 (62%), Gaps = 10/239 (4%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQSAVFA  1006
             +L LL L  A   ++S     TI N C   +WPG    +  S     GF L+PGQ+   A
Sbjct  29    QLCLLALVFAQWHQVSMAMTFTISNYCSHPIWPGTLAGSGTSQLSTTGFRLEPGQTVQLA  88

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE---  838
             AP GW+GRIW RTGC FD      +  CQTG CGG ++C G+G  PPAT+ + TLG+   
Sbjct  89    APVGWSGRIWARTGCVFDADG---AGVCQTGDCGGRMECRGSGATPPATLFEVTLGQGGG  145

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              DFYDVSLVDG+NLP+V  P   +G C+A GC  DL  +CP +L +  GG  +ACRSAC 
Sbjct  146   QDFYDVSLVDGYNLPVVAIPRARQGACNATGCMADLNRSCPRELQVDCGGGAIACRSACE  205

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              F  D YCC GA+ +P +C PT YS  FK+ACP AYS+A+DD TS  TC A DY ++FC
Sbjct  206   AFGQDRYCCSGAYGTPDACHPTVYSSIFKSACPRAYSYAYDDRTSTFTCRAVDYTIAFC  264



>ref|XP_009110282.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             LF   +     + +   T  TI+N C   VWPGI T +N    +G GFAL  G S   AA
Sbjct  10    LFFSFIIATGALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAA  69

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE---T  835
             P+GW+GRIWGRTGCNFD     S   C TG+CG  ++CSG G  PPAT+A+FT+G     
Sbjct  70    PAGWSGRIWGRTGCNFDAFGTGS---CLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGAM  126

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDG+N+ + +K   G G+C  VGC  DL + CP++L++ +GG  VAC+SAC  
Sbjct  127   DFYDVSLVDGYNVQMEIKTQGGSGDCQNVGCISDLNKICPNELSVHNGGSVVACKSACEA  186

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F + +YCC GAF+ P +C PT+YS+ FK ACP AYS+A+DD TS  TC+  +Y + FC
Sbjct  187   FGSPQYCCTGAFNKPETCPPTDYSRIFKTACPKAYSYAYDDATSTFTCANANYSIIFC  244



>emb|CDY37263.1| BnaCnng08170D [Brassica napus]
Length=247

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 160/243 (66%), Gaps = 13/243 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L    I SGV +S  T  T+ N+C  TVWPGI + N N  G+G F L PG S    AP 
Sbjct  9     ILFFAFITSGVAVSA-TVFTLENSCPYTVWPGILSGNTNTLGEGGFPLTPGASIQLNAPP  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR W RTGC+FD S   +   C TG CGGALKC+G G PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWARTGCSFDSSGRGT---CVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLAL---KSGGKTVACRSACN  658
             YDVSLVDG+N+ + ++P  G G+C   GC  D+ E CPS+L +   ++GG   AC+SAC 
Sbjct  125   YDVSLVDGYNVKMGIRPQGGSGDCRYAGCVSDINEICPSELRIMDPQNGGIVAACKSACA  184

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS  TC+  +Y+++FC 
Sbjct  185   AFNSPEFCCTGAHATPQTCSPTQYSTMFKNACPSAYSYAYDDATSSFTCNGANYLITFCP  244

Query  477   SRN  469
             +R+
Sbjct  245   ARS  247



>emb|CDY41037.1| BnaC05g14950D [Brassica napus]
Length=246

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 155/241 (64%), Gaps = 14/241 (6%)
 Frame = -3

Query  1176  KLFLLLLAIASG-VKLSKCTNITIINNCKETVWPGITTNN----NDSGDGFALKPGQSAV  1012
              L    + IA+G + +   T  TI+N+C   VWPG+ T N    ND G  F L PG S  
Sbjct  8     HLLFFSVIIATGTLSVVSGTVFTIVNSCSFNVWPGVLTGNGAQLNDGG--FLLTPGASVD  65

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE-  838
               AP+GW+GRIWGRTGCNFD   GS +  C TG CG  LKC+G G  PP T+A+FT+G  
Sbjct  66    LTAPAGWSGRIWGRTGCNFD---GSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNG  122

Query  837   --TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
                DFYDVSLVDG+N+ + +   +G G+C  VGC  DL  +CP++L +  GG  VAC+SA
Sbjct  123   GGQDFYDVSLVDGYNVQMGITTRDGSGDCQNVGCVSDLNGSCPNELRVMDGGNVVACKSA  182

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FN  EYCC GAF  P +C PT+YS+ FKAACP AYS+A+DD +S  TC+  +Y V F
Sbjct  183   CAAFNKPEYCCTGAFDKPETCPPTDYSRIFKAACPKAYSYAYDDASSTFTCTNANYSVVF  242

Query  483   C  481
             C
Sbjct  243   C  243



>gb|EPS57386.1| zeamatin [Genlisea aurea]
Length=242

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 155/245 (63%), Gaps = 12/245 (5%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKC---TNITIINNCKETVWPGITTNNNDSGDGFALKPGQSA  1015
             A P  +  +L IA  V  +     +   ++N C ET+WP I         GF+L  G+S 
Sbjct  2     AVPPPWKAILIIAGAVIQAMGALGSTFRVVNECSETIWPAILGTPILDTTGFSLGNGESR  61

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQPPATIADFTLGE  838
                AP+GW+GR W RTGC FD S   S   C TG CG G ++C G G   AT+A+FTLG 
Sbjct  62    AVVAPAGWSGRFWARTGCRFDASGMGS---CATGDCGSGEMECRGAGASAATLAEFTLGS  118

Query  837   --TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
                DFYDVSLVDG+NLP+ V P  G G C + GC +DL  +CPS+L  + GG   ACRSA
Sbjct  119   GSMDFYDVSLVDGYNLPVTVAPDGGSGQCGSTGCAEDLNLSCPSELKAEGGG---ACRSA  175

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  F T+EYCC+GA+ SPA+C P+ Y++ FK+ACP +YS+A+DD TS  TC+A DYV++F
Sbjct  176   CGAFGTEEYCCQGAYGSPATCRPSAYAQLFKSACPKSYSYAYDDATSTFTCTAADYVITF  235

Query  483   CSSRN  469
             C S +
Sbjct  236   CPSSS  240



>gb|KFK33653.1| hypothetical protein AALP_AA5G041900 [Arabis alpina]
Length=249

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 162/244 (66%), Gaps = 15/244 (6%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L  + I SG+ +S  T  T+ NNC  TVWPGI + N+N+ GDG F L PG S    +P 
Sbjct  9     ILFFMFITSGIVVSA-TVFTLQNNCPYTVWPGILSGNSNNLGDGGFPLTPGASVQLTSPP  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----ETDF  829
             GW+GR W RTGCNFD +   S   C TG CGG LKC+G+G PPAT+A+FT+G    + DF
Sbjct  68    GWSGRFWARTGCNFDSTGRGS---CVTGDCGGILKCTGSGVPPATLAEFTVGSSISDKDF  124

Query  828   YDVSLVDGFNLPIVVKPV--NGKGNCSAVGCDKDLRENCPSDLALK---SGGKTVACRSA  664
             YDVSLVDG+N+ + + P   +G G+C   GC  D+ E CP++L +    + G   AC+SA
Sbjct  125   YDVSLVDGYNVEMGITPQGGDGSGDCHYAGCVADINEICPNELRIMDPYNNGNVAACKSA  184

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS+ TCS ++Y+++F
Sbjct  185   CAAFNSPEFCCTGAHATPDTCSPTQYSTMFKNACPSAYSYAYDDATSIFTCSGSNYLITF  244

Query  483   CSSR  472
             C +R
Sbjct  245   CPTR  248



>ref|XP_009149407.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=246

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 154/241 (64%), Gaps = 14/241 (6%)
 Frame = -3

Query  1176  KLFLLLLAIASG-VKLSKCTNITIINNCKETVWPGITTNN----NDSGDGFALKPGQSAV  1012
              L      IA+G + +   T  TI+N+C   VWPG+ T N    ND G  F L PG S  
Sbjct  8     HLLFFSFIIATGTLSVVSGTVFTIVNSCSFNVWPGVLTGNGAQLNDGG--FLLTPGASVD  65

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE-  838
               AP+GW+GRIWGRTGCNFD   GS +  C TG CG  LKC+G G  PP T+A+FT+G  
Sbjct  66    LTAPAGWSGRIWGRTGCNFD---GSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNG  122

Query  837   --TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
                DFYDVSLVDG+N+ + +   +G G+C  VGC  DL  +CP++L +  GG  VAC+SA
Sbjct  123   GGQDFYDVSLVDGYNVQMGITTRDGSGDCQNVGCVSDLNGSCPNELRVMDGGNVVACKSA  182

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FN  EYCC GAF  P +C PT+YS+ FKAACP AYS+A+DD +S  TC+  +Y V F
Sbjct  183   CAAFNKPEYCCTGAFDKPETCPPTDYSRIFKAACPKAYSYAYDDASSTFTCTNANYSVVF  242

Query  483   C  481
             C
Sbjct  243   C  243



>ref|XP_009795150.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Nicotiana 
sylvestris]
Length=245

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 156/237 (66%), Gaps = 15/237 (6%)
 Frame = -3

Query  1158  LAIASGVKLSKCTNI-----TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             L I S + L  C  I     T +N C +TVWPGI         GF L  G S  F AP+G
Sbjct  11    LMIHSVIVLIFCEGILGATFTFVNKCDKTVWPGILGTPKLDSTGFELTKGSSRSFQAPTG  70

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFY  826
             W+GR WGRTGCNFD S   S   C T  CG G ++C+G G  PPAT+A+FTLG    DFY
Sbjct  71    WSGRFWGRTGCNFDDSGSGS---CATADCGSGQMECNGGGATPPATLAEFTLGSGSQDFY  127

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C++ GC+ DL + CP++L +  GG   ACRSAC+ F T
Sbjct  128   DVSLVDGYNLPMMVEVSGGSGPCASTGCNVDLNQKCPTELMVDGGG---ACRSACDAFRT  184

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              +YCC GA++SPA+C P+ YS+ FK+ACP +YS+A+DD TS  TCS  +Y+++FC S
Sbjct  185   PQYCCEGAYASPATCSPSVYSQMFKSACPKSYSYAYDDATSTFTCSNANYIITFCPS  241



>emb|CDP01888.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 164/248 (66%), Gaps = 13/248 (5%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAV  1012
             ST    LF+L +  + GV  +    IT +N C++TVWPGI  N+     GF L+   S  
Sbjct  5     STVILSLFVLCICKSKGVSGA---TITFVNKCEQTVWPGILGNSGLGSTGFELQRAASRS  61

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLGE  838
             F AP+GW+GR WGRTGC FD   GS    C TG CG G ++C G G   PAT+A+FTLG 
Sbjct  62    FQAPTGWSGRFWGRTGCTFD---GSGQGSCATGDCGSGKIECDGAGASTPATLAEFTLGS  118

Query  837   --TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
                DFYDVSLVDG+NLP++V+   G G+C++ GC +DL   CP++L ++ GG   ACRSA
Sbjct  119   GSQDFYDVSLVDGYNLPMLVEGSGGSGSCASTGCTEDLNSKCPNELKIEGGG---ACRSA  175

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C+ F T EYCC+G ++SP++C P+ YS+ FK+ACP +YS+AFDD TS  TC+  DY V+F
Sbjct  176   CDAFGTPEYCCKGQYASPSTCSPSVYSQIFKSACPKSYSYAFDDSTSTFTCTGADYTVTF  235

Query  483   CSSRNQTQ  460
             C +   +Q
Sbjct  236   CPTSPSSQ  243



>gb|KEH19055.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=237

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 149/243 (61%), Gaps = 13/243 (5%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQS  1018
              A  +L L+ +  + GV     T  T+ N C+  +WPGI T          GF LKPG +
Sbjct  1     MALKQLSLIFMLFSLGVD---ATIFTLQNKCRNAIWPGILTGAGKPQLLDGGFQLKPGHA  57

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                 AP GW GR WGR GC FD S       C TG CGG LKC G G +PPA++A+FTL 
Sbjct  58    INITAPKGWFGRFWGRIGCTFDISG---KGKCITGDCGGKLKCVGAGGEPPASLAEFTLD  114

Query  840   --ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS-GGKTVACR  670
               E DFYDVSLVDG+NLP+ + P  G G C+AV C  DL  NCP+ L L++  G+ V C+
Sbjct  115   SPEGDFYDVSLVDGYNLPVSIVPFGGSGQCTAVKCRSDLNRNCPAGLELRNIKGRVVGCK  174

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  FN  EYCC G F+SP  C P++YSK FK +CP+AYS+A+DD TS   C   DY++
Sbjct  175   SACMAFNRPEYCCTGDFNSPKKCEPSSYSKVFKDSCPMAYSYAYDDETSTFACKGADYLI  234

Query  489   SFC  481
             SFC
Sbjct  235   SFC  237



>ref|XP_006661394.1| PREDICTED: pathogenesis-related protein 5-like [Oryza brachyantha]
Length=330

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 150/243 (62%), Gaps = 14/243 (6%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFA  1006
             +L+LL+LA+AS V  S     TI N C   +WPG       +  S  GF L PGQ+   A
Sbjct  8     RLWLLVLAMASWVYTSMAMTFTIANYCSHPIWPGTLAGAGTSQLSTTGFRLDPGQTVQLA  67

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE---  838
             AP GW+GRIW RTGC FD         CQTG CGG ++C G G  PPAT+ + TLG+   
Sbjct  68    APVGWSGRIWARTGCVFDADG---VGVCQTGDCGGRMECRGAGATPPATLFEVTLGKGGG  124

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGN---CSAVGCDKDLRENCPSDLALK-SGGKTVACR  670
              DFYDVSLVDG+NLP+V  P   +G    C+  GC  DL  +CP +L +   GG  +ACR
Sbjct  125   EDFYDVSLVDGYNLPVVAIPRAQQGGAAACNTTGCMADLNRSCPRELQVDCGGGGAIACR  184

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  F  D YCC GAF +PA+C PT YS  FK+ACP AYS+A+DD TS  TC A DY V
Sbjct  185   SACEAFGQDRYCCSGAFDTPAACHPTAYSTIFKSACPRAYSYAYDDSTSTFTCKAYDYTV  244

Query  489   SFC  481
             +FC
Sbjct  245   AFC  247



>ref|XP_009622122.1| PREDICTED: thaumatin-like protein 1 [Nicotiana tomentosiformis]
Length=365

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 162/249 (65%), Gaps = 17/249 (7%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCT---NITIINNCKETVWPGITTNNND---SGDGFALK  1030
             S++ P  F+L L+ A  + LS+       T +N C+ TVWPGI  N         GF L 
Sbjct  4     SSSSPSHFILSLSFAF-LVLSRGVLGATFTFVNKCEYTVWPGILANAGSPTLQSTGFELP  62

Query  1029  PGQSAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIA  856
                S  F AP+GW+GR WGRT C+FD   GS S  C TG CG G ++C+G G  PPAT+A
Sbjct  63    QDSSRTFTAPTGWSGRFWGRTSCSFD---GSESGSCGTGDCGSGEVECNGAGAAPPATLA  119

Query  855   DFTLGE--TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKT  682
             +FTLG    DFYDVSLVDG+NLP+VV+   G G C+  GC  DL + CP++L  +SGG  
Sbjct  120   EFTLGTGGQDFYDVSLVDGYNLPMVVEASGGSGMCATTGCVTDLNQICPTEL--RSGGGE  177

Query  681   VACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSAT  502
              ACRSAC  FN  EYCC GA+S+PA+C P+ YS+ FK+ACP +YS+A+DDPTS  TCS  
Sbjct  178   -ACRSACEAFNKPEYCCSGAYSTPATCKPSMYSQMFKSACPRSYSYAYDDPTSTFTCSGA  236

Query  501   DYVVSFCSS  475
             DY V+FC S
Sbjct  237   DYTVTFCPS  245



>dbj|BAD90814.1| thaumatin-like protein [Cryptomeria japonica]
Length=240

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 151/238 (63%), Gaps = 7/238 (3%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFA  1006
             +L  L + +  G   +  T  T++N C  TVWPG  + +  S     GF L PGQS    
Sbjct  5     RLATLAMMVLFGSCRAGATVFTLVNKCSYTVWPGTLSGSGSSVLGEGGFTLAPGQSVPLT  64

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCS-GTGQPPATIADFTLGETDF  829
             A S W+GR WGRT C+FD S   S   C TG CG  L C+   G PP ++A+FTLG+ DF
Sbjct  65    ASSRWSGRFWGRTDCSFDASGKGS---CITGDCGNVLNCAQAGGTPPVSLAEFTLGDKDF  121

