BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13919_g1_i1 len=189 path=[286:0-30 94:31-152 108:153-188]

Length=189
                                                                      Score     E

ref|XP_009785774.1|  PREDICTED: patatin-17-like                       93.6    5e-21   
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516           93.2    9e-21   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                92.8    1e-20   
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                92.8    1e-20   
ref|XP_002510255.1|  Patatin precursor, putative                      92.4    1e-20   Ricinus communis
ref|XP_006384147.1|  hypothetical protein POPTR_0004s082501g          90.9    2e-20   
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                    92.4    2e-20   
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                92.4    2e-20   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                92.0    2e-20   
emb|CDP07844.1|  unnamed protein product                              92.0    2e-20   
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                92.0    2e-20   
ref|XP_006294513.1|  hypothetical protein CARUB_v10023546mg           91.3    2e-20   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                91.7    3e-20   
ref|XP_002510259.1|  Patatin T5 precursor, putative                   91.7    3e-20   Ricinus communis
ref|XP_003589237.1|  Patatin-like protein                             90.9    3e-20   
gb|ACU24007.1|  unknown                                               89.4    3e-20   Glycine max [soybeans]
ref|XP_010064131.1|  PREDICTED: patatin-like protein 2                90.1    3e-20   
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                90.9    3e-20   
ref|XP_009605254.1|  PREDICTED: patatin-2-Kuras 1-like                91.3    3e-20   
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                     91.3    4e-20   
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                91.3    4e-20   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1          91.7    4e-20   
gb|KHN12765.1|  Patatin group A-3                                     91.3    4e-20   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2          91.7    4e-20   
gb|KCW66180.1|  hypothetical protein EUGRSUZ_F00017                   90.5    4e-20   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                91.3    4e-20   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                  90.9    4e-20   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                91.3    5e-20   
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2     90.9    5e-20   
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                   90.9    5e-20   
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1     90.9    6e-20   
ref|NP_180224.1|  phospholipase A 2A                                  90.9    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                90.9    6e-20   
ref|XP_003589236.1|  Patatin-like protein                             90.9    6e-20   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis     90.5    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288052.1|  PREDICTED: patatin group A-3-like                90.5    7e-20   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                       90.1    7e-20   
gb|AAB08427.1|  patatin homolog                                       89.4    8e-20   Nicotiana tabacum [American tobacco]
gb|KCW66173.1|  hypothetical protein EUGRSUZ_F00009                   88.6    9e-20   
ref|XP_009794856.1|  PREDICTED: probable inactive patatin-3-Kuras 1   88.6    9e-20   
emb|CAN80453.1|  hypothetical protein VITISV_028107                   90.1    1e-19   Vitis vinifera
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                90.5    1e-19   
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                90.1    1e-19   
ref|XP_010101004.1|  Patatin group A-3                                90.1    1e-19   
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2     90.1    1e-19   
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1     90.1    1e-19   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2     90.1    1e-19   
ref|XP_010064190.1|  PREDICTED: patatin-like protein 2                89.0    1e-19   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                90.1    1e-19   Vitis vinifera
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337           90.1    1e-19   
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                89.4    1e-19   
emb|CBI19552.3|  unnamed protein product                              90.5    1e-19   
gb|KDP38383.1|  hypothetical protein JCGZ_04308                       89.7    2e-19   
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2     89.0    2e-19   
emb|CAN76066.1|  hypothetical protein VITISV_001725                   89.7    2e-19   Vitis vinifera
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                   89.4    2e-19   
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                89.4    2e-19   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg           89.4    2e-19   
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                89.0    2e-19   Vitis vinifera
ref|XP_006434812.1|  hypothetical protein CICLE_v10001337mg           88.2    3e-19   
emb|CDY21469.1|  BnaC03g27280D                                        89.0    3e-19   
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1     89.0    3e-19   
ref|XP_006434814.1|  hypothetical protein CICLE_v10001337mg           87.8    3e-19   
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                89.0    3e-19   
gb|ACU21029.1|  unknown                                               87.0    3e-19   Glycine max [soybeans]
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                   88.6    4e-19   
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                88.6    4e-19   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                88.6    4e-19   
ref|XP_009590385.1|  PREDICTED: patatin-like protein 2                87.8    4e-19   
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1     88.6    4e-19   Vitis vinifera
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3     88.6    4e-19   
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                88.2    4e-19   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                88.6    4e-19   
gb|KHN41622.1|  Patatin-06                                            87.0    4e-19   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                   88.2    4e-19   
ref|XP_002510257.1|  Patatin T5 precursor, putative                   88.6    4e-19   Ricinus communis
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1     88.6    4e-19   
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                88.6    4e-19   
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg           88.2    4e-19   