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+N+P+ +  V G G+C   GC  DLR +CP++L++ S G+ +AC+SAC  F+
Sbjct  122   YDVSLVDGYNVPLSIAAVGGTGDCRTAGCVSDLRTSCPAELSVTSNGQVIACKSACAAFS  181

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             T EYCC G   SP +C P+ YS+ FK+ACP AYS+A+DD TS  TCS  DY ++FC S
Sbjct  182   TPEYCCTGDHGSPQTCSPSKYSQVFKSACPTAYSYAYDDATSTFTCSNADYTITFCPS  239



>ref|XP_010519216.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=243

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 152/237 (64%), Gaps = 16/237 (7%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAP  1000
             F LLL  AS       T +T+ N C   VWPGI  +      +G GF L P ++     P
Sbjct  11    FTLLLFQASA------TTVTMYNKCAHPVWPGIQPSAGQKLIAGGGFKLLPNKAFTLQLP  64

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFY  826
             S W+GR WGR GC FD+S       C TG CGG+L C+G G  PPAT+A+ TLG + DFY
Sbjct  65    SLWSGRFWGRHGCAFDRSG---RGRCATGDCGGSLLCNGLGGAPPATLAEITLGNDKDFY  121

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVF  652
             DVSLVDG+NL + ++PV G G CS  GC  DL   CP  L ++S  G + VAC+SAC+ F
Sbjct  122   DVSLVDGYNLAMSIQPVKGSGQCSYAGCVSDLNRMCPVGLQVRSRNGKQVVACKSACSAF  181

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             N+  YCC G+F +P SC PT YSK FKAACP AYS+A+DDPTS+ TCS  +Y+V+FC
Sbjct  182   NSPRYCCTGSFGNPQSCRPTAYSKIFKAACPKAYSYAYDDPTSIATCSKANYLVTFC  238



>ref|XP_006599328.1| PREDICTED: thaumatin-like protein 1-like [Glycine max]
Length=306

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 155/235 (66%), Gaps = 12/235 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+LA   GV+++  T  T +N C  TVWPG+    +    GF LK G +  F AP G
Sbjct  14    IFLLILAF-RGVRVTA-TTFTFVNKCDHTVWPGVLGKPDIGTTGFELKRGSTRSFDAPPG  71

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFY  826
             W+GR WGRTGC FD S  ++   C TG CG G + C+G G  PPAT+A+FTLGE   D+Y
Sbjct  72    WSGRFWGRTGCEFDDSGHAT---CATGDCGSGQVNCNGAGATPPATLAEFTLGEGAPDYY  128

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V    G G+C+A GC  DL   CP +L +  G    AC+SAC  F  
Sbjct  129   DVSLVDGYNLPMMVDASGGSGSCAATGCGADLNRRCPEELRVDGGD---ACQSACRAFGK  185

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              E+CC  AF+SPA+C P+ YS+ FKAACP +YS+A+DD TS  TC+A DY V+FC
Sbjct  186   PEFCCSDAFNSPAACAPSMYSQIFKAACPKSYSYAYDDATSTFTCTAADYTVTFC  240



>ref|XP_006390357.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
 gb|ESQ27643.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
Length=246

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 157/243 (65%), Gaps = 12/243 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAP  1000
             L L  + I SG+ +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP
Sbjct  8     LMLFFIFITSGIAVSA-TVFTLQNSCPYTVWPGILSGNSNTLGDGGFPLTPGASVQLTAP  66

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE----TD  832
              GW+GR W RTGC+FD S   +   C TG CGG LKC G G PP T+A+FT+G      D
Sbjct  67    PGWSGRFWARTGCSFDSSGHGN---CVTGDCGGVLKCIGGGVPPTTLAEFTVGSGDSGKD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACN  658
             FYDVSLVDG+N+ + +KP  G G+C   GC  D+   CPS+L +     G   AC+SAC 
Sbjct  124   FYDVSLVDGYNVEMGIKPQGGSGDCKYAGCVADVNTVCPSELRIMDPHTGIIAACKSACA  183

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT+YS  FK ACP AYS+A+DD TS  TCS ++Y+++FC 
Sbjct  184   AFNSPEFCCTGAHATPQTCSPTHYSAMFKNACPSAYSYAYDDATSTFTCSGSNYLITFCP  243

Query  477   SRN  469
             +R+
Sbjct  244   TRS  246



>ref|XP_009419984.1| PREDICTED: pathogenesis-related protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=289

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 155/249 (62%), Gaps = 16/249 (6%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQSA  1015
             AF  +  LL  I+ G     CT  T+ NNC   +WPG             GF L  GQ+A
Sbjct  11    AFVPILALLFRISDG-----CT-FTVSNNCPHPIWPGTLAGAGTPQLPTTGFRLDSGQTA  64

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG-  841
                AP GW+GRIW RTGCNFD +NG+ +  CQTG CGG ++C G G  PP T+ + TLG 
Sbjct  65    RIRAPPGWSGRIWARTGCNFD-TNGAGT--CQTGDCGGRMECGGIGALPPVTLFEITLGT  121

Query  840   --ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
               + D+YDVSLVDG+NLP+V  P    G C+A GC  DL   CP +L +  GG  VACRS
Sbjct  122   GLDEDYYDVSLVDGYNLPVVAAPRVLHGGCNATGCLADLNRGCPKELRVDGGGGVVACRS  181

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F  DEYCC G +++P+SC P+ YS  FKAACP AYS+AFDD TS  TC+A DY + 
Sbjct  182   ACEAFGLDEYCCSGEYANPSSCKPSFYSTIFKAACPRAYSYAFDDGTSTFTCNAYDYTIV  241

Query  486   FCSSRNQTQ  460
             FC++ N+ +
Sbjct  242   FCANVNRMR  250



>gb|ABK25809.1| unknown [Picea sitchensis]
Length=243

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 154/235 (66%), Gaps = 9/235 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAP  1000
             FL LL IA G  +   T  T+ N CK +VWPGI  +      +  GF L P Q+     P
Sbjct  11    FLSLLCIAGGSGVFA-TTFTLFNKCKHSVWPGIQPSAGRPVLANGGFRLMPLQAMSIVPP  69

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGETDFYD  823
             +GW+GRIWGR GC+FD S+G     C TG CGG L C+G G  PPAT+A+ TLG  DFYD
Sbjct  70    AGWSGRIWGRHGCSFD-SDGKGL--CATGDCGGQLHCNGAGGAPPATLAEITLGTQDFYD  126

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVFNT  646
             VSLVDG+NLPI + P  G G C+  GC  DL  +CP  L +K   G  +AC+SAC  F+T
Sbjct  127   VSLVDGYNLPIAIAPRRGSGKCTYAGCISDLNLSCPPSLQVKNEQGCVMACKSACFAFST  186

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              +YCC G++ +P +C PT++S+ FK ACP AYS+A+DDP S++TCS  DY+++FC
Sbjct  187   PQYCCTGSYGNPQTCRPTSFSRLFKNACPRAYSYAYDDPNSLVTCSGADYLITFC  241



>ref|XP_009607714.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana tomentosiformis]
Length=335

 Score =   232 bits (592),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 157/237 (66%), Gaps = 15/237 (6%)
 Frame = -3

Query  1158  LAIASGVKLSKCTNI-----TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             L I S + L  C  I     T +N C +TVWPGI         GF L  G S  F AP+G
Sbjct  7     LIIHSLIVLIFCEGILGATFTFVNKCDKTVWPGILGTPKLDSTGFELTKGSSRSFQAPTG  66

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLGE--TDFY  826
             W+GR WGRTGCNFD S    S  C T  CG G ++C+G G  PPAT+A+FTLG    DFY
Sbjct  67    WSGRFWGRTGCNFDDSG---SGTCATADCGSGQMECNGGGATPPATLAEFTLGSGSQDFY  123

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C++ GC+ DL + CP++L ++ GG   ACRSAC+ F T
Sbjct  124   DVSLVDGYNLPMMVEVSGGSGPCASTGCNVDLNQKCPTELRVEDGG---ACRSACDAFRT  180

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              +YCC GA++SPA+C P+ YS+ FK+ACP +YS+A+DD TS  TCS  +Y+++FC S
Sbjct  181   PQYCCEGAYASPATCSPSVYSQMFKSACPKSYSYAYDDATSTFTCSNANYIITFCPS  237



>ref|XP_009117553.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Brassica 
rapa]
Length=244

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 153/242 (63%), Gaps = 11/242 (5%)
 Frame = -3

Query  1182  FPKLFLLLLA-IASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQSA  1015
             F  L LL L+ I + V +   T  TI N+C   VWPGI T N  +     GF L PG S 
Sbjct  4     FSGLHLLFLSFIIATVSVVSGTVFTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGASV  63

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGE  838
                AP+GW+GRIWGRTGCNFD   GS +  C TG CG  LKC+G G  PP T+A+FT+G 
Sbjct  64    AVTAPAGWSGRIWGRTGCNFD---GSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGN  120

Query  837   ---TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
                 DFYDVSLVDG+N+ + V    G G+C  +GC  DL   CP++L + +G   VAC+S
Sbjct  121   GGAKDFYDVSLVDGYNVQMGVTTRGGSGDCQNIGCVADLNGRCPNELRVMNGANVVACKS  180

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F   EYCC GAFS+ A+C PTNYS+ FK ACP AYS+A+DD +S  TC+  +Y + 
Sbjct  181   ACEAFGKPEYCCTGAFSTSATCPPTNYSRIFKGACPKAYSYAYDDASSTFTCANANYSIV  240

Query  486   FC  481
             FC
Sbjct  241   FC  242



>ref|NP_001288837.1| thaumatin-like protein precursor [Brassica rapa]
 gb|ABV89611.1| thaumatin-like protein [Brassica rapa]
Length=245

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 149/229 (65%), Gaps = 10/229 (4%)
 Frame = -3

Query  1131  SKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             S+ + +   N C  TVWPGI  ++     +G GF L P ++     PS W+GR WGR GC
Sbjct  20    SEASTVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGC  79

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG-ETDFYDVSLVDGFNLPIV  787
             +FD+S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL + 
Sbjct  80    SFDRSG---RGRCATGDCGGSLLCNGAGGVPPATLAEITLGHEQDFYDVSLVDGYNLAMS  136

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSS  613
             + PV G G C+  GC  DL   CP  L ++S  G + VAC+SAC+ FN+  YCC G+F +
Sbjct  137   IMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGN  196

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             P +C PT YSK FK ACP AYS+A+DDPTS+ TC+  +YVV+FC  R +
Sbjct  197   PQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPHRGR  245



>ref|XP_006416518.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
 gb|ESQ34871.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
Length=245

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 153/243 (63%), Gaps = 12/243 (5%)
 Frame = -3

Query  1182  FPKLFLLLLA--IASG-VKLSKCTNITIINNCKETVWPGITTNNNDS--GDGFALKPGQS  1018
             F  L LL  +  I++G + +   T  TI+N+C  TVWPGI T N       GFAL PG S
Sbjct  4     FSGLHLLFFSFFISTGTISVVSGTVFTIVNSCSFTVWPGILTGNGAQLMDGGFALNPGAS  63

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                 AP+GW+GR WGRTGCNFD S   S   C TG CG  LKC G G  PPAT+A+FT+G
Sbjct  64    VDVTAPAGWSGRFWGRTGCNFDSSGAGS---CITGDCGNKLKCGGAGGAPPATLAEFTIG  120

Query  840   ET---DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACR  670
                  DFYDVSLVDG+N+ + +    G G+C  VGC  DL  NCP+DL +   G  VAC+
Sbjct  121   TNGGNDFYDVSLVDGYNVQMEITTGGGSGDCQNVGCVSDLNANCPNDLRVSDAGNVVACK  180

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  FN  E+CC G+F  P +C PT+YS+ FK ACP AYS+A+DD +S  TC+  +Y +
Sbjct  181   SACEAFNKPEFCCTGSFGKPETCPPTDYSRIFKGACPKAYSYAYDDASSTFTCANANYSI  240

Query  489   SFC  481
              FC
Sbjct  241   IFC  243



>ref|XP_009117552.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Brassica 
rapa]
 emb|CDY21672.1| BnaA09g44230D [Brassica napus]
Length=246

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 155/244 (64%), Gaps = 13/244 (5%)
 Frame = -3

Query  1182  FPKLFLLLLA--IASG-VKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQ  1021
             F  L LL L+  IA+G V +   T  TI N+C   VWPGI T N  +     GF L PG 
Sbjct  4     FSGLHLLFLSFIIATGAVSVVSGTVFTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGA  63

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTL  844
             S    AP+GW+GRIWGRTGCNFD   GS +  C TG CG  LKC+G G  PP T+A+FT+
Sbjct  64    SVAVTAPAGWSGRIWGRTGCNFD---GSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTI  120

Query  843   GE---TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVAC  673
             G     DFYDVSLVDG+N+ + V    G G+C  +GC  DL   CP++L + +G   VAC
Sbjct  121   GNGGAKDFYDVSLVDGYNVQMGVTTRGGSGDCQNIGCVADLNGRCPNELRVMNGANVVAC  180

Query  672   RSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYV  493
             +SAC  F   EYCC GAFS+ A+C PTNYS+ FK ACP AYS+A+DD +S  TC+  +Y 
Sbjct  181   KSACEAFGKPEYCCTGAFSTSATCPPTNYSRIFKGACPKAYSYAYDDASSTFTCANANYS  240

Query  492   VSFC  481
             + FC
Sbjct  241   IVFC  244



>emb|CDX96487.1| BnaA07g30980D [Brassica napus]
Length=245

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 149/229 (65%), Gaps = 10/229 (4%)
 Frame = -3

Query  1131  SKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             S+ + +   N C  TVWPGI  ++     +G GF L P ++     PS W+GR WGR GC
Sbjct  20    SEASTVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGC  79

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG-ETDFYDVSLVDGFNLPIV  787
             +FD+S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL + 
Sbjct  80    SFDRSG---RGRCATGDCGGSLLCNGAGGVPPATLAEITLGHEQDFYDVSLVDGYNLAMS  136

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSS  613
             + PV G G C+  GC  DL   CP  L ++S  G + VAC+SAC+ FN+  YCC G+F +
Sbjct  137   IMPVKGTGKCTYAGCISDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGN  196

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             P +C PT YSK FK ACP AYS+A+DDPTS+ TC+  +YVV+FC  R +
Sbjct  197   PQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPHRGR  245



>gb|KDP26886.1| hypothetical protein JCGZ_18044 [Jatropha curcas]
Length=232

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 149/238 (63%), Gaps = 13/238 (5%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVF  1009
             P  FLL+L I+  V  S     T  N C+ TVWPGI +        G GF L+PGQS   
Sbjct  3     PLHFLLMLLIS--VLGSDAAVFTFSNRCRTTVWPGILSGAGKPQLMGGGFELRPGQSVTL  60

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE-T  835
              AP GW+GR WGRTGC+FD+S       C TG CGG LKC+G G  PPA++A+FTL    
Sbjct  61    NAPQGWSGRFWGRTGCSFDRSG---RGRCLTGDCGGVLKCAGAGGVPPASLAEFTLNSPL  117

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             D+YDVSLVDGFNLPI + P    G C +V C  D+   CP  L ++   + VAC+SAC  
Sbjct  118   DYYDVSLVDGFNLPISILPT---GACKSVECVADMNRRCPGSLQVRWNRQVVACKSACLA  174

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F + E+CC G + SPA+C P+NYSK FK ACP AYS+AFDD TS  TC   +Y++ FC
Sbjct  175   FGSPEFCCTGPYGSPATCKPSNYSKVFKDACPTAYSYAFDDSTSTFTCQGANYLIRFC  232



>ref|XP_010262514.1| PREDICTED: thaumatin-like protein isoform X2 [Nelumbo nucifera]
Length=247

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 149/245 (61%), Gaps = 10/245 (4%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQS  1018
             T    LF  L+     V++S  T I + N C   VWPGI  +      +  GF L P Q+
Sbjct  7     TLLALLFSALIFCYISVEVSA-TTIALYNKCSHPVWPGIQPSAGKPILARGGFKLNPNQA  65

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                  P+GW+GRIWGR  C FD   GS    C TG CGGAL C+G G  PPAT+A+ TLG
Sbjct  66    YSLKIPAGWSGRIWGRQDCYFD---GSGRGHCATGDCGGALYCNGVGGAPPATLAEITLG  122

Query  840   ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRS  667
             E DFYDVSLVDG+NL I + P  GKG CS  GC  DL   CP  L ++S    + VAC+S
Sbjct  123   EQDFYDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRSHDNRRVVACKS  182

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F + +YCC G + +P SC PT YS+ FK ACP AYS+A+DDPTS+ TCS   Y+V+
Sbjct  183   ACFAFQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCSGGSYLVT  242

Query  486   FCSSR  472
             FC  R
Sbjct  243   FCPHR  247



>ref|XP_011084258.1| PREDICTED: thaumatin-like protein [Sesamum indicum]
Length=248