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                88.6    5e-19   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg           88.6    5e-19   
ref|XP_006388386.1|  hypothetical protein POPTR_0202s00230g           87.4    5e-19   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                88.6    5e-19   
ref|XP_009617802.1|  PREDICTED: patatin-like protein 2 isoform X2     87.4    5e-19   
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                88.2    5e-19   
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg           88.2    5e-19   
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2     88.2    6e-19   
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                    88.2    6e-19   
ref|XP_002301194.1|  patatin-like family protein                      88.2    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                88.2    6e-19   
gb|KCW66175.1|  hypothetical protein EUGRSUZ_F00011                   87.0    6e-19   
emb|CDX83197.1|  BnaA03g23090D                                        88.2    6e-19   
ref|XP_010101001.1|  Patatin group A-3                                88.2    7e-19   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg           88.2    7e-19   
ref|XP_010059971.1|  PREDICTED: patatin-like protein 2 isoform X2     87.0    7e-19   
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2     88.2    7e-19   
ref|XP_010943124.1|  PREDICTED: patatin-like protein 2                86.3    7e-19   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg           87.8    7e-19   
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1     88.2    7e-19   
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                87.8    7e-19   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                   88.2    7e-19   
gb|KGN62540.1|  hypothetical protein Csa_2G360570                     87.0    8e-19   
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2     87.4    8e-19   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                87.8    8e-19   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                88.2    8e-19   Vitis vinifera
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g           87.8    8e-19   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                87.8    8e-19   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg           87.4    8e-19   
emb|CBI19549.3|  unnamed protein product                              87.8    8e-19   
ref|XP_010101003.1|  Patatin group A-3                                87.8    9e-19   
emb|CBI19553.3|  unnamed protein product                              88.2    9e-19   
gb|EMT15946.1|  Patatin-3-Kuras 1                                     86.7    9e-19   
gb|AAX99411.1|  patatin-like protein                                  87.8    9e-19   Gossypium hirsutum [American cotton]
emb|CBI19544.3|  unnamed protein product                              88.2    9e-19   
ref|XP_006388384.1|  hypothetical protein POPTR_0202s00210g           86.7    1e-18   
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                87.4    1e-18   
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1     87.4    1e-18   
gb|AAB08428.1|  patatin homolog                                       87.4    1e-18   Nicotiana tabacum [American tobacco]
ref|XP_003603014.1|  Patatin-like protein                             87.4    1e-18   
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                87.4    1e-18   
gb|AAF98368.1|AF158027_1  patatin-like protein 1                      87.4    1e-18   Nicotiana tabacum [American tobacco]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1     87.4    1e-18   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                87.4    1e-18   
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                87.0    1e-18   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                87.4    1e-18   
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1     87.0    1e-18   
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                87.0    1e-18   Vitis vinifera
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g           87.0    1e-18   
ref|XP_006645174.1|  PREDICTED: patatin-2-Kuras 4-like                87.0    1e-18   
gb|KHG27256.1|  Patatin group M-3                                     87.0    2e-18   
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g           87.0    2e-18   
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                87.0    2e-18   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg           87.0    2e-18   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g           86.7    2e-18   
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                87.0    2e-18   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                87.0    2e-18   
ref|XP_003603015.1|  Patatin-like protein                             87.0    2e-18   
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g           87.0    2e-18   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                       87.0    2e-18   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2     86.3    2e-18   
ref|XP_002324124.2|  hypothetical protein POPTR_0017s02550g           85.9    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g           86.7    2e-18   
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                86.7    2e-18   
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1     86.7    2e-18   
emb|CBI21444.3|  unnamed protein product                              86.7    2e-18   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                   86.3    2e-18   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                86.7    2e-18   
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                86.7    2e-18   
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g           86.7    2e-18   
ref|XP_009409647.1|  PREDICTED: patatin-like protein 2                85.5    3e-18   
ref|XP_004310193.1|  PREDICTED: patatin group A-3-like                86.3    3e-18   
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g           85.9    3e-18   
ref|XP_008245283.1|  PREDICTED: patatin-like protein 2                85.1    3e-18   
ref|XP_004291132.1|  PREDICTED: patatin group A-3-like                86.3    3e-18   
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2     85.5    3e-18   
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                86.3    3e-18   
gb|AFK35290.1|  unknown                                               86.3    3e-18   
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                85.9    3e-18   
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                85.9    3e-18   
ref|NP_001274813.1|  patatin-like protein 1                           83.2    4e-18   
ref|XP_003527713.1|  PREDICTED: patatin-like                          85.9    4e-18   
emb|CDP04311.1|  unnamed protein product                              85.9    4e-18   
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g           85.9    4e-18   
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                85.5    5e-18   
ref|XP_008813727.1|  PREDICTED: patatin-like protein 2                85.1    5e-18   
ref|XP_006488152.1|  PREDICTED: patatin-05-like                       85.5    5e-18   
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1     85.5    5e-18   
ref|XP_002310732.1|  patatin family protein                           85.5    5e-18   Populus trichocarpa [western balsam poplar]
emb|CDP01332.1|  unnamed protein product                              85.5    5e-18   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1          85.5    5e-18   
gb|AGS13487.1|  PLP protein                                           85.1    5e-18   
ref|XP_006372534.1|  hypothetical protein POPTR_0017s025303g          84.3    5e-18   
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2     85.5    6e-18   
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3     85.1    6e-18   
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1     85.5    6e-18   
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                85.5    7e-18   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg           85.1    7e-18   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                85.1    7e-18   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                       85.1    7e-18   
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                85.1    7e-18   
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2     84.7    7e-18   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g           85.1    8e-18   
ref|XP_007160831.1|  hypothetical protein PHAVU_001G020200g           85.1    8e-18   
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1     85.1    8e-18   
ref|XP_003544451.1|  PREDICTED: patatin-05-like                       85.1    8e-18   
ref|XP_003544453.1|  PREDICTED: patatin-05                            85.1    9e-18   
gb|EMS59852.1|  Patatin-3-Kuras 1                                     84.0    9e-18   
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...  84.7    9e-18   
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                85.5    1e-17   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                84.7    1e-17   
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                84.7    1e-17   
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                84.7    1e-17   
ref|XP_006601293.1|  PREDICTED: patatin-11-like                       84.7    1e-17   
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                84.7    1e-17   
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                    84.7    1e-17   
gb|ACR34670.1|  unknown                                               83.2    1e-17   Zea mays [maize]
ref|XP_008360670.1|  PREDICTED: patatin-like protein 3                83.6    1e-17   
ref|XP_010098699.1|  Patatin group A-3                                84.7    1e-17   
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                84.7    1e-17   
emb|CBI19558.3|  unnamed protein product                              84.7    1e-17   
gb|KHN04516.1|  Patatin group A-3                                     84.3    1e-17   
emb|CDP01337.1|  unnamed protein product                              84.3    2e-17   
ref|XP_003589238.1|  Patatin-like protein                             84.3    2e-17   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg           84.0    2e-17   
dbj|BAK06341.1|  predicted protein                                    84.3    2e-17   
gb|KGN62539.1|  hypothetical protein Csa_2G360560                     83.2    2e-17   
gb|EEE68593.1|  hypothetical protein OsJ_27119                        83.2    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                84.0    2e-17   
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                84.0    2e-17   Vitis vinifera
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2     84.0    2e-17   
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1     84.0    2e-17   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                84.0    2e-17   
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2     83.6    2e-17   
emb|CAN71270.1|  hypothetical protein VITISV_001906                   82.8    2e-17   Vitis vinifera
gb|AAK18751.1|  patatin-like protein                                  84.0    2e-17   Vigna unguiculata
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                84.0    2e-17   Vitis vinifera
gb|EAZ06806.1|  hypothetical protein OsI_29050                        84.3    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010269079.1|  PREDICTED: patatin-like protein 2 isoform X3     82.8    2e-17   
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                83.6    2e-17   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1     83.6    2e-17   
emb|CDP07842.1|  unnamed protein product                              83.6    3e-17   
ref|XP_008220197.1|  PREDICTED: patatin-like protein 2 isoform X2     82.8    3e-17   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                83.6    3e-17   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                82.8    3e-17   
ref|XP_003523877.1|  PREDICTED: uncharacterized protein LOC100804004  82.0    3e-17   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...  83.6    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010269072.1|  PREDICTED: patatin-like protein 2 isoform X2     82.8    3e-17   
emb|CAN68798.1|  hypothetical protein VITISV_008805                   83.6    3e-17   Vitis vinifera
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                83.6    3e-17   
ref|XP_004291130.1|  PREDICTED: patatin group A-3-like                83.6    3e-17   
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2     83.2    3e-17   
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1     83.6    3e-17   
ref|XP_002510260.1|  Patatin T5 precursor, putative                   83.2    3e-17   Ricinus communis
emb|CBI19554.3|  unnamed protein product                              83.2    4e-17   
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                83.2    4e-17   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                83.2    4e-17   
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                83.2    4e-17   Vitis vinifera
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1     83.2    4e-17   
ref|XP_002510258.1|  Patatin T5 precursor, putative                   83.2    4e-17   Ricinus communis
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1     83.2    4e-17   
gb|EMS48009.1|  Patatin-3-Kuras 1                                     82.0    4e-17   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2     83.2    5e-17   
ref|NP_001061678.1|  Os08g0376500                                     83.2    5e-17   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87158.1|  unknown                                               81.6    5e-17   Zea mays [maize]