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 153/241 (63%), Gaps = 11/241 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             LFL +L +   V++S  T +T+ N C   VWPGI  +      +  GF L P +S     
Sbjct  12    LFLAILILHISVEVSG-TTMTLYNKCSHPVWPGIQPSAGKPVLARGGFKLPPNKSYTVQL  70

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDF  829
             P+GW+GR+WGR GC+F   N      C TG CGGAL C+G G  PPAT+A+ TLG + DF
Sbjct  71    PAGWSGRVWGRHGCSF---NAEGRGRCATGDCGGALFCNGIGGPPPATLAEITLGNDQDF  127

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGK--TVACRSACNV  655
             YDVSLVDG+NL I + P  GKG CS  GC  DL   CP  L ++S  K   VAC+SAC  
Sbjct  128   YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNMMCPVGLQVRSHDKKSVVACKSACFA  187

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FN+  YCC G+F +P SC PT YS+ FKAACP AYS+A+DDPTS+ TC+   Y+++FC  
Sbjct  188   FNSPRYCCTGSFGNPQSCKPTAYSRIFKAACPKAYSYAYDDPTSIATCTGGSYLLTFCPH  247

Query  474   R  472
             R
Sbjct  248   R  248



>ref|XP_004516152.1| PREDICTED: thaumatin-like protein-like, partial [Cicer arietinum]
Length=223

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  T+ N C+ T+WPGI T       +  GF L+PGQ+    AP GW+GR WGR GC F 
Sbjct  7     TIFTLQNKCRNTMWPGILTGAGKPPLTDGGFRLRPGQAINITAPKGWSGRFWGRRGCTF-  65

Query  951   KSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG--ETDFYDVSLVDGFNLPIVVK  781
               NG     C TG CGG L+C+G G  PPA++A+FTL   E DFYDVSLVDG+N+P+ + 
Sbjct  66    --NGFGHGKCITGDCGGKLRCAGAGGIPPASLAEFTLDSPEGDFYDVSLVDGYNMPVSII  123

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASC  601
             P  G G C  V C  DL  NCP+ L L++  + V C+SAC  FN  EYCC G F+SP  C
Sbjct  124   PSRGSGQCKTVKCRSDLNRNCPTGLELRNKDRVVGCKSACMAFNKPEYCCTGDFNSPNKC  183

Query  600   LPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              P++YSK FKA+CP AYS+A+DD TS  TC   DY++ FC
Sbjct  184   QPSSYSKVFKASCPQAYSYAYDDATSTFTCHGADYIIRFC  223



>gb|KFK41805.1| hypothetical protein AALP_AA2G174200 [Arabis alpina]
Length=244

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 146/224 (65%), Gaps = 10/224 (4%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS  946
             +   N C  TVWPGI  ++     +G GF L P ++     P  W+GR WGR GC+FD+S
Sbjct  24    VIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCSFDRS  83

Query  945   NGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG-ETDFYDVSLVDGFNLPIVVKPVN  772
                    C TG CGG+L C+G G  PPAT+A+ TLG + DFYDVSLVDG+NL + + PV 
Sbjct  84    GHGR---CATGDCGGSLLCNGAGGVPPATLAEITLGHDQDFYDVSLVDGYNLAMSIMPVK  140

Query  771   GKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPASCL  598
             GKG CS  GC  DL   CP  L ++S  G + VAC+SAC+ FN+ +YCC G+F SP SC 
Sbjct  141   GKGKCSYAGCVSDLNRMCPVGLQVRSRDGRRVVACKSACSAFNSPQYCCTGSFGSPQSCR  200

Query  597   PTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+VSFC    +
Sbjct  201   PTAYSKIFKVACPKAYSYAYDDPTSISTCSKANYIVSFCPRHGR  244



>ref|XP_009106020.1| PREDICTED: thaumatin-like protein isoform X2 [Brassica rapa]
Length=264

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 147/226 (65%), Gaps = 10/226 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             + +   N C  TVWPGI  ++     +G GF L P ++     PS W+GR WGR GC+FD
Sbjct  42    STVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGCSFD  101

Query  951   KSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKP  778
             +S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL + + P
Sbjct  102   RSG---RGRCATGDCGGSLLCNGAGGVPPATLAEITLGHEQDFYDVSLVDGYNLAMSIMP  158

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             V G G C+  GC  DL   CP  L ++S  G + VAC+SAC+ FN+  YCC G+F +P +
Sbjct  159   VKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGNPQT  218

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             C PT YSK FK ACP AYS+A+DDPTS+ TC+  +YVV+FC  R +
Sbjct  219   CRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPHRGR  264



>ref|XP_002887570.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63829.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 160/242 (66%), Gaps = 12/242 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              +  + I SG+  S  T  T++N+C  TVWPG  + N+ + GDG F L PG S    AP+
Sbjct  9     IIFFVFITSGIADSA-TVFTLLNSCPYTVWPGTLSGNSVTLGDGGFPLTPGASVQLTAPT  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWARTGCNFDASGHGT---CVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + +KP  G GNC   GC  D+ E CPS+L +   + G   AC+SAC  
Sbjct  125   YDVSLVDGYNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSIAACKSACAA  184

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD +S  TC+ ++Y+++FC +
Sbjct  185   FNSPEFCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCPT  244

Query  474   RN  469
             ++
Sbjct  245   QS  246



>ref|XP_006302689.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
 gb|EOA35587.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
Length=267

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 154/236 (65%), Gaps = 11/236 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L L+ I SG+ +S  T  TI NNC  TVW G         GDG F L PG S    AP+
Sbjct  36    ILFLVFITSGIAVSA-TVFTIKNNCPTTVWAGTLAGRGPKLGDGGFQLTPGASRQLTAPA  94

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGC+FD   G+ +  C TG CGG L+CSG G PP ++A+FTL   G  DFY
Sbjct  95    GWSGRFWARTGCSFD---GAGNGRCVTGDCGG-LRCSGGGVPPVSLAEFTLVGDGGKDFY  150

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDL-ALKSGGKTVACRSACNVFN  649
             DVSLVDG+N+ I ++P  G G+C   GC  DL  NCP+DL  +      VAC+SAC  FN
Sbjct  151   DVSLVDGYNVKIGIRPSGGSGDCRYAGCVADLNANCPNDLKVMGPQNNVVACKSACARFN  210

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             TD+YCCRGAF++P +C PT+YS+ FK ACP AYS+A+DD TS  TC+  +Y V+FC
Sbjct  211   TDQYCCRGAFNTPKTCPPTDYSRIFKNACPDAYSYAYDDETSTFTCTGANYEVAFC  266



>ref|XP_010262463.1| PREDICTED: thaumatin-like protein isoform X1 [Nelumbo nucifera]
Length=248

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 146/245 (60%), Gaps = 9/245 (4%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQS  1018
             T    LF  L+     V     T I + N C   VWPGI  +      +  GF L P Q+
Sbjct  7     TLLALLFSALIFCYISVVEVSATTIALYNKCSHPVWPGIQPSAGKPILARGGFKLNPNQA  66

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                  P+GW+GRIWGR  C FD   GS    C TG CGGAL C+G G  PPAT+A+ TLG
Sbjct  67    YSLKIPAGWSGRIWGRQDCYFD---GSGRGHCATGDCGGALYCNGVGGAPPATLAEITLG  123

Query  840   ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRS  667
             E DFYDVSLVDG+NL I + P  GKG CS  GC  DL   CP  L ++S    + VAC+S
Sbjct  124   EQDFYDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRSHDNRRVVACKS  183

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F + +YCC G + +P SC PT YS+ FK ACP AYS+A+DDPTS+ TCS   Y+V+
Sbjct  184   ACFAFQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCSGGSYLVT  243

Query  486   FCSSR  472
             FC  R
Sbjct  244   FCPHR  248



>ref|XP_010416362.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 158/242 (65%), Gaps = 12/242 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L  + I SGV +S  T  TI N+C  TVWPG  + N+ + GDG F L PG S    AP 
Sbjct  9     ILFFVFITSGVAVSA-TVFTIQNSCPYTVWPGTLSGNSITLGDGGFQLTPGASVQLTAPV  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR WGRTGCNFD S   +   C TG CGG LKC G G+PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWGRTGCNFDASGRGT---CVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + + P  G GNC   GC  D+ E CP++L +     G   AC+SAC  
Sbjct  125   YDVSLVDGYNVKMGIAPQGGFGNCKYAGCVSDINEICPNELRIMDPGSGSIAACKSACAA  184

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             F++ E+CC GA S+P +C PT YS  FK ACP AYS+A+DD +S  TC+ ++Y+++FC +
Sbjct  185   FSSPEFCCTGAHSTPQTCSPTYYSTMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCPT  244

Query  474   RN  469
             ++
Sbjct  245   QS  246



>ref|XP_003629298.1| Thaumatin-like protein [Medicago truncatula]
 gb|AET03774.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=308

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 178/311 (57%), Gaps = 28/311 (9%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+LA   GV +S  T  T +N C  T+WPGI    +    GF LK G +  F A +G
Sbjct  16    IFLLILAF-KGVTISA-TTFTFVNKCDHTIWPGILGKPDLGTTGFELKKGNTQTFQALAG  73

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLGET--DFY  826
             W+GR W RTGC FD S   +   C TG CG G + C+G G  PPAT+A+FTLG +  D+Y
Sbjct  74    WSGRFWARTGCKFDDSGHGT---CSTGDCGSGEINCNGNGATPPATLAEFTLGNSSPDYY  130

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G+C A GC +DL   CPS+L +  G    AC SAC  F T
Sbjct  131   DVSLVDGYNLPVMVETSGGSGSCQATGCGEDLNRRCPSELRVDGGD---ACNSACGAFGT  187

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSAT-DYVVSFCSSRN  469
              EYCC GAF SP+SC P+ YS+ FK+ACP +YS+AFDD TS  TC+A  DY ++FC S +
Sbjct  188   PEYCCSGAFGSPSSCSPSVYSEMFKSACPKSYSYAFDDATSTFTCTAADDYTITFCPSSS  247

Query  468   QTQCTFHDKNVSCSSDAKGMAPFFKPWQMLLAVALPTTVFNLGVLL*H*ILYSFRLSDEL  289
              +  +  +     S +   +A   K W   LA    T +             S   S  +
Sbjct  248   PSLKSLMESKPGSSVEQAAVAT--KSWIANLATGASTRI-------------SQPFSTSM  292

Query  288   WTMFCSVTFIL  256
                F ++TFI 
Sbjct  293   SIFFVAITFIF  303



>ref|XP_006383093.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
 gb|ERP60890.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
Length=325

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 151/234 (65%), Gaps = 13/234 (6%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             FL LL I  GV  +K    T +N C  +VWPGI  +      GF L+ G S  F AP+GW
Sbjct  17    FLSLLFIFEGVSGAK---FTFVNKCDFSVWPGILGSPELDSTGFELRKGSSRSFQAPTGW  73

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFYD  823
             +GR WGRTGCNFD S   S   C T  CG G ++C+G G  PPAT+A+FTLG    DFYD
Sbjct  74    SGRFWGRTGCNFDSSGHGS---CVTADCGSGQVECNGAGATPPATLAEFTLGSGSQDFYD  130

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDG+NLP++V+   G G C++ GC  DL   CP++L  + G    ACRSAC  F   
Sbjct  131   VSLVDGYNLPMIVEVSGGSGECASTGCVTDLNRKCPTELRTEGGS---ACRSACEAFGKP  187

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             EYCC G ++SPASC P+ YS+ FK+ACP +YS+A+DD TS  TC+  DY ++FC
Sbjct  188   EYCCSGEYNSPASCKPSMYSQVFKSACPKSYSYAYDDATSTFTCTGADYTITFC  241



>ref|XP_010941295.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=300

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 164/248 (66%), Gaps = 16/248 (6%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVF  1009
             P LFL LLA+   + +  CT  T +NNC +TVWPG+ +N+        GFAL  G+S V 
Sbjct  10    PILFLSLLAVFF-IGMMDCTRFTFVNNCGDTVWPGVLSNSGSPKLDSTGFALAAGESRVL  68

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGET  835
              AP+GW+GR W RTGCNFD +   S   C TG CG G ++C+G G  PPAT+A+F+LG  
Sbjct  69    LAPAGWSGRFWARTGCNFDSAGSGS---CATGDCGSGQVECNGAGATPPATLAEFSLGGA  125

Query  834   D---FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
             D   FYDVSLVDG+NLP+VV  V G G C+A GC  DL   CP +L +  G +  ACRSA
Sbjct  126   DGKDFYDVSLVDGYNLPVVV--VAGSG-CAATGCAADLNRRCPEELRVGDG-EGAACRSA  181

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  F   E+CC G ++SPA+C P+ YS+ FK+ACP +YS+A+DD +S+ TC+A D+ ++F
Sbjct  182   CGAFGRPEFCCSGEYASPATCHPSVYSEVFKSACPRSYSYAYDDASSIFTCTAGDFSITF  241

Query  483   CSSRNQTQ  460
             C   + +Q
Sbjct  242   CPGSSPSQ  249



>ref|XP_009795149.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Nicotiana 
sylvestris]
Length=344

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 155/235 (66%), Gaps = 15/235 (6%)
 Frame = -3

Query  1158  LAIASGVKLSKCTNI-----TIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             L I S + L  C  I     T +N C +TVWPGI         GF L  G S  F AP+G
Sbjct  11    LMIHSVIVLIFCEGILGATFTFVNKCDKTVWPGILGTPKLDSTGFELTKGSSRSFQAPTG  70

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFY  826
             W+GR WGRTGCNFD S    S  C T  CG G ++C+G G  PPAT+A+FTLG    DFY
Sbjct  71    WSGRFWGRTGCNFDDSG---SGSCATADCGSGQMECNGGGATPPATLAEFTLGSGSQDFY  127

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C++ GC+ DL + CP++L +  GG   ACRSAC+ F T
Sbjct  128   DVSLVDGYNLPMMVEVSGGSGPCASTGCNVDLNQKCPTELMVDGGG---ACRSACDAFRT  184

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              +YCC GA++SPA+C P+ YS+ FK+ACP +YS+A+DD TS  TCS  +Y+++FC
Sbjct  185   PQYCCEGAYASPATCSPSVYSQMFKSACPKSYSYAYDDATSTFTCSNANYIITFC  239



>ref|XP_008680256.1| PREDICTED: thaumatin-like protein 1b [Zea mays]
Length=334

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 156/247 (63%), Gaps = 14/247 (6%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQ  1021
             S+A+P L +L LA   GV  +  T  T+ N C + +WPG             GF L PGQ
Sbjct  9     SSAYPLLLVLALAHWRGVAAASSTTFTVSNYCSQPIWPGTLAGAGTPQLPTTGFRLDPGQ  68

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTL  844
             SA+  AP+GW+GR+W RTGC F      +   CQTG CGG L+C+G G  PPAT+ + TL
Sbjct  69    SALVPAPAGWSGRLWARTGCAFGAGGEGT---CQTGDCGGRLECAGAGGAPPATLFEVTL  125

Query  843   GE----TDFYDVSLVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTV  679
             G+     D+YDVSLVDG+NLP+V  P    G  C+A GC  DL   CP +L ++ GG TV
Sbjct  126   GKGATGLDYYDVSLVDGYNLPVVAVPRAPSGAGCNATGCTADLLAACPKELQVERGG-TV  184

Query  678   ACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITC-SAT  502
             ACRSAC  F  D+YCC GA+++PA+C PT YS  FK+ACP AYS+A+DD +S  TC SA 
Sbjct  185   ACRSACEAFGQDQYCCSGAYATPAACRPTAYSSIFKSACPRAYSYAYDDGSSTFTCHSAA  244

Query  501   DYVVSFC  481
              Y ++FC
Sbjct  245   GYTIAFC  251



>emb|CDY68760.1| BnaAnng28270D [Brassica napus]
Length=246

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 156/243 (64%), Gaps = 12/243 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAP  1000
             L LL + I SGV +S  T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP
Sbjct  8     LILLFVFITSGVAVSA-TVFTLQNSCPYTVWPGILSGNSNTLGDGGFPLTPGASKQLTAP  66

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE----TD  832
              GW+GR W RTGC+FD S   +   C TG CGG LKC G G PP T+A+FT+G      D
Sbjct  67    QGWSGRFWARTGCSFDSSGNGN---CVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLAL--KSGGKTVACRSACN  658
             FYDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC 
Sbjct  124   FYDVSLVDGYNVEMGIKPQGGSGDCKYAGCVADVNAVCPNELRIVDPKTGTVAACKSACA  183

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS  TC+  +Y+++FC 
Sbjct  184   AFNSPEFCCTGAHATPQTCSPTRYSAMFKNACPSAYSYAYDDATSTFTCAGANYLITFCP  243

Query  477   SRN  469
             +R+
Sbjct  244   TRS  246



>ref|XP_004293225.1| PREDICTED: pathogenesis-related protein 5-like [Fragaria vesca 
subsp. vesca]
Length=251

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 154/242 (64%), Gaps = 14/242 (6%)
 Frame = -3

Query  1173  LFLLLLAIAS--GVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVF  1009
             L+LL L IAS     +   T  T+ N+C  TVWPG  + N  +     GFA+ PG     
Sbjct  8     LYLLPLIIASLAATNVVYATIFTLQNHCPYTVWPGTLSGNGAAVLGEGGFAMFPGAEIQL  67

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET--  835
              AP+GW+GR W RTGCNFD++    +  C TG CGGALKC+G G+PP T+A+FT+G T  
Sbjct  68    TAPAGWSGRFWARTGCNFDEAG---NGKCVTGDCGGALKCTGGGEPPVTLAEFTVGSTLT  124

Query  834   --DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGK--TVACRS  667
               DFYDVSLVDG+N+ + ++   G G+C   GC  DL  NCP +L +   G    VAC+S
Sbjct  125   DKDFYDVSLVDGYNVGMGLRATGGDGDCQYAGCVSDLNTNCPPELRVTDSGSGVVVACKS  184

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  FN  E+CC G  ++P +C PT YS  FK+ACP AYS+A+DD TS  TC+ +DY+++
Sbjct  185   ACEAFNAPEFCCTGDHATPQTCSPTQYSAMFKSACPTAYSYAYDDATSTCTCTGSDYLIT  244

Query  486   FC  481
             FC
Sbjct  245   FC  246



>ref|XP_010471602.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 158/242 (65%), Gaps = 12/242 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L  + I SG+ +S  T  TI N+C  TVWPG  + N+ + GDG F L PG S    AP 
Sbjct  9     ILFFVFITSGIAVSA-TVFTIQNSCPYTVWPGTLSGNSITLGDGGFQLTPGASVQLTAPV  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR WGRTGCNFD S   +   C TG CGG LKC G G+PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWGRTGCNFDASGRGT---CVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + + P  G GNC   GC  D+ E CP++L +     G   AC+SAC  
Sbjct  125   YDVSLVDGYNVKMGIAPQGGFGNCKYAGCVSDINEICPNELRIMDPGSGSIAACKSACAA  184

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             F++ E+CC GA S+P +C PT YS  FK ACP AYS+A+DD +S  TC+ ++Y+++FC +
Sbjct  185   FSSPEFCCTGAHSTPQTCSPTYYSTMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCPT  244

Query  474   RN  469
             ++
Sbjct  245   QS  246



>ref|XP_010266794.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=330

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 151/233 (65%), Gaps = 13/233 (6%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  T +N C  T+WPGI  N         GF L  G S  F AP+GW+GR WGRTGCNFD
Sbjct  26    TTFTFVNKCDYTIWPGILANAGSPRLDSTGFELTQGSSRSFQAPTGWSGRFWGRTGCNFD  85

Query  951   KSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFYDVSLVDGFNLPIVV  784
                GS    C TG CG G ++C G G  PPAT+A+FTLG    DFYDVSLVDG+NLP++V
Sbjct  86    ---GSGQGSCATGDCGSGQIECKGAGAAPPATLAEFTLGSGSQDFYDVSLVDGYNLPMIV  142

Query  783   KPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             +   G+G C++ GC  DL + CP++L +   G+  AC+SAC  F T EYCC G F++PA+
Sbjct  143   EGTGGQGTCASTGCVTDLNQRCPTELRV---GEGEACKSACEAFGTPEYCCSGEFNTPAT  199

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQCTFHD  445
             C P+ YS+ FK+ACP +YS+A+DD TS  TC+  DY ++FC S   +Q +  D
Sbjct  200   CRPSVYSEMFKSACPKSYSYAYDDATSTFTCTGADYTITFCPSSLTSQKSSRD  252



>ref|XP_010245598.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=324

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 151/228 (66%), Gaps = 13/228 (6%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  T +N C  TVWPGI  N         GF L  G S  F AP+GW+GR WGRTGCNFD
Sbjct  26    TTFTFVNKCDYTVWPGILANAGSPKLDSTGFELAKGSSRSFQAPTGWSGRFWGRTGCNFD  85

Query  951   KSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFYDVSLVDGFNLPIVV  784
                GS    C TG CG G ++C+G G  PPAT+A+FTLG    DFYDVSLVDG+NLP++V
Sbjct  86    ---GSGRGSCSTGDCGSGQIECNGAGAAPPATLAEFTLGSGSQDFYDVSLVDGYNLPMIV  142

Query  783   KPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             +   G+G C++ GC  DL + CP++L +   G+  AC+SAC  F T EYCC G+F++PA+
Sbjct  143   EGSGGQGTCTSTGCVTDLNQRCPTELKV---GEGDACKSACEAFGTPEYCCSGSFNTPAT  199

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQTQ  460
             C P+ YS+ FK+ACP +YS+A+DD TS  TC+  DY ++FC S   +Q
Sbjct  200   CRPSVYSQMFKSACPKSYSYAYDDATSTFTCTGADYTIAFCPSSLTSQ  247



>ref|XP_011092890.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
 ref|XP_011092891.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=364

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 155/246 (63%), Gaps = 17/246 (7%)
 Frame = -3

Query  1182  FPKLFLLLLAIASGVKLSKCT---NITIINNCKETVWPGITTNNND---SGDGFALKPGQ  1021
             F  L L+L    S +  S+       T +N C  TVWPGI  N         GF L    
Sbjct  5     FSYLSLILTLQISLLLFSRAAFGAKFTFVNKCDHTVWPGILANAGSPTLDSTGFELPQDS  64

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFT  847
             S  F AP+GW+GR WGRTGC F   +G+    CQTG CG G  +C+G+G  PPAT+A+FT
Sbjct  65    SRTFLAPAGWSGRFWGRTGCKFSDESGT----CQTGDCGSGQAECNGSGAAPPATLAEFT  120

Query  846   LGE--TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVAC  673
             LG    DFYDVSLVDG+NLP++V+   G G C++ GC  DL   CPS+L ++ G    AC
Sbjct  121   LGTGGLDFYDVSLVDGYNLPMIVEATGGTGMCASTGCVTDLNRACPSELRVRGG---AAC  177

Query  672   RSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYV  493
             +SAC  F + EYCC GAF+SPASC P+ YS+ FK+ACP +YS+A+DDPTS  TCS  DY 
Sbjct  178   QSACEAFGSPEYCCSGAFNSPASCRPSVYSQMFKSACPRSYSYAYDDPTSTFTCSGADYT  237

Query  492   VSFCSS  475
             V+FC S
Sbjct  238   VTFCPS  243



>gb|KEH20376.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 155/238 (65%), Gaps = 13/238 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+LA   GV +S  T  T +N C  T+WPGI    +    GF LK G +  F A +G
Sbjct  16    IFLLILAF-KGVTISA-TTFTFVNKCDHTIWPGILGKPDLGTTGFELKKGNTQTFQALAG  73

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLGET--DFY  826
             W+GR W RTGC FD S   +   C TG CG G + C+G G  PPAT+A+FTLG +  D+Y
Sbjct  74    WSGRFWARTGCKFDDSGHGT---CSTGDCGSGEINCNGNGATPPATLAEFTLGNSSPDYY  130

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G+C A GC +DL   CPS+L +  G    AC SAC  F T
Sbjct  131   DVSLVDGYNLPVMVETSGGSGSCQATGCGEDLNRRCPSELRVDGGD---ACNSACGAFGT  187

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSAT-DYVVSFCSS  475
              EYCC GAF SP+SC P+ YS+ FK+ACP +YS+AFDD TS  TC+A  DY ++FC S
Sbjct  188   PEYCCSGAFGSPSSCSPSVYSEMFKSACPKSYSYAFDDATSTFTCTAADDYTITFCPS  245



>ref|XP_010428509.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=240

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 155/236 (66%), Gaps = 11/236 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L L+ I SG+ +S  T  TI NNC  TVW G         GDG F L PG S    AP+
Sbjct  9     ILFLVFITSGIAVSA-TVFTIKNNCPTTVWAGTLAGKGPKLGDGGFELTPGASRQLTAPA  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGC+FD   G+ +  C TG CGG L+C+G G PP ++A+FTL   G  DFY
Sbjct  68    GWSGRFWARTGCSFD---GAGNGRCVTGDCGG-LRCNGGGVPPVSLAEFTLVGDGGKDFY  123

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDL-ALKSGGKTVACRSACNVFN  649
             DVSLVDG+N+ + ++P  G G+C   GC  DL  NCP++L  +  G   VAC+SAC  FN
Sbjct  124   DVSLVDGYNVKLGIRPSGGSGDCKYAGCVADLNANCPNELKVMGPGNNVVACKSACAHFN  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             TD+YCCRGA+S+P +C PT++S+ FK ACP AYS+A+DD TS  TCS  +Y V+FC
Sbjct  184   TDQYCCRGAYSTPQTCPPTDFSRIFKRACPDAYSYAYDDETSTFTCSGANYEVTFC  239



>ref|XP_011088584.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=334

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 152/237 (64%), Gaps = 13/237 (5%)
 Frame = -3

Query  1164  LLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSG  994
              LLA     +++     T +N C+ TVWPGI  N         GF L P  S  F AP+G
Sbjct  10    FLLAFHIFFRVAFGATFTFVNKCEYTVWPGILANAGSPTLDSTGFELPPDSSRTFIAPAG  69

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFY  826
             W+GR WGRTGC F   +GS    CQTG CG G  +C+G+G  PPAT+A+FTLG    DFY
Sbjct  70    WSGRFWGRTGCTF---SGSEPGSCQTGDCGSGQAECNGSGAAPPATLAEFTLGTGGLDFY  126

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C++ GC  DL   CPS+L +  G    AC+SAC  F +
Sbjct  127   DVSLVDGYNLPMIVEATGGSGMCASTGCVTDLNRVCPSELRVGGG---EACKSACEAFGS  183

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              EYCC G F+SPA+C P+ YS+ FK+ACP +YS+A+DDPTS  TCS  DY V+FC S
Sbjct  184   PEYCCSGTFNSPATCRPSVYSQMFKSACPRSYSYAYDDPTSTFTCSGADYTVTFCPS  240



>ref|XP_004501042.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=250

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 148/222 (67%), Gaps = 11/222 (5%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  TI N+C  T+WPG  + N  +  GDG F+L PG S    A SGW+GR WGRTGCNFD
Sbjct  27    TVFTIENHCNNTIWPGTLSGNGAALLGDGGFSLPPGSSVQLTAASGWSGRFWGRTGCNFD  86

Query  951   KSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG----ETDFYDVSLVDGFNLPIVV  784
                G+ +  C TG C G + C+G G PP T+A+FT+G    + DFYDVSLVDG+N+ + +
Sbjct  87    ---GAGNGNCITGDCAGGMNCNGGGTPPVTLAEFTIGSGNEDKDFYDVSLVDGYNVGMGI  143

Query  783   KPVNGKGNCSAVGCDKDLRENCPSDLAL-KSGGKTVACRSACNVFNTDEYCCRGAFSSPA  607
             +   G G+C   GC  DL  NCP++L + + GG  VAC+SAC  FNT E+CC G  SSP 
Sbjct  144   RATGGTGDCQYAGCVADLNGNCPAELQVTEEGGSVVACKSACAAFNTAEFCCTGEHSSPQ  203

Query  606   SCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             SC PT YS+ FK+ACP AYS+A+DD +S  TCS +DY ++FC
Sbjct  204   SCSPTKYSEMFKSACPSAYSYAYDDASSTCTCSGSDYHITFC  245



>ref|XP_010530276.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=246

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 150/222 (68%), Gaps = 10/222 (5%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPSGWNGRIWGRTGCNFDK  949
             T  T+ N C  T+WPGI + N  + GDG FAL P  S  F AP GW+GR W RTGCNFD 
Sbjct  23    TVFTLENRCSYTIWPGILSGNGAAFGDGGFALPPAASVQFPAPPGWSGRFWARTGCNFDG  82

Query  948   SNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL----GETDFYDVSLVDGFNLPIVVK  781
             S G+    C TG CGG LKCSG G PP ++A+FT+    GE DFYDVSLVDG+N+ I ++
Sbjct  83    STGTGR--CLTGDCGGTLKCSGGGIPPVSLAEFTIASSPGEKDFYDVSLVDGYNVGIGIR  140

Query  780   PVNGKGNCSAVGCDKDLRENCPSDLAL--KSGGKTVACRSACNVFNTDEYCCRGAFSSPA  607
             P++G G+C   GC  DL  NCP++L +   S G  VAC+SAC+   + E+CC G  ++P 
Sbjct  141   PISGVGDCRFSGCVADLNGNCPAELRVVDPSTGLVVACKSACSAXESPEFCCTGDHATPE  200

Query  606   SCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             +C PT +S  FKAACP AYS+A+DD TS  TCS +DY++SFC
Sbjct  201   TCPPTQFSAIFKAACPGAYSYAYDDATSTFTCSGSDYLISFC  242



>ref|XP_007209509.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
 gb|EMJ10708.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
Length=250

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 148/234 (63%), Gaps = 10/234 (4%)
 Frame = -3

Query  1161  LLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGW  991
             LL +   V++S  T IT+ N C   VWPGI  +      +  GF L P ++     P  W
Sbjct  16    LLFLHVLVEVSSATTITMHNKCSHPVWPGIQPSAGQPILARGGFTLPPNKAYTLRLPPLW  75

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVS  817
             +GR+WGR GC FD S       C TG CGG L CSG G  PPAT+A+ TLG E DFYDVS
Sbjct  76    SGRLWGRHGCAFDSSGRGR---CATGDCGGNLFCSGLGGTPPATLAEITLGNEQDFYDVS  132

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRSACNVFNTD  643
             LVDG+NL I ++P  G G CS  GC  DL   CP  L ++S    + VAC+SAC+ FN+ 
Sbjct  133   LVDGYNLAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSP  192

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              YCC G+F SP SC PT YSK FKAACP AYS+A+DDPTS+ TC+  +YVV+FC
Sbjct  193   RYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFC  246



>ref|XP_008393422.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=250

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 150/247 (61%), Gaps = 10/247 (4%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQS  1018
             T+ P +   LL +   V +S  T IT+ N C   VWPGI  +      +  GF L P ++
Sbjct  7     TSLPLMLPTLLFLYILVSVSSATTITMYNKCTHPVWPGIQPSAGQPILARGGFTLPPNKA  66

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                  P+ W+GR WGR GC FD S       C TG CGG L CSG G  PPAT+A+ TLG
Sbjct  67    HTLHLPALWSGRFWGRHGCTFDASGRGR---CATGDCGGNLFCSGLGGTPPATLAEITLG  123

Query  840   -ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACR  670
              E DFYDVSLVDG+NL I + P  G G CS  GC  DL   CP  L ++S    + VAC+
Sbjct  124   NEQDFYDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRQVVACK  183

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC+ FN+  YCC G+F SP SC PT YSK FKAACP AYS+A+DDPTS+ TC+  +++V
Sbjct  184   SACSAFNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNFLV  243

Query  489   SFCSSRN  469
             +FC    
Sbjct  244   TFCPHHR  250



>ref|NP_001031064.1| Thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE29691.1| Thaumatin-like protein [Arabidopsis thaliana]
Length=244

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 144/229 (63%), Gaps = 10/229 (4%)
 Frame = -3

Query  1131  SKCTNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             S  + +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC
Sbjct  19    SAASTVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSLQLPPLWSGRFWGRHGC  78

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIV  787
              FD+S       C TG CGG+L C+G G +PPAT+A+ TLG E DFYDVSLVDG+NL + 
Sbjct  79    TFDRSGRGH---CATGDCGGSLSCNGAGGEPPATLAEITLGPELDFYDVSLVDGYNLAMS  135

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSS  613
             + PV G G CS  GC  DL + CP  L ++S  G + VAC+SAC+ FN+ +YCC G F +
Sbjct  136   IMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSAFNSPQYCCTGLFGN  195

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             P SC PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC     
Sbjct  196   PQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRH  244



>emb|CDX72995.1| BnaC06g34430D [Brassica napus]
Length=265

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 148/229 (65%), Gaps = 10/229 (4%)
 Frame = -3

Query  1131  SKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGC  961
             S+ + +   N C  TVWPGI  ++      G GF L P ++     PS W+GR WGR GC
Sbjct  40    SEASTVIFYNKCTYTVWPGIQASSGQPLLGGGGFKLSPKRAYTLQLPSLWSGRFWGRHGC  99