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1     83.2    5e-17   
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                82.8    5e-17   
ref|XP_008813725.1|  PREDICTED: patatin-like protein 2 isoform X2     82.0    5e-17   
emb|CBI19560.3|  unnamed protein product                              83.6    5e-17   
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244  84.7    5e-17   Vitis vinifera
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g           82.8    5e-17   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2     82.8    6e-17   
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                84.3    6e-17   
ref|XP_004973691.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2     82.4    6e-17   
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1     82.8    6e-17   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                   82.4    6e-17   
ref|NP_001045094.1|  Os01g0898500                                     82.4    7e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010680489.1|  PREDICTED: patatin-like protein 1                82.4    7e-17   
ref|XP_008776250.1|  PREDICTED: patatin-like protein 2                82.8    7e-17   
gb|EAY76835.1|  hypothetical protein OsI_04794                        82.4    7e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g           82.4    7e-17   
ref|XP_004973690.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1     82.4    8e-17   
ref|XP_004291128.1|  PREDICTED: patatin group A-3-like                82.8    8e-17   
ref|NP_001141843.1|  hypothetical protein                             82.4    8e-17   Zea mays [maize]
emb|CBI19557.3|  unnamed protein product                              84.0    8e-17   
ref|XP_010102581.1|  Patatin group A-3                                82.4    8e-17   
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                82.4    8e-17   Vitis vinifera
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g           82.4    8e-17   
emb|CDP01333.1|  unnamed protein product                              82.0    8e-17   
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g           82.0    9e-17   
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                82.0    9e-17   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg           82.0    1e-16   
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                82.0    1e-16   
ref|XP_006829696.1|  hypothetical protein AMTR_s00126p00051390        80.5    1e-16   
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg           81.6    1e-16   
gb|EEC84713.1|  hypothetical protein OsI_31673                        81.6    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                82.8    1e-16   
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700        82.0    1e-16   
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                82.0    1e-16   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                81.6    1e-16   
sp|P15478.1|PATT5_SOLTU  RecName: Full=Patatin-T5; AltName: Full=...  81.6    1e-16   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1          81.6    1e-16   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                81.6    1e-16   
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2     81.6    2e-16   
ref|XP_006466737.1|  PREDICTED: patatin-14-like                       81.6    2e-16   
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                81.6    2e-16   
ref|NP_001050287.1|  Os03g0393900                                     81.6    2e-16   
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                81.6    2e-16   
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                81.6    2e-16   
gb|KDO79284.1|  hypothetical protein CISIN_1g0425841mg                80.5    2e-16   
ref|XP_010089434.1|  Patatin group A-3                                81.3    2e-16   
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1     81.6    2e-16   
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                81.3    2e-16   
emb|CDP01335.1|  unnamed protein product                              81.6    2e-16   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1     81.3    2e-16   
emb|CDP11077.1|  unnamed protein product                              81.3    2e-16   
ref|XP_002456787.1|  hypothetical protein SORBIDRAFT_03g042730        81.3    2e-16   
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                81.3    2e-16   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                81.3    2e-16   
ref|NP_001063402.2|  Os09g0462400                                     80.9    2e-16   
ref|XP_004957049.1|  PREDICTED: patatin-05-like                       80.9    2e-16   
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                81.3    2e-16   
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                82.0    2e-16   
gb|EMT06575.1|  Patatin-15                                            81.6    2e-16   
sp|Q2MY44.1|PAT07_SOLTU  RecName: Full=Patatin-07; Flags: Precursor   80.9    2e-16   
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg           81.3    2e-16   
gb|KCW54995.1|  hypothetical protein EUGRSUZ_I00969                   79.7    2e-16   
gb|EAZ07346.1|  hypothetical protein OsI_29595                        81.3    2e-16   
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_006495361.1|  PREDICTED: patatin group M-3-like                79.7    3e-16   
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg           80.9    3e-16   
ref|XP_010256336.1|  PREDICTED: patatin-like protein 2 isoform X1     81.3    3e-16   
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg           80.9    3e-16   
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg           80.9    3e-16   
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_010256337.1|  PREDICTED: patatin-like protein 2 isoform X2     80.9    3e-16   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                81.6    3e-16   
sp|Q3YJT5.1|PAT05_SOLTU  RecName: Full=Patatin-05; AltName: Full=...  80.5    3e-16   
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2     80.1    3e-16   
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                80.9    3e-16   
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1     80.5    3e-16   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  80.9    3e-16   
ref|XP_008241848.1|  PREDICTED: patatin-like protein 2                80.5    3e-16   
ref|XP_010028280.1|  PREDICTED: patatin-like protein 2 isoform X3     79.3    3e-16   
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1     80.5    3e-16   
sp|Q2MY48.1|PAT03_SOLTU  RecName: Full=Patatin-03; Flags: Precursor   80.5    3e-16   
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg           80.5    3e-16   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...  80.9    4e-16   
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2     80.1    4e-16   
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                80.5    4e-16   
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                80.5    4e-16   
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                80.5    4e-16   
ref|XP_006660709.1|  PREDICTED: patatin-2-Kuras 2-like isoform X1     79.7    4e-16   
ref|XP_006466736.1|  PREDICTED: patatin-11-like                       80.1    4e-16   
gb|KCW54997.1|  hypothetical protein EUGRSUZ_I00973                   79.0    5e-16   
ref|XP_002863646.1|  hypothetical protein ARALYDRAFT_331045           80.1    5e-16   
ref|XP_010238243.1|  PREDICTED: patatin-like protein 2 isoform X3     79.3    5e-16   
emb|CDP02483.1|  unnamed protein product                              80.1    5e-16   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2     80.1    5e-16   
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                 80.1    5e-16   
dbj|BAJ98020.1|  predicted protein                                    80.5    5e-16   
ref|XP_002445640.1|  hypothetical protein SORBIDRAFT_07g023220        80.9    5e-16   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                80.1    5e-16   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                80.1    6e-16   
gb|EEE59195.1|  hypothetical protein OsJ_11136                        80.5    6e-16   
gb|ABA99523.1|  Patatin-like phospholipase family protein, expressed  79.3    6e-16   
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                79.7    6e-16   
gb|EMT18762.1|  Patatin group A-3                                     79.7    7e-16   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                79.7    7e-16   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                79.7    7e-16   
ref|XP_010028279.1|  PREDICTED: patatin-like protein 2 isoform X2     78.6    7e-16   
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                79.0    7e-16   
ref|XP_004288058.1|  PREDICTED: patatin group A-3-like                79.3    8e-16   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                79.7    8e-16   
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                80.1    8e-16   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                79.7    8e-16   
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2     79.3    8e-16   
ref|XP_004962815.1|  PREDICTED: patatin-T5-like                       80.1    8e-16   
ref|XP_008360668.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  78.2    8e-16   
emb|CAN71554.1|  hypothetical protein VITISV_034739                   80.5    8e-16   
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1     79.7    8e-16   
emb|CDX72620.1|  BnaC07g46420D                                        79.7    9e-16   
gb|EAZ20815.1|  hypothetical protein OsJ_36440                        79.3    9e-16   
ref|XP_009367485.1|  PREDICTED: patatin-like protein 2                78.6    9e-16   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                79.3    9e-16   
gb|EMS46263.1|  Patatin group A-3                                     79.7    9e-16   
ref|XP_006829699.1|  hypothetical protein AMTR_s00126p00054960        77.8    9e-16   
sp|Q2MY54.1|PATJ1_SOLTU  RecName: Full=Patatin group J-1; Flags: ...  79.3    9e-16   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1     79.3    9e-16   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg           79.0    9e-16   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                79.3    1e-15   
sp|Q2MY39.1|PAT12_SOLTU  RecName: Full=Patatin-12; Flags: Precursor   79.3    1e-15   
gb|EAY83441.1|  hypothetical protein OsI_38653                        79.7    1e-15   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230        79.3    1e-15   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  80.1    1e-15   
gb|EMT32376.1|  Patatin group A-3                                     79.3    1e-15   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                79.0    1e-15   
gb|AFK38043.1|  unknown                                               79.3    1e-15   
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2     79.0    1e-15   
gb|KEH17875.1|  patatin-like phospholipase                            79.3    1e-15   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg           79.0    1e-15   
ref|XP_006829698.1|  hypothetical protein AMTR_s00126p00052810        78.2    1e-15   
gb|KHN42072.1|  Patatin group A-3                                     79.3    1e-15   
ref|XP_010942709.1|  PREDICTED: patatin-like protein 2                77.8    1e-15   
gb|EMS48006.1|  Patatin group A-3                                     77.4    1e-15   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                79.0    1e-15   
gb|EMT28251.1|  Patatin group A-3                                     79.3    1e-15   
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818        78.6    1e-15   
sp|Q3YJT4.1|PT1K2_SOLTU  RecName: Full=Patatin-1-Kuras 2; Flags: ...  78.6    1e-15   
sp|P15477.1|PATB2_SOLTU  RecName: Full=Patatin-B2; Flags: Precursor   78.6    1e-15   
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                79.0    1e-15   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                79.0    1e-15   
sp|Q2MY58.1|PATA3_SOLTU  RecName: Full=Patatin group A-3; Flags: ...  78.6    1e-15   
sp|Q2MY45.1|PAT06_SOLTU  RecName: Full=Patatin-06; Flags: Precursor   78.6    1e-15   
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1     79.0    2e-15   
ref|XP_004289234.1|  PREDICTED: patatin group A-3-like                78.6    2e-15   
sp|Q2MY60.1|PAT02_SOLTU  RecName: Full=Patatin-02; AltName: Full=...  78.6    2e-15   
sp|Q2MY50.1|PAT01_SOLTU  RecName: Full=Patatin-01; Flags: Precursor   78.6    2e-15   
sp|Q2MY40.1|PAT11_SOLTU  RecName: Full=Patatin-11; Flags: Precursor   78.6    2e-15   
sp|Q2MY42.1|PAT04_SOLTU  RecName: Full=Patatin-04/09; Flags: Prec...  78.6    2e-15   
ref|NP_199172.1|  acyl transferase/acyl hydrolase/lysophospholipa...  79.0    2e-15   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                78.6    2e-15   
pdb|1OXW|A  Chain A, The Crystal Structure Of Semet Patatin           78.6    2e-15   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1     78.6    2e-15   
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                79.0    2e-15   
gb|EAY83457.1|  hypothetical protein OsI_38668                        79.3    2e-15   
emb|CBI25857.3|  unnamed protein product                              77.0    2e-15   
dbj|BAK02816.1|  predicted protein                                    79.0    2e-15   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1     79.0    2e-15   
gb|ACN33435.1|  unknown                                               79.0    2e-15   
ref|NP_001149326.1|  patatin class 1                                  79.0    2e-15   
tpg|DAA48471.1|  TPA: patatin class 1                                 79.0    2e-15   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494            78.6    2e-15   
sp|Q41487.1|PAT16_SOLTU  RecName: Full=Patatin-16; Flags: Precursor   78.6    2e-15   
gb|EAZ07347.1|  hypothetical protein OsI_29596                        79.0    2e-15   