Query  960   NFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIV  787
             +FD+S       C TG CGG+L C+G G  PPAT+A+ TLG + DFYDVSLVDG+NL + 
Sbjct  100   SFDRSG---RGRCATGDCGGSLLCNGAGGVPPATLAEITLGHDQDFYDVSLVDGYNLAMS  156

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSS  613
             + PV G G C+  GC  DL   CP  L ++S  G + VAC+SAC+ FN+  YCC G+F +
Sbjct  157   IMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGN  216

Query  612   PASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             P +C PT YSK FK ACP AYS+A+DDPTS+ TC+  +YVV+FC  R +
Sbjct  217   PQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPHRGR  265



>ref|XP_003539647.1| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=236

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 151/241 (63%), Gaps = 12/241 (5%)
 Frame = -3

Query  1185  AFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSA  1015
             A  +L LL++  + GV     T +T+ N C++ VWPGI T         DG  L PG++ 
Sbjct  2     ALKQLSLLVMLFSLGVD---ATVLTLQNKCRDIVWPGILTGAGRPELIDDGAELTPGKAI  58

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTL--  844
                AP GW+GRIWGR GC F  S GS +  C TG CGG LKC G G  PPA++A+FTL  
Sbjct  59    NITAPKGWSGRIWGRRGCTF-HSYGSGT--CITGDCGGKLKCDGVGGAPPASLAEFTLDS  115

Query  843   GETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSA  664
              E  FYDVSLV+G+NLP+ + P  G G C AV C  DL  NCP+ L +++    V C+SA
Sbjct  116   QEGGFYDVSLVNGYNLPVSIFPTGGSGQCKAVTCQSDLNRNCPNGLEVRNQSHIVGCKSA  175

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FN  EYCC G FS+P  C PT+YSK FKA+CP AYS+A+DD TS  TC   +Y++ F
Sbjct  176   CMAFNKPEYCCTGDFSNPRKCQPTSYSKVFKASCPQAYSYAYDDATSTFTCQGANYLIRF  235

Query  483   C  481
             C
Sbjct  236   C  236



>ref|XP_006341532.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=247

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 156/244 (64%), Gaps = 14/244 (6%)
 Frame = -3

Query  1182  FPKLFLLL---LAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQ  1021
             F  LFL+L      AS + +S  T +T+ N C   VWPGI  +      +  GF L P +
Sbjct  5     FLTLFLVLAFFTIFASHISVSA-TTMTLFNKCSHPVWPGIQPSAGKPILARGGFKLPPNK  63

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTL  844
             +   + P GW+GR+WGR GC FD +       C TG CGG+L C+G G  PPAT+A+ TL
Sbjct  64    AYRLSMPVGWSGRVWGRHGCAFDATGRGR---CATGDCGGSLFCNGIGGTPPATLAEITL  120

Query  843   G-ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKT--VAC  673
             G E DFYDVSLVDG+NL I V PV GKG CS  GC  DL   CP+ L ++S  K+  VAC
Sbjct  121   GNEQDFYDVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVAC  180

Query  672   RSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYV  493
             +SAC+ FN+  YCC G F +P +C PT YS+ FK ACP AYS+A+DDPTS+ TC+ + YV
Sbjct  181   KSACSAFNSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSISTCTGSSYV  240

Query  492   VSFC  481
             ++FC
Sbjct  241   LTFC  244



>ref|XP_004509365.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Cicer 
arietinum]
Length=305

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 153/237 (65%), Gaps = 12/237 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+L + +GV +S  T  T +N C  T+WPGI    +    GF LK G +  F AP+G
Sbjct  16    IFLLIL-VFTGVTVSA-TTFTFVNKCDHTIWPGILGKPDIGTTGFELKRGNTQTFQAPTG  73

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLG--ETDFY  826
             W+GR W RT C FD S   +   C TG CG G + C+G G  PPAT+A+FTLG    D+Y
Sbjct  74    WSGRFWARTACKFDYSGHGT---CSTGDCGSGEINCNGNGATPPATLAEFTLGIGSPDYY  130

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C   GC +D+   CPS+L ++ G    AC+SAC  F  
Sbjct  131   DVSLVDGYNLPMIVEANGGSGMCDMTGCGEDINRRCPSELKVEDGD---ACQSACGAFGK  187

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              EYCC G F SP+SC P+ YS+ FK+ACP +YS+AFDD TS  TC+A DY ++FC S
Sbjct  188   PEYCCSGVFGSPSSCTPSVYSQMFKSACPKSYSYAFDDATSTFTCTAADYTITFCPS  244



>ref|XP_008337996.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=253

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 155/241 (64%), Gaps = 16/241 (7%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFA  1006
              +  LLL I  GV  +     T  N C  TVWPGI  ++        GF L  G S VF 
Sbjct  18    HITFLLLIITRGVSAA---TFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQ  74

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--  838
             AP+GW+GR WGRTGC+FD   GS    C TG CG G L+C+G G  PPAT+A+FTLG   
Sbjct  75    APTGWSGRFWGRTGCSFD---GSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS  131

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              DFYDVSLVDG+NLP++V+   G G C++ GC  DL   CP++L  + GG   AC+SAC+
Sbjct  132   QDFYDVSLVDGYNLPMIVQGSGGSGACASTGCVTDLNRRCPAELKAEGGG---ACKSACD  188

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              F + EYCC GA+ SP++C P+ YS+ FK+ACP +YS+A+DD +S  TC+  DY + FC+
Sbjct  189   AFGSPEYCCNGAYGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCTGADYTIIFCA  248

Query  477   S  475
             S
Sbjct  249   S  249



>ref|XP_007160531.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
 gb|ESW32525.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
Length=248

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 151/241 (63%), Gaps = 10/241 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAP  1000
                LL+  S +K S  ++    N C   VWPGI  +      +  GF L P ++     P
Sbjct  11    LFFLLSTLSPLKASAASSFVFYNKCPHPVWPGIQPSAGKPILARGGFKLAPNRAYSLQLP  70

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFY  826
             + W+GR WGR GC FD S       C TG CGG+L C+G G  PPAT+A+FTLG E DFY
Sbjct  71    ALWSGRFWGRHGCAFDASGRGR---CATGDCGGSLYCNGIGGTPPATLAEFTLGNEQDFY  127

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVF  652
             DVSLVDG+NLPI + P  G G CS  GC  DL   CP  L ++S    + VAC+SAC+ F
Sbjct  128   DVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAF  187

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             N+ +YCC G++ SP +C PT YSK FK+ACP AYS+A+DDPTS+ TC+  +Y+++FC  R
Sbjct  188   NSPKYCCTGSYGSPQACKPTVYSKIFKSACPKAYSYAYDDPTSIATCTKANYLITFCPHR  247

Query  471   N  469
             +
Sbjct  248   H  248



>ref|XP_004509366.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Cicer 
arietinum]
Length=247

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 153/237 (65%), Gaps = 12/237 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSG  994
             +FLL+L + +GV +S  T  T +N C  T+WPGI    +    GF LK G +  F AP+G
Sbjct  16    IFLLIL-VFTGVTVSA-TTFTFVNKCDHTIWPGILGKPDIGTTGFELKRGNTQTFQAPTG  73

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLG--ETDFY  826
             W+GR W RT C FD S   +   C TG CG G + C+G G  PPAT+A+FTLG    D+Y
Sbjct  74    WSGRFWARTACKFDYSGHGT---CSTGDCGSGEINCNGNGATPPATLAEFTLGIGSPDYY  130

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNT  646
             DVSLVDG+NLP++V+   G G C   GC +D+   CPS+L ++ G    AC+SAC  F  
Sbjct  131   DVSLVDGYNLPMIVEANGGSGMCDMTGCGEDINRRCPSELKVEDGD---ACQSACGAFGK  187

Query  645   DEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              EYCC G F SP+SC P+ YS+ FK+ACP +YS+AFDD TS  TC+A DY ++FC S
Sbjct  188   PEYCCSGVFGSPSSCTPSVYSQMFKSACPKSYSYAFDDATSTFTCTAADYTITFCPS  244



>ref|XP_007046679.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOX90836.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=317

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 151/238 (63%), Gaps = 16/238 (7%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             L  +L+    GV  +     T IN C  TVWPGI  N         GF L  G S  F A
Sbjct  15    LSFILVLFLEGVTAA---TFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQA  71

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--T  835
             P+GW GR WGRTGCNFD S   S   C TG CG G ++C+G G  PPAT+A+FTLG    
Sbjct  72    PTGWAGRFWGRTGCNFDDSGHGS---CATGDCGSGEVECNGAGAIPPATLAEFTLGSGSQ  128

Query  834   DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNV  655
             DFYDVSLVDG+NLP++V+   G G C+  GC  DL + CPS+L +  GG   AC+SAC+ 
Sbjct  129   DFYDVSLVDGYNLPMIVEGSGGSGECAITGCVSDLNKKCPSELRIDGGG---ACKSACDA  185

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             F   EYCC GAF+SPA+C P+ YS+ FK+ACP +YS+AFDD TS  TC+  DY ++FC
Sbjct  186   FGNPEYCCSGAFNSPAACKPSMYSEVFKSACPKSYSYAFDDATSTFTCTGADYSITFC  243



>ref|NP_177640.1| thaumatin-like protein 3 [Arabidopsis thaliana]
 gb|AAG51927.1|AC013258_21 thaumatin-like protein; 28949-28112 [Arabidopsis thaliana]
 dbj|BAD43106.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|ABN04791.1| At1g75030 [Arabidopsis thaliana]
 gb|AEE35664.1| thaumatin-like protein 3 [Arabidopsis thaliana]
Length=246

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 159/242 (66%), Gaps = 12/242 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L  + I SG+  S  T  T+ N+C  TVWPG  + N+ + GDG F L PG S    AP+
Sbjct  9     ILFFVFITSGIADSA-TVFTLQNSCAYTVWPGTLSGNSITLGDGGFPLTPGASVQLTAPT  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET----DF  829
             GW+GR W RTGCNFD S   +   C TG CGG LKC+G G PPAT+A+FT+G +    DF
Sbjct  68    GWSGRFWARTGCNFDASGHGT---CVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK--SGGKTVACRSACNV  655
             YDVSLVDG+N+ + +KP  G GNC   GC  D+ E CPS+L +   + G   AC+SAC  
Sbjct  125   YDVSLVDGYNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSVAACKSACAA  184

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             F++ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD +S  TC+ ++Y+++FC +
Sbjct  185   FSSPEFCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCPT  244

Query  474   RN  469
             ++
Sbjct  245   QS  246



>ref|XP_007160788.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
 gb|ESW32782.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
Length=248

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 147/224 (66%), Gaps = 12/224 (5%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T   + N+C  TVWPG  + N  +     GFAL PG S  F+APSGW+GR WGRTGC FD
Sbjct  23    TVFYLENHCSHTVWPGTLSGNGAAVLGSGGFALPPGSSVHFSAPSGWSGRFWGRTGCTFD  82

Query  951   KSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGET-----DFYDVSLVDGFNLPIV  787
             +S   S   C TG C G LKC+G G PP T+ +FT G +     DFYDVSLVDG+N+ + 
Sbjct  83    ESGVGS---CATGDCAGGLKCNGGGVPPVTLVEFTTGSSGNGNKDFYDVSLVDGYNVGMG  139

Query  786   VKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTVACRSACNVFNTDEYCCRGAFSSP  610
             V+   G G+C   GC  DL   CP++L ++  GG  VAC+SAC  FNT E+CC G   +P
Sbjct  140   VRATGGTGDCRYAGCVADLNGACPTELQVRDGGGAVVACKSACAAFNTAEFCCTGDHGTP  199

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              +C PT+YS+ FK+ACP AYS+A+DD +S  TCS +DYV++FCS
Sbjct  200   QTCSPTHYSEIFKSACPTAYSYAYDDASSTFTCSNSDYVITFCS  243



>ref|NP_173261.1| Thaumatin-like protein [Arabidopsis thaliana]
 sp|P50699.2|TLPH_ARATH RecName: Full=Thaumatin-like protein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE29690.1| Thaumatin-like protein [Arabidopsis thaliana]
Length=243

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 143/226 (63%), Gaps = 10/226 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             + +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC FD
Sbjct  21    STVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSLQLPPLWSGRFWGRHGCTFD  80

Query  951   KSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKP  778
             +S       C TG CGG+L C+G G +PPAT+A+ TLG E DFYDVSLVDG+NL + + P
Sbjct  81    RSGRGH---CATGDCGGSLSCNGAGGEPPATLAEITLGPELDFYDVSLVDGYNLAMSIMP  137

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             V G G CS  GC  DL + CP  L ++S  G + VAC+SAC+ FN+ +YCC G F +P S
Sbjct  138   VKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSAFNSPQYCCTGLFGNPQS  197

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             C PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC     
Sbjct  198   CKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRH  243



>ref|XP_008444818.1| PREDICTED: thaumatin-like protein 1b [Cucumis melo]
Length=250

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 150/245 (61%), Gaps = 16/245 (7%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAV  1012
             S  F  LFL++       K       T +N C  TVWPGI  N      GF L PG +  
Sbjct  13    SVLFHSLFLIIF-----FKGVSGAGFTFVNRCDFTVWPGILGNPQLESTGFELSPGATRS  67

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGG-ALKCSGTGQ-PPATIADFTLGE  838
             F AP GW+GR WGRTGC+FD + G  +  CQT  CG   ++C+G G  PPAT+A+FT+G 
Sbjct  68    FQAPPGWSGRFWGRTGCSFDPATGQGN--CQTADCGSNQIECNGAGATPPATLAEFTIGG  125

Query  837   ----TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACR  670
                  DFYDVSLVDG+N+P+VV    G G C + GC  +L   CP++L     G+  ACR
Sbjct  126   GAGGQDFYDVSLVDGYNIPMVVDATGGSGECQSTGCAAELNRRCPAEL---RAGEGKACR  182

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  F   EYCC GA++SPA+C P+ YS+ FK+ACP +YS+AFDD TS  TCS  DY +
Sbjct  183   SACEAFGNPEYCCSGAYNSPAACKPSIYSEMFKSACPKSYSYAFDDATSTFTCSGADYTI  242

Query  489   SFCSS  475
             +FC S
Sbjct  243   TFCPS  247



>ref|XP_007202291.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
 gb|EMJ03490.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
Length=306

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 156/239 (65%), Gaps = 18/239 (8%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGIT----TNNNDSGDGFALKPGQSAVFAAP  1000
             LLLL IA GV  +     T  N C  TVWPGI     T   DS  GF L  G +  F AP
Sbjct  11    LLLLIIAKGVTGA---TFTFTNKCDFTVWPGILASAGTPKLDS-TGFELAKGSTRSFQAP  66

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TD  832
             +GW+GR WGRTGCNFD   GS    C TG CG G L+C+G G  PPAT+A+FTLG    D
Sbjct  67    TGWSGRFWGRTGCNFD---GSGHGSCSTGDCGSGQLECNGAGAAPPATLAEFTLGSGSQD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVF  652
             FYDVSLVDG+NLP++V+   G G C++ GC  DL   CP++L +  GG   AC+SAC+ F
Sbjct  124   FYDVSLVDGYNLPMIVEGSGGSGTCASTGCATDLNRRCPAELKVDGGG---ACKSACDAF  180

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              + EYCC G + SP++C P+ YS+ FK+ACP +YS+A+DD +S  TC+  DY ++FC+S
Sbjct  181   GSPEYCCNGDYGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCTGADYTITFCAS  239



>ref|XP_004512141.1| PREDICTED: thaumatin-like protein 1-like [Cicer arietinum]
Length=311

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 149/239 (62%), Gaps = 11/239 (5%)
 Frame = -3

Query  1179  PKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAP  1000
             P L  LL  I  GV +S     T +NNC  TVWPGI         GF L  G S  F AP
Sbjct  13    PILCFLLFVIFKGVSVSG-AKFTFLNNCDYTVWPGIYGKPEIGSTGFELTKGSSRTFQAP  71

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSG-TGQPPATIADFTLGE--TD  832
             +GW+GR W RTGC FD S   +   C T  CG G + C+G T  PPAT+A+FTLG    D
Sbjct  72    TGWSGRFWARTGCQFDNSGRGT---CSTADCGSGEISCNGATASPPATLAEFTLGSGSMD  128

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVF  652
             FYDVSLVDG+NLP+ V    G G+C+  GC  D+   CPS+L ++ GG   AC SAC  F
Sbjct  129   FYDVSLVDGYNLPMTVAASGGTGSCNITGCISDINRKCPSELRVEGGG---ACNSACGAF  185

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
                EYCC GAFS+P++C P+ YS+ FK+ACP +YS+A+DD TS  TCS  DY+++FC S
Sbjct  186   GKPEYCCNGAFSNPSTCKPSVYSQMFKSACPKSYSYAYDDATSTFTCSDADYIITFCPS  244