ref|XP_004970914.1|  PREDICTED: patatin-T5-like isoform X3            78.2    2e-15   
sp|Q2MY36.1|PAT15_SOLTU  RecName: Full=Patatin-15; Flags: Precursor   78.6    2e-15   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1     78.6    2e-15   
ref|XP_008801795.1|  PREDICTED: patatin-like protein 2                77.4    2e-15   
sp|Q3YJT3.1|PT2K1_SOLTU  RecName: Full=Patatin-2-Kuras 1; Flags: ...  78.2    2e-15   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2     78.6    2e-15   
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                78.6    2e-15   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200        79.0    2e-15   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2     78.6    2e-15   
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380        78.6    2e-15   
sp|Q2MY41.1|PAT10_SOLTU  RecName: Full=Patatin-10; Flags: Precursor   78.2    2e-15   
gb|KHN19110.1|  Patatin group A-3                                     78.6    2e-15   
gb|EEE68866.1|  hypothetical protein OsJ_27669                        78.6    2e-15   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1     78.2    2e-15   
sp|P11768.1|PATM1_SOLTU  RecName: Full=Patatin group M-1; AltName...  78.2    2e-15   
sp|Q2MY51.1|PATM3_SOLTU  RecName: Full=Patatin group M-3; Flags: ...  78.2    3e-15   
sp|Q2MY52.1|PATM2_SOLTU  RecName: Full=Patatin group M-2; Flags: ...  78.2    3e-15   
sp|Q2MY37.1|PAT14_SOLTU  RecName: Full=Patatin-14; Flags: Precursor   78.2    3e-15   
ref|NP_001062042.1|  Os08g0476900                                     78.6    3e-15   
ref|XP_010939457.1|  PREDICTED: patatin-like protein 2 isoform X2     78.2    3e-15   
gb|EAZ07350.1|  hypothetical protein OsI_29600                        78.6    3e-15   
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                78.2    3e-15   
emb|CDM80597.1|  unnamed protein product                              78.6    3e-15   
sp|Q3YJT2.1|PT2K2_SOLTU  RecName: Full=Patatin-2-Kuras 2; Flags: ...  77.8    3e-15   
sp|Q3YJT0.1|PT2K4_SOLTU  RecName: Full=Patatin-2-Kuras 4; Flags: ...  77.8    3e-15   
sp|P07745.1|PAT0_SOLTU  RecName: Full=Patatin; AltName: Full=Pota...  77.8    3e-15   
sp|Q2MY56.1|PATD2_SOLTU  RecName: Full=Patatin group D-2; Flags: ...  77.8    3e-15   
ref|XP_009366776.1|  PREDICTED: patatin-like protein 2                77.8    3e-15   
ref|XP_007134435.1|  hypothetical protein PHAVU_010G0470000g          77.4    3e-15   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                78.2    3e-15   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                77.8    3e-15   
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                77.8    3e-15   
ref|XP_004970912.1|  PREDICTED: patatin-T5-like isoform X1            77.8    4e-15   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                78.2    4e-15   
ref|XP_006339914.1|  PREDICTED: patatin-05-like                       77.8    4e-15   
emb|CDP11080.1|  unnamed protein product                              77.4    4e-15   
gb|KFK30332.1|  hypothetical protein AALP_AA7G248200                  78.6    4e-15   
dbj|BAJ99822.1|  predicted protein                                    77.4    4e-15   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                77.8    4e-15   
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                77.8    4e-15   
sp|Q3YJS9.1|PT3K1_SOLTU  RecName: Full=Probable inactive patatin-...  77.4    4e-15   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                77.4    5e-15   
ref|NP_001275345.1|  patatin-05-like precursor                        77.4    5e-15   
pdb|4PK9|A  Chain A, The Crystal Structure Of Native Patatin          77.0    5e-15   
emb|CAA31576.1|  unnamed protein product                              77.0    5e-15   
ref|XP_006339912.1|  PREDICTED: patatin-05-like                       77.4    5e-15   
ref|NP_001242136.1|  uncharacterized protein LOC100802114 precursor   77.4    6e-15   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916           77.4    6e-15   
gb|AAM20447.1|  patatin-like protein                                  76.6    6e-15   
ref|XP_004291131.1|  PREDICTED: patatin group A-3-like                77.4    6e-15   
ref|XP_003572295.1|  PREDICTED: patatin-like protein 2                76.3    6e-15   
ref|NP_001140826.1|  uncharacterized protein LOC100272901             77.4    6e-15   
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                77.4    6e-15   
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1     77.4    6e-15   
ref|XP_010548403.1|  PREDICTED: patatin-like protein 1                77.8    6e-15   
gb|AAA33828.1|  patatin                                               77.0    6e-15   
sp|P15476.2|PATB1_SOLTU  RecName: Full=Patatin-B1; Flags: Precursor   77.0    6e-15   
ref|XP_004515340.1|  PREDICTED: patatin-02-like                       77.4    6e-15   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                       77.0    6e-15   
gb|KHG24697.1|  Patatin group A-3                                     77.0    6e-15   
sp|Q2MY59.1|PATA2_SOLTU  RecName: Full=Patatin group A-2; Flags: ...  77.0    7e-15   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                77.0    7e-15   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg              77.4    7e-15   
ref|XP_006367472.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...  77.0    7e-15   
ref|XP_006664622.1|  PREDICTED: patatin group J-1-like                77.4    7e-15   
gb|EMS48649.1|  Patatin group A-3                                     77.8    7e-15   
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                77.4    7e-15   
emb|CDY42720.1|  BnaA03g53730D                                        77.0    7e-15   
sp|Q42502.1|PT2K3_SOLTU  RecName: Full=Patatin-2-Kuras 3; Flags: ...  76.6    8e-15   
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                77.0    8e-15   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2     76.6    8e-15   
emb|CDP01331.1|  unnamed protein product                              77.0    8e-15   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                77.0    8e-15   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                77.0    8e-15   
sp|Q8LPW4.1|PAT17_SOLCD  RecName: Full=Patatin-17; Flags: Precursor   76.6    9e-15   
gb|EEE53389.1|  hypothetical protein OsJ_36436                        77.0    1e-14   
ref|XP_007134443.1|  hypothetical protein PHAVU_010G047700g           76.3    1e-14   
ref|XP_011085657.1|  PREDICTED: patatin-like protein 2                75.1    1e-14   
emb|CDM80590.1|  unnamed protein product                              75.1    1e-14   
dbj|BAJ94292.1|  predicted protein                                    76.6    1e-14   
gb|AFJ92643.2|  phospholipase A2                                      76.6    1e-14   
ref|NP_001062043.1|  Os08g0477100                                     76.6    1e-14   
gb|EEC69467.1|  hypothetical protein OsI_38663                        76.6    1e-14   