>ref|XP_007157907.1| hypothetical protein PHAVU_002G107800g [Phaseolus vulgaris]
 gb|ESW29901.1| hypothetical protein PHAVU_002G107800g [Phaseolus vulgaris]
Length=328

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 151/242 (62%), Gaps = 10/242 (4%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVF  1009
             T  P   L  +AI    +       T +N C  TVWPGI      +  GF L  G S  F
Sbjct  7     TPHPYEVLFAIAIFLVFRGVSGATFTFVNKCDYTVWPGILGTPELASTGFELAKGGSRSF  66

Query  1008  AAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLG--  841
              AP+GW+GR WGRTGC FD S   +   C T  CG G + C+G G  PPAT+A+FTLG  
Sbjct  67    QAPTGWSGRFWGRTGCQFDNSGRGT---CSTADCGSGEVNCNGAGATPPATLAEFTLGTG  123

Query  840   ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSAC  661
               D+YDVSLVDG+NLP++V P  G G+C+A GC +DL   CPS+L ++ G    AC+SAC
Sbjct  124   SMDYYDVSLVDGYNLPMIVAPRGGSGSCAATGCGEDLNRRCPSELRVEGGD---ACQSAC  180

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             + F   EYCC GAF +P++C P+ YS+ FK+ACP AYS+A+DD TS  TCS  DY ++FC
Sbjct  181   SAFGKPEYCCNGAFGNPSTCKPSTYSQIFKSACPKAYSYAYDDATSTFTCSGADYTITFC  240

Query  480   SS  475
              S
Sbjct  241   PS  242



>gb|EYU37936.1| hypothetical protein MIMGU_mgv1a009447mg [Erythranthe guttata]
Length=342

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 153/239 (64%), Gaps = 15/239 (6%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAP  1000
             F + L   S V        T +N C+ TVWPGI  N         GF L    S  F AP
Sbjct  14    FHIFLVFFSTVAFGA--TFTFVNKCQYTVWPGILANTGSPRLDSTGFELPQDSSRTFVAP  71

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TD  832
             +GW+GR WGRTGC F   +GS S  CQTG CG G  +C+G+G  PPAT+A+FTLG    D
Sbjct  72    AGWSGRFWGRTGCAF---SGSESVSCQTGDCGSGQAECNGSGAAPPATLAEFTLGTGGLD  128

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVF  652
             FYDVSLVDG+NLP++V+   G G C++ GC  DL   CPS+L +  G    AC+SAC  F
Sbjct  129   FYDVSLVDGYNLPMIVEASGGSGMCASTGCITDLNRACPSELRVGGG---EACKSACEAF  185

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
              + EYCC GAFS+PA+C P+ YS+ FK+ACP +YS+A+DDPTS  TC++ DY V+FC S
Sbjct  186   GSPEYCCSGAFSTPAACRPSVYSQMFKSACPRSYSYAYDDPTSTFTCASADYTVTFCPS  244



>ref|XP_011083577.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=311

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 164/249 (66%), Gaps = 16/249 (6%)
 Frame = -3

Query  1173  LFLLLL-AIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFA  1006
             LFL+L  ++ +GV  S     T++N C  TVWPGI +N      S  GFAL+ G+S V  
Sbjct  9     LFLILANSLVAGVYSS--ATFTLVNKCGFTVWPGILSNAGIAPLSTTGFALQTGESKVIN  66

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTL---G  841
             APS W GR WGRT C+ D +   S   C TG CG G L+C+G G  PPAT+A+FTL    
Sbjct  67    APSSWGGRFWGRTHCSQDSTGKFS---CVTGDCGSGKLECAGGGAAPPATLAEFTLDGDA  123

Query  840   ETDFYDVSLVDGFNLPIVVKPVNGKG-NCSAVGCDKDLRENCPSDLALKSG-GKTVACRS  667
               DFYDVSLVDG+NLP++V P  G G NCS  GC  DL   CPSDL + S  G+ VAC+S
Sbjct  124   GKDFYDVSLVDGYNLPMLVVPQGGSGVNCSNTGCVFDLNGACPSDLRVTSSDGEGVACKS  183

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F  D+YCCRGA+ +P +C P+ YS++FK ACP AYS+A+DD TS  TC+A DYV++
Sbjct  184   ACEAFRNDQYCCRGAYGTPDACKPSQYSQAFKNACPHAYSYAYDDRTSTFTCTAADYVIT  243

Query  486   FCSSRNQTQ  460
             FC S N +Q
Sbjct  244   FCPSPNTSQ  252



>gb|KHG07208.1| hypothetical protein F383_34305 [Gossypium arboreum]
Length=313

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 149/236 (63%), Gaps = 16/236 (7%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPS  997
             ++LL    GV  +     T IN C  TVWPGI  N         GF L  G S  F AP+
Sbjct  17    IILLVFLDGVTAA---TFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQAPT  73

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDF  829
             GW GR WGRTGCNFD S   S   C TG CG G ++C+G G  PPAT+A+FTLG    DF
Sbjct  74    GWAGRFWGRTGCNFDDSGHGS---CATGDCGSGEMECNGAGAIPPATLAEFTLGSGSQDF  130

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+NLP++V+   G G C+  GC  DL + CPS+L +  G    AC+SAC+ F 
Sbjct  131   YDVSLVDGYNLPMIVEGSGGSGECATTGCLTDLNKKCPSELKIDGG---AACKSACDAFG  187

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
               EYCC GA++SP +C P+ YS+ FK+ACP +YS+AFDD TS  TCS  DY ++FC
Sbjct  188   KPEYCCSGAYNSPTACKPSMYSQVFKSACPKSYSYAFDDATSTFTCSGADYAITFC  243



>ref|XP_008352435.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=318

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 156/241 (65%), Gaps = 16/241 (7%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFA  1006
              +  LLL I  GV  +     T  N C  TVWPGI  ++        GF L  G S VF 
Sbjct  18    HITFLLLIITRGVSAA---TFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQ  74

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--  838
             AP+GW+GR WGRTGC+FD   GS    C TG CG G L+C+G G  PPAT+A+FTLG   
Sbjct  75    APTGWSGRFWGRTGCSFD---GSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS  131

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              DFYDVSLVDG+NLP++V+   G G C++ GC  DL   CP++L  + GG   AC+SAC+
Sbjct  132   QDFYDVSLVDGYNLPMIVQGSGGSGACASTGCVTDLNRRCPAELKAEGGG---ACKSACD  188

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              F + EYCC GA+ SP++C P+ YS+ FK+ACP +YS+A+DD +S  TC+  DY ++FC+
Sbjct  189   AFGSPEYCCNGAYGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCTDADYTITFCA  248

Query  477   S  475
             S
Sbjct  249   S  249



>ref|XP_010459436.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 143/226 (63%), Gaps = 10/226 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             + +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC+FD
Sbjct  21    STVIFYNKCKHPVWPGIQPSAGQNILAGGGFKLPANKAHTLQLPPLWSGRFWGRHGCSFD  80

Query  951   KSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKP  778
             +S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL + + P
Sbjct  81    RSGRGR---CATGDCGGSLSCNGAGGSPPATLAEITLGPELDFYDVSLVDGYNLAMSIMP  137

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             V G G CS  GC  DL + CP  L ++S  G + VAC+SAC+ FN+ +YCC G F +P S
Sbjct  138   VKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSAFNSPQYCCTGLFGNPQS  197

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             C PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC     
Sbjct  198   CKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRH  243



>ref|XP_006390358.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
 gb|ESQ27644.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
Length=247

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 151/239 (63%), Gaps = 13/239 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAPS  997
              L  + I SG+ +S  T  T+ N C  TVWPGI + N+N  GDG F L PG S    +P 
Sbjct  9     ILFFVFITSGIAVSA-TVFTLENLCPYTVWPGILSGNSNTLGDGGFPLTPGASVQLTSPP  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE----TDF  829
              W+GR W RTGCNFD S   +   C TG CGG LKC G G PPAT+A+FT+G      DF
Sbjct  68    RWSGRFWARTGCNFDSSGRGN---CVTGDCGGVLKCIGGGVPPATLAEFTVGSGESGMDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLAL---KSGGKTVACRSACN  658
             YDVSLVDG+N+ + +KP  G G+C   GC  D+ E CPS+L +    + G   AC+SAC 
Sbjct  125   YDVSLVDGYNVQMGIKPQGGSGDCKYAGCVSDINEICPSELRIMDPNNNGSVAACKSACA  184

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
              FN+ E+CC GA S+P +C PT YS  FK ACP AYS+A+DD TS  TCS   Y+++FC
Sbjct  185   AFNSPEFCCTGAHSTPMTCSPTQYSAMFKNACPSAYSYAYDDATSTFTCSGASYLITFC  243



>ref|XP_009785059.1| PREDICTED: thaumatin-like protein isoform X2 [Nicotiana sylvestris]
Length=247

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 151/241 (63%), Gaps = 11/241 (5%)
 Frame = -3

Query  1179  PKLFLLLLAI-ASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAV  1012
             P   L  LAI AS +     T +T+ N C   VWPGI  +      +  GF L P ++  
Sbjct  7     PFFILASLAILASHISEVTATTMTMYNRCSHPVWPGIQPSAGKPILARGGFKLLPNKAYK  66

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-E  838
              + P+GW+GR+WGR GC+FD S       C TG CGGAL C+G G  PPAT+A+ TLG +
Sbjct  67    LSLPAGWSGRVWGRHGCSFDASGHGR---CATGDCGGALFCNGIGGTPPATLAEITLGSD  123

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGK--TVACRSA  664
              DFYDVSLVDG+NL I + P  GKG CS  GC  DL   CP  L +KS  K   VAC+SA
Sbjct  124   QDFYDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSA  183

Query  663   CNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSF  484
             C  FN+  YCC G F +P SC PT YS+ FK ACP AYS+A+DDPTS+ TC+ + Y+++F
Sbjct  184   CAAFNSPRYCCTGTFGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYLLTF  243

Query  483   C  481
             C
Sbjct  244   C  244



>emb|CDP07567.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 152/225 (68%), Gaps = 12/225 (5%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  T+ N+C  TVWPG  + N  +  GDG FAL PG +   +AP+GW+GR W RTGCNFD
Sbjct  27    TVFTLQNSCSHTVWPGTLSGNGAAILGDGGFALPPGATIQLSAPAGWSGRFWARTGCNFD  86

Query  951   KSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE----TDFYDVSLVDGFNLPIVV  784
              S   S   C TG CGG LKC+G G PP ++A+FT+       DFYDVSLVDG+N+ + +
Sbjct  87    DSGHGS---CSTGDCGG-LKCTGGGVPPVSLAEFTIANGDNAKDFYDVSLVDGYNVGLGI  142

Query  783   KPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTV-ACRSACNVFNTDEYCCRGAFSSPA  607
             +P  G G+C+  GC  DL +NCP +L +    K V AC+SAC+ FNT +YCC G  S+P 
Sbjct  143   RPSGGLGDCNYSGCVADLNQNCPEELQVTDSDKVVVACKSACDAFNTPQYCCTGDHSTPE  202

Query  606   SCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSR  472
             +C PTNYS+ FK ACP AYS+A+DD +S  TC+ +DY+++FC +R
Sbjct  203   TCPPTNYSRKFKEACPAAYSYAYDDASSTFTCAGSDYLITFCPTR  247



>ref|XP_011016697.1| PREDICTED: thaumatin-like protein 1b [Populus euphratica]
Length=325

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 150/234 (64%), Gaps = 13/234 (6%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAVFAAPSGW  991
             FL LL I  GV  +     T +N C  +VWPGI  +      GF L+ G S  F AP+GW
Sbjct  17    FLSLLFIFEGVSGA---TFTFVNKCDFSVWPGILGSPELDSTGFELRKGSSRSFQAPTGW  73

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFYD  823
             +GR WGR+GCNFD S   S   C T  CG G ++C+G G  PPAT+A+FTLG    DFYD
Sbjct  74    SGRFWGRSGCNFDSSGHGS---CATADCGSGQVECNGAGATPPATLAEFTLGSGSQDFYD  130

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTD  643
             VSLVDG+NLP++V+   G G C++ GC  DL   CP++L  + G    ACRSAC  F   
Sbjct  131   VSLVDGYNLPMIVEVSGGSGECASTGCVTDLNRKCPTELRTEGGS---ACRSACEAFGKP  187

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             EYCC G ++SPASC P+ YS+ FK+ACP +YS+A+DD TS  TC+  DY ++FC
Sbjct  188   EYCCSGEYNSPASCKPSMYSQVFKSACPKSYSYAYDDATSTFTCTGADYTITFC  241



>gb|KFK30232.1| hypothetical protein AALP_AA7G234800 [Arabis alpina]
Length=247

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 157/236 (67%), Gaps = 19/236 (8%)
 Frame = -3

Query  1164  LLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSG  994
             +LL +  GVK   CT  T +N C  TVWPGI +          GF L    S    AP+G
Sbjct  18    ILLLLRDGVK---CTTFTFVNKCDFTVWPGILSGAGSPKLDTTGFELSKDTSRTLRAPAG  74

Query  993   WNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTG-QPPATIADFTLG---ETDF  829
             W+GR WGRTGCNFD +  SS++ C TG CG G ++C+G+G +PP T+A+FTLG     DF
Sbjct  75    WSGRFWGRTGCNFDGT--SSTTGCSTGDCGSGEIECNGSGAEPPTTLAEFTLGISGSLDF  132

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+NLP++V+   G G+C+  GC  DL +NCP++L  K+G   +ACRSAC  F 
Sbjct  133   YDVSLVDGYNLPMIVE---GSGSCATTGCVSDLNKNCPTELKAKNG---LACRSACEAFR  186

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             T EYCC G + SP +C P+ YS++FK+ACP +YS+A+DD TS  TCS  DY ++FC
Sbjct  187   TPEYCCSGLYGSPDTCKPSMYSQAFKSACPKSYSYAYDDATSTFTCSDADYTITFC  242



>ref|XP_010416366.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 154/236 (65%), Gaps = 11/236 (5%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS-GDG-FALKPGQSAVFAAPS  997
              L L+ I SG+ +S  T  TI NNC  TVW G         GDG F L PG S    AP+
Sbjct  9     ILFLVFITSGIAVSA-TVFTIKNNCPTTVWAGTLAGQGPKLGDGGFELTPGASRQLTAPA  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL---GETDFY  826
             GW+GR W RTGC+FD   G+ +  C TG CGG L+C+G G PP ++A+FTL   G  DFY
Sbjct  68    GWSGRFWARTGCSFD---GAGNGRCVTGDCGG-LRCNGGGVPPVSLAEFTLVGDGGKDFY  123

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDL-ALKSGGKTVACRSACNVFN  649
             DVSLVDG+N+ + ++P  G G+C   GC  DL  NCP++L  +      VAC++AC  F 
Sbjct  124   DVSLVDGYNVKLGIRPSGGSGDCKYAGCVADLNANCPNELKVMGPQNNVVACKNACEAFK  183

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             TD+YCCRGA+S+P +CLPT++S+ FK ACP AYS+A+DD TS  TC+  +Y V+FC
Sbjct  184   TDQYCCRGAYSTPQTCLPTDFSRIFKRACPDAYSYAYDDETSTFTCTGANYEVTFC  239



>emb|CDY19198.1| BnaC05g13990D [Brassica napus]
Length=242

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 151/241 (63%), Gaps = 16/241 (7%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPS  997
              LL++ AS       + +  +N C+  VWPGI      N  +G GF L   ++     P 
Sbjct  11    FLLISHASA------STVVFLNKCRYPVWPGIQPSAGQNILAGGGFKLPANKAYTLQLPP  64

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYD  823
              W+GR WGR GC FD+S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYD
Sbjct  65    LWSGRFWGRHGCTFDRSG---RGRCATGDCGGSLTCNGAGGSPPATLAEITLGQELDFYD  121

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFN  649
             VSLVDG+NL + + PV G+G CS  GC  DL   CP  L ++S  G + +AC+SAC+ FN
Sbjct  122   VSLVDGYNLAMSIMPVKGRGQCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSAFN  181

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             + +YCC G F +P +C PT+YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC    
Sbjct  182   SPQYCCTGTFGNPLTCRPTSYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHR  241

Query  468   Q  466
             +
Sbjct  242   R  242



>ref|XP_004235810.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=245

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 149/237 (63%), Gaps = 10/237 (4%)
 Frame = -3

Query  1170  FLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAP  1000
             FLLL            T +T+ N C   VWPGI  +      +  GF L P ++     P
Sbjct  9     FLLLAFFTIFASHISATTMTLYNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAYRLNMP  68

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFY  826
             +GW+GR+WGR GC FD +       C TG CGG+L C+G G  PPAT+A+ TLG E DFY
Sbjct  69    AGWSGRVWGRHGCAFDAAGRGR---CATGDCGGSLFCNGIGGTPPATLAEITLGNEQDFY  125