>ref|XP_009785774.1| PREDICTED: patatin-17-like [Nicotiana sylvestris]
Length=392

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+VLQDKLG+TRL QTLT+V+IPTFD+K  +PTIF   ++ +SP  +AK+SDIC
Sbjct  127  YDGKYLHKVLQDKLGETRLHQTLTNVVIPTFDMKKFQPTIFTKSEIANSPHLDAKMSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_002880810.1| hypothetical protein ARALYDRAFT_481516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57069.1| hypothetical protein ARALYDRAFT_481516 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 93.2 bits (230),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++  KLGDT+LSQTLT+V+IPTFDIK  +PTIF +++VK+ P KNA L+DI 
Sbjct  125  YDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKYLQPTIFSSYEVKNHPLKNATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010525997.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=406

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++ +KLGDTRL+QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  123  YDGKYLHKLVMEKLGDTRLNQTLTNVVIPTFDIKCLQPTIFSSYEVKNNPLKNATLADIS  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++Q+KLG+ RL QTLT+V+IPTFDIK+ +PTIF +++VK  P  NA LSDIC
Sbjct  124  YDGKYLHKLVQEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_002510255.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF52442.1| Patatin precursor, putative [Ricinus communis]
Length=407

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL+QTLT+VIIPTFDIK  +PTIF ++ VK++   NA+LSDIC
Sbjct  124  YDGKYLHNLVKEKLGNTRLNQTLTNVIIPTFDIKKLQPTIFSSFQVKNNSSLNARLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_006384147.1| hypothetical protein POPTR_0004s082501g, partial [Populus trichocarpa]
 gb|ERP61944.1| hypothetical protein POPTR_0004s082501g, partial [Populus trichocarpa]
Length=227