Query  825   DVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKT--VACRSACNVF  652
             DVSLVDG+NL I V PV GKG CS  GC  DL   CP+ L ++S  K+  VAC+SAC+ F
Sbjct  126   DVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVACKSACSAF  185

Query  651   NTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             N+  YCC G F +P +C PT YS+ FK ACP AYS+A+DDPTS+ TC+ + YV++FC
Sbjct  186   NSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYVLTFC  242



>ref|XP_008240157.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=250

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 148/238 (62%), Gaps = 10/238 (4%)
 Frame = -3

Query  1161  LLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGW  991
             LL +   V++S  T IT+ N C   VWPGI  +      +  GF L P ++     P  W
Sbjct  16    LLFLHVLVEVSSATTITMHNKCSHPVWPGIQPSAGQPILARGGFTLPPNKAYTLHLPPLW  75

Query  990   NGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVS  817
             +GR+WGR GC FD S       C TG CGG L CSG G  PPAT+A+ TLG + DFYDVS
Sbjct  76    SGRLWGRHGCAFDASGRGR---CATGDCGGNLFCSGPGGPPPATLAEITLGNDQDFYDVS  132

Query  816   LVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRSACNVFNTD  643
             LVDG+NL I ++P  G G CS  GC  DL   CP  L ++S    + VAC+SAC+ FN+ 
Sbjct  133   LVDGYNLAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSP  192

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
              YCC G+F SP SC PT YSK FKAACP AYS+A+DDPTS+ TC+  +YVV+FC    
Sbjct  193   RYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFCPHHR  250



>ref|XP_006390359.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
 gb|ESQ27645.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
Length=243

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 145/234 (62%), Gaps = 9/234 (4%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQSAVFAAPS  997
             LL + I SGV +S  T  T+ N C  TVWPGI T N     GDG   L    S    AP 
Sbjct  10    LLFVFITSGVAVSA-TVFTLENLCPYTVWPGILTGNGGKALGDGGLELATDASVQLTAPP  68

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLGETDFYDV  820
             GW GR W RTGC FD +       C TG CGG LKC+G G  PP T+A+FT+G  DFYDV
Sbjct  69    GWTGRFWARTGCKFDSTG---HGICVTGDCGGVLKCAGAGGVPPVTLAEFTVGGKDFYDV  125

Query  819   SLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVA-CRSACNVFNTD  643
             SLVDG+N+ + +KP  G G+C   GC  DL   CP +L +K     VA C+SAC  FN +
Sbjct  126   SLVDGYNVKMGIKPQGGSGDCRYAGCVADLNAICPEELRVKDQQNNVAACKSACAAFNKE  185

Query  642   EYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             EYCC GA S+P +C PTNYS +FK ACP AYS+A+DD TS  TCS   Y+++FC
Sbjct  186   EYCCSGAHSTPETCAPTNYSMTFKKACPSAYSYAYDDATSTFTCSGASYLITFC  239



>ref|XP_003530957.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=253

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 152/242 (63%), Gaps = 13/242 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAA  1003
             +F L L +   +K+S  +++   N C+  VWPGI  +      +  GF L P ++     
Sbjct  18    IFFLTLTV---LKVSASSSVIFYNKCQHPVWPGIQPSAGKPVLARGGFKLAPNRAYSLQL  74

Query  1002  PSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDF  829
             P+ W+GR WGR GC+FD         C TG CGG+L C+G G  PPAT+A+FTLG E DF
Sbjct  75    PALWSGRFWGRHGCSFDAGGRGR---CATGDCGGSLFCNGIGGSPPATLAEFTLGNEQDF  131

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNV  655
             YDVSLVDG+NLPI + P  G G CS  GC  DL   CP  L ++S    + VAC+SAC+ 
Sbjct  132   YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSA  191

Query  654   FNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             FN+  YCC G++ SP +C PT YSK FK ACP AYS+A+DDPTS+ TC+  +Y+V+FC  
Sbjct  192   FNSPRYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYLVTFCPH  251

Query  474   RN  469
             R 
Sbjct  252   RR  253



>ref|XP_008801393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 143/246 (58%), Gaps = 10/246 (4%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQSAVFA  1006
             +LF  +L +    +LS C   TI NNC   +WPG             GF L+PG+S   A
Sbjct  6     QLFASVLVLLLSFQLSMCCTFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIA  65

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG---E  838
             AP GW+GR W RTGC FD     +   CQTG C G ++C G G  PPAT+ + TLG   +
Sbjct  66    APPGWSGRFWARTGCKFDAEGAGT---CQTGDCAGRMECGGAGALPPATLFEITLGKGKD  122

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              DFYDVSLVDG+NLPI   P   +G C+  GC  DL   CP +L +   G  VAC+SAC 
Sbjct  123   RDFYDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQVDGDGGVVACKSACE  182

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              F  D+YCC G F +P +C P+ YS  FK ACP AYS+A+DD TS  TC A DY + FC 
Sbjct  183   AFGLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCP  242

Query  477   SRNQTQ  460
             + N  +
Sbjct  243   NANGMR  248



>ref|XP_010061079.1| PREDICTED: thaumatin-like protein 1b [Eucalyptus grandis]
Length=321

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 163/255 (64%), Gaps = 16/255 (6%)
 Frame = -3

Query  1182  FPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAV  1012
             +P + L  L I++    +  T  T++N C+ TVWPG+  N ++   S  GFAL+ G+S  
Sbjct  5     WPSIPLPWLLISAMFLAADATTFTLVNKCEYTVWPGVLANADEPPLSTTGFALQKGESRS  64

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTL--  844
              AAP+GW GR W RT C  D + G  S  C TG CG G L+C G G  PPAT+A+F L  
Sbjct  65    LAAPAGWGGRFWARTRCAQDPAAGELS--CLTGDCGSGQLECGGRGAAPPATLAEFKLYG  122

Query  843   -GETDFYDVSLVDGFNLPIVVKPVNGK---GNCSAVGCDKDLRENCPSDL---ALKSGGK  685
              G  DF+DVSLVDGFNLP++V P  GK   GNC++VGC  DL   CPS+L   A   G  
Sbjct  123   DGGLDFFDVSLVDGFNLPMLVAPQGGKEGRGNCTSVGCTGDLNAACPSELRVAAGGGGSG  182

Query  684   TVACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSA  505
               AC+SAC+ F   +YCC GA+ SP +C PT YS++FK+ACP AYS+A+DD TS  TC+ 
Sbjct  183   VAACKSACDAFRRPQYCCSGAYGSPQACRPTPYSEAFKSACPQAYSYAYDDATSTFTCAG  242

Query  504   TDYVVSFCSSRNQTQ  460
              DYV++FC S N +Q
Sbjct  243   ADYVITFCPSPNASQ  257



>emb|CAN80000.1| hypothetical protein VITISV_043971 [Vitis vinifera]
Length=634

 Score =   236 bits (601),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 141/216 (65%), Gaps = 8/216 (4%)
 Frame = -3

Query  1113  TIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKSN  943
             T+ N C E++WPGI   +        GF L+PG+S    AP GW+GR WGR  C+FD S 
Sbjct  422   TLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESVDITAPEGWSGRFWGRRRCSFDDSG  481

Query  942   GSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE-TDFYDVSLVDGFNLPIVVKPVNG  769
               S   C TG CGG LKC+G G  PPAT+A+FTL    DFYDVSLVDG+N+P+ + P  G
Sbjct  482   KGS---CVTGDCGGVLKCAGAGGAPPATLAEFTLDSPVDFYDVSLVDGYNMPVSILPSGG  538

Query  768   KGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPASCLPTN  589
              G C  V C  DL ++CP DL +   G+ VAC SAC  FN  EYCC GAFS+P +C PT 
Sbjct  539   SGECKTVRCVSDLNQHCPKDLQVLRDGRVVACNSACMAFNKPEYCCSGAFSTPDTCKPTE  598

Query  588   YSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
             YSK FKA+CP +YS+A+DDPTS  TC   +Y++ FC
Sbjct  599   YSKVFKASCPTSYSYAYDDPTSTFTCKGANYLIRFC  634



>ref|XP_010097569.1| hypothetical protein L484_017379 [Morus notabilis]
 gb|EXB69101.1| hypothetical protein L484_017379 [Morus notabilis]
Length=249

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 148/240 (62%), Gaps = 10/240 (4%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPS  997
             L L  I     +S  T IT+ N CK  VWPGI  +      +  GF L P ++     P 
Sbjct  13    LFLSHILVHQVVSASTTITLYNKCKHPVWPGIQPSAGQPILARGGFKLPPNKAYALRLPP  72

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYD  823
              W+GR+WGR GC FD         C TG CGG+L C+G G  PPAT+A+ TLG + DFYD
Sbjct  73    LWSGRLWGRHGCAFDAHGRGR---CATGDCGGSLFCAGAGGAPPATLAEITLGNDQDFYD  129

Query  822   VSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACRSACNVFN  649
             VSLVDG+NL I + P  G G CS  GC  DL   CP+ L ++SG   + VAC+SAC+ FN
Sbjct  130   VSLVDGYNLAISITPSKGSGKCSYAGCVSDLNVMCPASLQVRSGDGRRVVACKSACSAFN  189

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             +  YCC G+F SP SC PT YS+ FKAACP AYS+A+DDPTS+ TC+  +Y+V+FC    
Sbjct  190   SPRYCCTGSFGSPQSCKPTAYSRIFKAACPKAYSYAYDDPTSIATCTKGNYLVTFCPHHR  249



>ref|XP_010498212.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 143/226 (63%), Gaps = 10/226 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             + +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC+FD
Sbjct  21    STVIFYNKCKHPVWPGIQPSAGQNILAGGGFKLPANKAHTLQLPPLWSGRFWGRHGCSFD  80

Query  951   KSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKP  778
             +S       C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL + + P
Sbjct  81    RSGRGR---CATGDCGGSLSCNGAGGSPPATLAEITLGPELDFYDVSLVDGYNLAMSIMP  137

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             V G G CS  GC  DL + CP  L ++S  G + +AC+SAC+ FN+ +YCC G F +P S
Sbjct  138   VKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVLACKSACSAFNSPQYCCTGLFGNPQS  197

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             C PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC     
Sbjct  198   CKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRH  243



>ref|XP_008801392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Phoenix 
dactylifera]
Length=292

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 143/246 (58%), Gaps = 10/246 (4%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSG---DGFALKPGQSAVFA  1006
             +LF  +L +    +LS C   TI NNC   +WPG             GF L+PG+S   A
Sbjct  6     QLFASVLVLLLSFQLSMCCTFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIA  65

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQ-PPATIADFTLG---E  838
             AP GW+GR W RTGC FD     +   CQTG C G ++C G G  PPAT+ + TLG   +
Sbjct  66    APPGWSGRFWARTGCKFDAEGAGT---CQTGDCAGRMECGGAGALPPATLFEITLGKGKD  122

Query  837   TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACN  658
              DFYDVSLVDG+NLPI   P   +G C+  GC  DL   CP +L +   G  VAC+SAC 
Sbjct  123   RDFYDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQVDGDGGVVACKSACE  182

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              F  D+YCC G F +P +C P+ YS  FK ACP AYS+A+DD TS  TC A DY + FC 
Sbjct  183   AFGLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCP  242

Query  477   SRNQTQ  460
             + N  +
Sbjct  243   NANGMR  248



>ref|XP_008803099.1| PREDICTED: thaumatin-like protein [Phoenix dactylifera]
Length=245

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 143/240 (60%), Gaps = 11/240 (5%)
 Frame = -3

Query  1176  KLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFA  1006
             KL   LL I   + LS    + ++NNC  ++WPG   N       G GF L   Q   F 
Sbjct  5     KLNFFLLWICLSITLSCEIQLILVNNCNHSIWPGTLGNAGHPTPEGGGFHLDAFQETFFD  64

Query  1005  APSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSG-TGQPPATIADFTLGET--  835
              P+GW+GRIW R GC+FDK        C+TG C   L C G +G PPAT+ + T G    
Sbjct  65    VPTGWSGRIWARKGCSFDKQGKGC---CETGDCSRLLHCQGMSGTPPATVVEMTFGTARS  121

Query  834   --DFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSAC  661
                +YDVSLVDGFNLP+ +KP+ G+  C A GC+ DL   CPS    K  GK V CRSAC
Sbjct  122   PLHYYDVSLVDGFNLPVTMKPIGGRNGCGAAGCEVDLNVCCPSRFEEKRQGKVVGCRSAC  181

Query  660   NVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFC  481
                  D+YCC G +SSP SC PT +S+ FK+ CP AYSFA+DDPTS+ TC A+ Y+++FC
Sbjct  182   LALKRDKYCCTGNYSSPNSCKPTLFSRIFKSVCPHAYSFAYDDPTSLKTCRASRYLITFC  241



>ref|XP_003563464.1| PREDICTED: thaumatin-like protein [Brachypodium distachyon]
Length=248

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 144/228 (63%), Gaps = 14/228 (6%)
 Frame = -3

Query  1119  NITIINNCKETVWPGITTNNND---SGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDK  949
              + + N C ETVWPGI         +  G  L P ++     P+GW+GR+WGR GC+FD 
Sbjct  24    TMALYNRCGETVWPGIQPGAGKEILARGGLQLLPNRATSIRLPAGWSGRVWGRQGCSFDA  83

Query  948   SNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGET-----DFYDVSLVDGFNLPIV  787
             +       C TG CGGAL C+G G  PPAT+A+ TLG +     DFYDVSLVDG+N+PI 
Sbjct  84    AG---RGKCATGDCGGALYCNGAGGAPPATLAEITLGASGSTSQDFYDVSLVDGYNIPIA  140

Query  786   VKPVNGKG-NCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSP  610
             + P +G G NC   GC  DL   CP+ LA++ GG+ V CRSAC  + + +YCC G F  P
Sbjct  141   MTPYHGSGTNCLPAGCVSDLNRVCPAGLAVRGGGRVVGCRSACAAYGSPQYCCTGQFGGP  200

Query  609   ASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCS-ATDYVVSFCSSRN  469
              +C PT YSK FK ACP AYS+A+DDPTS++TC+  T YVV+FC  R 
Sbjct  201   QTCKPTAYSKLFKQACPKAYSYAYDDPTSILTCAPGTSYVVTFCPHRR  248



>ref|XP_010459595.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=249

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 148/243 (61%), Gaps = 14/243 (6%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGI-TTNNNDSGDG-FALKPGQSAVFAAP  1000
             LF+  +     + +   T  T+ N+C  TVWPGI T+     GDG  AL  G S    A 
Sbjct  10    LFISCIIATCTISIVSGTVFTLTNHCSSTVWPGILTSKGTQLGDGGLALASGSSVTLTAS  69

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLGE-----  838
              GW+GR WGRTGCNFD S       C TG CGG LKC+G G  PPAT+A+FT+G      
Sbjct  70    PGWSGRFWGRTGCNFDASG---VGKCVTGDCGGKLKCAGAGGAPPATLAEFTIGTPGPRS  126

Query  837   ---TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
                 DFYDVSLVDG+N+ + + P  G GNC   GC  D+   CP++L +      VAC+S
Sbjct  127   NSVQDFYDVSLVDGYNVQMKITPQGGSGNCITAGCVSDVNAICPNELRVTGAAGVVACKS  186

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  FN  EYCC GAFS P +C PT+YSK FK ACP AYS+A+DD +S  TC+  +Y++S
Sbjct  187   ACEAFNKPEYCCTGAFSKPETCPPTSYSKIFKGACPTAYSYAYDDASSTFTCTNANYLIS  246

Query  486   FCS  478
             FC+
Sbjct  247   FCA  249



>ref|XP_009356044.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=250

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 148/247 (60%), Gaps = 10/247 (4%)
 Frame = -3

Query  1188  TAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNND---SGDGFALKPGQS  1018
             T+ P +    L +   V +S  T +T+ N C   VWPGI  +      +  GF L P ++
Sbjct  7     TSLPIMLSTFLFLHVLVSVSSATTLTMYNKCTHPVWPGIQPSAGQPLLARGGFTLPPNKA  66

Query  1017  AVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG  841
                  P  W+GR WGR GC FD S       C TG CGG L CSG G  PPAT+A+ TLG
Sbjct  67    HTLHLPRLWSGRFWGRHGCAFDASGRGR---CATGDCGGNLFCSGLGGTPPATLAEITLG  123

Query  840   -ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGG--KTVACR  670
              + DFYDVSLVDG+NL I + P  G G CS  GC  DL   CP  L ++S    + VAC+
Sbjct  124   NDQDFYDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACK  183

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC+ FN+  YCC G+F SP SC PT YSK FKAACP AYS+A+DDPTS+ TC+  +Y+V
Sbjct  184   SACSAFNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLV  243

Query  489   SFCSSRN  469
             +FC    
Sbjct  244   TFCPHHR  250



>gb|KGN62685.1| hypothetical protein Csa_2G368860 [Cucumis sativus]
Length=305

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 149/245 (61%), Gaps = 16/245 (7%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDSGDGFALKPGQSAV  1012
             S  F  LFL++       K       T +N C  T+WPGI  N      GF L PG    
Sbjct  13    SVLFHSLFLIIF-----FKGVSGAGFTFVNRCDFTIWPGILGNPKLESTGFELSPGAVRS  67

Query  1011  FAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGG-ALKCSGTGQ-PPATIADFTLGE  838
             F AP GW+GR WGRTGC+FD + G  +  CQT  CG   ++C+G G  PPAT+A+FT+G 
Sbjct  68    FQAPPGWSGRFWGRTGCSFDPATGQGN--CQTADCGSNQIECNGAGATPPATLAEFTIGG  125

Query  837   ----TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACR  670
                  DFYDVSLVDG+N+P+VV    G G C + GC  +L   CPS+L     G+  ACR
Sbjct  126   GAGGQDFYDVSLVDGYNIPMVVDATGGSGACQSTGCAAELNRRCPSEL---RAGEGKACR  182

Query  669   SACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVV  490
             SAC  F   EYCC GA++SPA+C P+ YS+ FK+ACP +YS+AFDD TS  TCS  DY +
Sbjct  183   SACEAFGNPEYCCSGAYNSPAACKPSIYSEMFKSACPKSYSYAFDDATSTFTCSGADYTI  242

Query  489   SFCSS  475
             +FC S
Sbjct  243   TFCPS  247



>gb|EPS57841.1| hypothetical protein M569_16976, partial [Genlisea aurea]
Length=300

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 146/223 (65%), Gaps = 14/223 (6%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             T  T +N C+ TVWPGI  N   +     GF L+ G S  F AP GW+GR WGRTGC F 
Sbjct  10    TTFTFVNRCEYTVWPGILANAGSARLDSAGFELRQGSSRSFVAPVGWSGRFWGRTGCEFS  69

Query  951   KSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDFYDVSLVDGFNLPIVV  784
               +GS    C+TG CG G  +C+G G  PP T+ +FTLG    DFYDVSLVDG+NLP++V
Sbjct  70    GESGS----CRTGDCGSGQPECNGAGAAPPVTLVEFTLGTGGLDFYDVSLVDGYNLPVIV  125

Query  783   KPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
                 G G C++ GC  DL + CPS+L     G   AC+SAC  F + EYCC GA++SPA+
Sbjct  126   DATGGSGTCASTGCVADLNQACPSEL---RSGDGEACKSACEAFGSPEYCCSGAYNSPAA  182

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             C P+ YS+ FK+ACP +YSFA+DDPTS  TC+A DY V+FC S
Sbjct  183   CRPSVYSQMFKSACPKSYSFAYDDPTSTFTCAAADYTVTFCPS  225



>gb|AAA32875.1| thaumatin-like protein [Arabidopsis thaliana]
 prf||2106421A thaumatin-like protein
Length=243

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 143/226 (63%), Gaps = 10/226 (4%)
 Frame = -3

Query  1122  TNITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFD  952
             + +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC FD
Sbjct  21    STVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSLQLPPLWSGRFWGRHGCTFD  80

Query  951   KSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKP  778
             +S       C TG CGG+L C+G G +PPAT+A+ TLG E DFYDVSLVDG+NL + + P
Sbjct  81    RSGRGH---CATGDCGGSLSCNGAGGEPPATLAEITLGPELDFYDVSLVDGYNLAMSIMP  137

Query  777   VNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPAS  604
             V G G C+  GC  DL + CP  L ++S  G + VAC+SAC+ FN+ +YCC G F +P S
Sbjct  138   VKGSGQCTYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSAFNSPQYCCTGLFGNPQS  197

Query  603   CLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             C PT YSK FK ACP AYS+A+D+PTS+ TCS  +Y+V+FC     
Sbjct  198   CKPTAYSKIFKVACPKAYSYAYDEPTSIATCSKANYIVTFCPHHRH  243



>ref|XP_010026231.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW88067.1| hypothetical protein EUGRSUZ_A00487 [Eucalyptus grandis]
Length=248

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 153/233 (66%), Gaps = 11/233 (5%)
 Frame = -3

Query  1143  GVKLSKCTNITIINNCKETVWPGITTNNNDSGDG--FALKPGQSAVFAAPSGWNGRIWGR  970
             G  L+  T IT+ N C  TVWPG  + N  +  G  F+L PG S    AP+GW+GR WGR
Sbjct  19    GNVLASATVITLQNQCGYTVWPGTLSGNGPTLGGGGFSLPPGGSVQLQAPAGWSGRFWGR  78

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTL-----GETDFYDVSLVDG  805
             TGC+FD   GS +  C TG C G LKC+G G PPAT+ +FT+     G  DFYDVSLVDG
Sbjct  79    TGCSFD---GSGAGTCVTGDCPGGLKCTGGGAPPATLVEFTVAAPNAGGMDFYDVSLVDG  135

Query  804   FNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSG-GKTVACRSACNVFNTDEYCCR  628
             +N+ + V+   G GNC   GC  D+  NCP++L +  G G+ VAC+SAC  F T EYCC 
Sbjct  136   YNVGMAVRATGGTGNCQYAGCLLDVNANCPAELRVVDGSGRVVACKSACEQFKTPEYCCT  195

Query  627   GAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRN  469
             G   +P +C P++YSK FK+ACP AYS+A+DD TS  TC+  DY+++FCS+++
Sbjct  196   GDHGTPQTCGPSSYSKIFKSACPTAYSYAYDDATSTCTCTGADYLITFCSAQS  248



>gb|KEH36134.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=250

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 159/245 (65%), Gaps = 14/245 (6%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQ  1021
             S  FP  F++LL +  G  ++  T  TI N C  T+WPG  + N     GDG F+L PG 
Sbjct  7     SNTFP--FIILLLLLLG-NVASGTMFTIENRCNNTIWPGTLSGNGAELLGDGGFSLPPGS  63

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG  841
             S    AP GW+GR WGRTGCNFD   G+ +  C TG C G LKC+G G PP T+A+FT+G
Sbjct  64    SFDVTAPPGWSGRFWGRTGCNFD---GAGNGNCITGDCTGGLKCNGGGAPPVTLAEFTIG  120

Query  840   ----ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLAL-KSGGKTVA  676
                 + DFYDVSLVDG+N+ I ++   G G+C   GC  DL  +CP++L + + GG  VA
Sbjct  121   SVSGDKDFYDVSLVDGYNVGIGIQATRGTGDCQYAGCVADLNSHCPAELQVTEVGGSVVA  180

Query  675   CRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDY  496
             C+SAC  FNT+E+CC G  SSP SC  T YS+ FK+ACP AYS+A+DD +S  TCS +DY
Sbjct  181   CKSACAAFNTEEFCCTGEHSSPQSCSSTQYSEMFKSACPSAYSYAYDDASSTCTCSESDY  240

Query  495   VVSFC  481
              ++FC
Sbjct  241   HITFC  245



>ref|XP_002892990.1| hypothetical protein ARALYDRAFT_889237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69249.1| hypothetical protein ARALYDRAFT_889237 [Arabidopsis lyrata subsp. 
lyrata]
Length=243

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 140/224 (63%), Gaps = 10/224 (4%)
 Frame = -3

Query  1116  ITIINNCKETVWPGITT---NNNDSGDGFALKPGQSAVFAAPSGWNGRIWGRTGCNFDKS  946
             +   N CK  VWPGI      N  +G GF L   ++     P  W+GR WGR GC FD+S
Sbjct  23    VIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLSANKAHSLQLPPLWSGRFWGRHGCTFDRS  82

Query  945   NGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNLPIVVKPVN  772
                    C TG CGG+L C+G G +PPAT+A+ TLG E DFYDVSLVDG+NL + + PV 
Sbjct  83    G---RGHCATGDCGGSLSCNGAGGEPPATLAEITLGPELDFYDVSLVDGYNLAMSIMPVK  139

Query  771   GKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGAFSSPASCL  598
             G G CS  GC  DL   CP  L ++S  G   VAC+SAC+ FN+ +YCC G F +P SC 
Sbjct  140   GSGQCSYAGCVSDLNRMCPVGLQVRSRNGKHVVACKSACSAFNSPQYCCTGLFGNPLSCK  199

Query  597   PTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             PT YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC     
Sbjct  200   PTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRH  243



>gb|ACU65941.1| pathogenesis-related 5 protein [Brassica rapa subsp. chinensis]
 dbj|BAJ16221.1| pathogenesis-related 5 [Brassica rapa subsp. chinensis]
Length=243

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 146/232 (63%), Gaps = 10/232 (4%)
 Frame = -3

Query  1140  VKLSKCTNITIINNCKETVWPGI---TTNNNDSGDGFALKPGQSAVFAAPSGWNGRIWGR  970
             +  +  + +   N C+  VWPGI      N  +G GF L   ++     P  W+GR WGR
Sbjct  15    ISRASASTVVFFNKCRYPVWPGIQPIAAQNILAGGGFKLPANKAYTLQLPPLWSGRFWGR  74

Query  969   TGCNFDKSNGSSSSPCQTGSCGGALKCSGTG-QPPATIADFTLG-ETDFYDVSLVDGFNL  796
              GC FD   GS    C TG CGG+L C+G G  PPAT+A+ TLG E DFYDVSLVDG+NL
Sbjct  75    HGCTFD---GSGRGRCATGDCGGSLTCNGAGGSPPATLAEITLGQELDFYDVSLVDGYNL  131

Query  795   PIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKS--GGKTVACRSACNVFNTDEYCCRGA  622
              + + P+ G+G CS  GC  DL   CP  L ++S  G + +AC+SAC+ FN+ +YCC G 
Sbjct  132   AMSIMPLKGRGQCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSAFNSPQYCCTGL  191

Query  621   FSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSSRNQ  466
             F +P SC PT+YSK FK ACP AYS+A+DDPTS+ TCS  +Y+V+FC    +
Sbjct  192   FGNPQSCKPTSYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPHHRR  243



>ref|XP_002277548.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI37894.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 159/244 (65%), Gaps = 19/244 (8%)
 Frame = -3

Query  1176  KLFLL---LLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS---GDGFALKPGQSA  1015
              +F+L   L+A ++GV  +     T +N C+ TVWPGI  N   +     GF L    S 
Sbjct  9     SIFILNISLMAFSTGVLGA---TFTFVNRCEYTVWPGILANAGSARLDSTGFELPKDTSR  65

Query  1014  VFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLG  841
              F AP+GW+GR WGRTGCNFD   GS    C TG CG G ++C+G G  PPAT+A+FTLG
Sbjct  66    SFLAPTGWSGRFWGRTGCNFD---GSGLGSCVTGDCGSGTIECNGAGAAPPATLAEFTLG  122

Query  840   E--TDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRS  667
                 DFYDVSLVDG+NLP++V+   G G C++ GC  DL + CP++L +  G    ACRS
Sbjct  123   TGGQDFYDVSLVDGYNLPMIVEGSGGSGMCASTGCTVDLNQGCPAELKVGDG---SACRS  179

Query  666   ACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVS  487
             AC  F + EYCC GA+S+PA+C P+ YS+ FK+ACP +YS+A+DD TS  TC+  DY V+
Sbjct  180   ACEAFGSPEYCCSGAYSTPATCRPSVYSEMFKSACPRSYSYAYDDATSTFTCAGADYTVT  239

Query  486   FCSS  475
             FC S
Sbjct  240   FCPS  243



>ref|XP_009379396.1| PREDICTED: thaumatin-like protein 1 [Pyrus x bretschneideri]
Length=305

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 152/238 (64%), Gaps = 16/238 (7%)
 Frame = -3

Query  1167  LLLLAIASGVKLSKCTNITIINNCKETVWPGITTN---NNDSGDGFALKPGQSAVFAAPS  997
              +LL +  GV  +     T  N C  TVWPGI  +   N     GF L  G S VF AP+
Sbjct  11    FILLIVTEGVLGA---TFTFTNKCDFTVWPGILASAGSNKLDSTGFELPKGSSRVFQAPT  67

Query  996   GWNGRIWGRTGCNFDKSNGSSSSPCQTGSCG-GALKCSGTGQ-PPATIADFTLGE--TDF  829
             GW+GR WGRTGC FD   GS    C TG CG G L+C+G G  PPAT+A+FTLG    DF
Sbjct  68    GWSGRFWGRTGCTFD---GSGQGSCSTGDCGSGELECNGAGAVPPATLAEFTLGSGSQDF  124

Query  828   YDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALKSGGKTVACRSACNVFN  649
             YDVSLVDG+NLP+ V+   G G C++ GC  DL   CP++L +K GG   AC+SAC+ F 
Sbjct  125   YDVSLVDGYNLPMTVEGSGGSGACASTGCVTDLNRRCPAELKVKGGG---ACKSACDAFG  181

Query  648   TDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCSS  475
             + EYCC GA+ SP++C P+ YS+ FK+ACP +YS+A+DD +S  TC   DY ++FC S
Sbjct  182   SPEYCCNGAYGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCIGADYTITFCDS  239



>ref|XP_007160787.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
 gb|ESW32781.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
Length=244

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 151/246 (61%), Gaps = 18/246 (7%)
 Frame = -3

Query  1191  STAFPKLFLLLLAIASGVKLSKCTNITIINNCKETVWPGITTNNNDS--GDG-FALKPGQ  1021
             S  F  +  LL  + SG         T+ N C  TVWPG  + N  +  GDG F L+PG 
Sbjct  7     SKVFALILFLLGNVVSGAVF------TLQNRCSYTVWPGTLSGNGVATLGDGGFPLEPGA  60

Query  1020  SAVFAAPSGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLG  841
                  APSGW+GRIW RTGC+FD   GS    C TG C G L+C+G G PPAT+A+FT+G
Sbjct  61    EVQLTAPSGWSGRIWARTGCSFD---GSGIGTCATGDCAGGLRCTGGGVPPATLAEFTIG  117

Query  840   -----ETDFYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLALK-SGGKTV  679
                  + DFYDVSLVDG+N+ I V    G G+C   GC  DL   CP +L ++ SGG  V
Sbjct  118   FAGNGDKDFYDVSLVDGYNVGIGVLATGGTGDCRYAGCAADLNAACPEELQVRDSGGVVV  177

Query  678   ACRSACNVFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATD  499
             AC+SAC  FNT E+CC G   +P +C  T+YS+ FK ACP AYS+A+DD +S  TCS  D
Sbjct  178   ACKSACAAFNTPEFCCTGEHGTPQTCSATHYSEIFKNACPTAYSYAYDDASSTRTCSTAD  237

Query  498   YVVSFC  481
             YV++FC
Sbjct  238   YVIAFC  243



>ref|XP_009106162.1| PREDICTED: pathogenesis-related protein 5 [Brassica rapa]
Length=246

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 155/243 (64%), Gaps = 12/243 (5%)
 Frame = -3

Query  1173  LFLLLLAIASGVKLSKCTNITIINNCKETVWPGITT-NNNDSGDG-FALKPGQSAVFAAP  1000
             L LL + I SGV +   T  T+ N+C  TVWPGI + N+N  GDG F L PG S    AP
Sbjct  8     LILLFVFITSGVAVFA-TVFTLQNSCPYTVWPGILSGNSNTLGDGGFPLTPGASKQLTAP  66

Query  999   SGWNGRIWGRTGCNFDKSNGSSSSPCQTGSCGGALKCSGTGQPPATIADFTLGE----TD  832
              GW+GR W RTGC+FD S   +   C TG CGG LKC G G PP T+A+FT+G      D
Sbjct  67    QGWSGRFWARTGCSFDSSGNGN---CVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKD  123

Query  831   FYDVSLVDGFNLPIVVKPVNGKGNCSAVGCDKDLRENCPSDLAL--KSGGKTVACRSACN  658
             FYDVSLVDG+N+ + +KP  G G+C   GC  D+   CP++L +     G   AC+SAC 
Sbjct  124   FYDVSLVDGYNVEMGIKPQGGSGDCKYAGCVADVNAVCPNELRIVDPKTGTVAACKSACA  183

Query  657   VFNTDEYCCRGAFSSPASCLPTNYSKSFKAACPIAYSFAFDDPTSVITCSATDYVVSFCS  478
              FN+ E+CC GA ++P +C PT YS  FK ACP AYS+A+DD TS  TC+  +Y+++FC 
Sbjct  184   AFNSPEFCCTGAPATPQTCSPTRYSAMFKNACPSAYSYAYDDATSTFTCAGANYLITFCP  243

Query  477   SRN  469
             +R+
Sbjct  244   TRS  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764