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDTRL QTLT+++IPTFDIK  +PTIF ++ VK++P  +A LSDIC
Sbjct  45   YDGKFLHSIVKEKLGDTRLHQTLTNIVIPTFDIKNLQPTIFSSYRVKNNPSTDALLSDIC  104

Query  9    IAT  1
            I T
Sbjct  105  IGT  107



>ref|XP_007017310.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14535.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=404

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH VL+++LG TRL QTLT+V+IPTFDIK  +P IF +++VK SP  NA LSDIC
Sbjct  123  YDGKYLHGVLKERLGYTRLHQTLTNVVIPTFDIKKLQPVIFSSYEVKKSPSLNALLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGDT+L QTLT+V+IPTFDIK  +PTIF ++++K++P  NA LSDIC
Sbjct  121  YDGKYLHKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLNAYLSDIC  180

Query  9    IAT  1
            I+T
Sbjct  181  IST  183



>ref|XP_010509131.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=405

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  123  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATLADIA  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L++KLG TRL QTLT+V+IPTFD+K  +PTIF T++VK SP  +A LSDIC
Sbjct  126  YDGKYLHKILKEKLGQTRLRQTLTNVVIPTFDVKYLQPTIFSTYEVKASPLLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_010547841.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=407

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++++KLGDTRL+QTLT+V+IPTFDIK  +PTIF +++VK++  KNA L+DI 
Sbjct  123  YDGKYLHQLVKEKLGDTRLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNSLKNATLADIS  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_006294513.1| hypothetical protein CARUB_v10023546mg [Capsella rubella]
 gb|EOA27411.1| hypothetical protein CARUB_v10023546mg [Capsella rubella]
Length=347

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDT+L+QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  64   YDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATLADIA  123

Query  9    IAT  1
            I+T
Sbjct  124  IST  126



>ref|XP_010503027.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=405

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  123  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATLADIV  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_002510259.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52446.1| Patatin T5 precursor, putative [Ricinus communis]
Length=405

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL+QTLT+++IPTFD+K  +PTIF ++ VK++P  NA LSDIC
Sbjct  122  YDGKYLHNLVKEKLGNTRLNQTLTNIVIPTFDVKKLQPTIFSSFQVKNNPSINALLSDIC  181

Query  9    IAT  1
            I+T
Sbjct  182  IST  184



>ref|XP_003589237.1| Patatin-like protein [Medicago truncatula]
 gb|AES59488.1| patatin-like phospholipase [Medicago truncatula]
Length=298

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQV+++KLGD RL +TLT++++PTFDIKT +P IF ++ +K SP  +AKLSDIC
Sbjct  9    YDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIC  68

Query  9    IAT  1
            I+T
Sbjct  69   IST  71



>gb|ACU24007.1| unknown [Glycine max]
Length=188

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +TLT+V+IPTFDIK+ +P IF ++ +K+SP  +AKLSDIC
Sbjct  128  YDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDIC  187

Query  9    I  7
            I
Sbjct  188  I  188



>ref|XP_010064131.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66170.1| hypothetical protein EUGRSUZ_F00006 [Eucalyptus grandis]
Length=238

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ RL QTLT+V+IPTFDIK+ +PTIF +++VK  P  NA LSDIC
Sbjct  124  YDGKYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_010059758.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=324

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ RL QTLT+V+IPTFDIK+ +PTIF +++VK  P  NA LSDIC
Sbjct  124  YDGKYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009605254.1| PREDICTED: patatin-2-Kuras 1-like [Nicotiana tomentosiformis]
Length=392

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH VLQ+KLG+TRL+QTLT+V+IPTFD+K  +P IF   ++ +SP+ +AKLSDIC
Sbjct  127  YDGKYLHNVLQEKLGETRLNQTLTNVVIPTFDMKKLQPIIFTKSEIANSPQLDAKLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +TLT+V+IPTFDIK+ +P IF ++ +K+SP  +AKLSDIC
Sbjct  128  YDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_010429587.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDT+L+QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNPLKNATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_007017303.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14528.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=437

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +P IF +++VK +P K+A LSDIC
Sbjct  140  YDGKYLHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDIC  199

Query  9    IAT  1
            I T
Sbjct  200  IGT  202



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +TLT+V+IPTFDIK+ +P IF ++ +K+SP  +AKLSDIC
Sbjct  128  YDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_007017304.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
 gb|EOY14529.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
Length=438

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +P IF +++VK +P K+A LSDIC
Sbjct  140  YDGKYLHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDIC  199

Query  9    IAT  1
            I T
Sbjct  200  IGT  202



>gb|KCW66180.1| hypothetical protein EUGRSUZ_F00017 [Eucalyptus grandis]
Length=334

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++DKLGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  52   YDGKYLHSVVRDKLGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  111

Query  9    IAT  1
            I+T
Sbjct  112  IST  114



>ref|XP_010472600.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDT+L+QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNPLKNATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>gb|KFK32501.1| hypothetical protein AALP_AA6G250900, partial [Arabis alpina]
Length=384

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++ D LGDTRL QTLT+V+IPTFDIK  +PTIF +++VK +P KNA L+DI 
Sbjct  101  YDGEYLHQLIHDLLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADIA  160

Query  9    IAT  1
            I+T
Sbjct  161  IST  163



>ref|XP_010417357.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDT+L+QTLT+V+IPTFDIK  +PTIF +++VK++P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T L +TLT+V+IPTFDIK  +PTIF T++ K+ P  +AKLSDIC
Sbjct  130  YNGKYLHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDIC  189

Query  9    IAT  1
            I+T
Sbjct  190  IST  192



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ RL QTLT+V+IPTFDIK+ +PTIF +++VK  P  NA LSDIC
Sbjct  124  YDGKYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T L +TLT+V+IPTFDIK  +PTIF T++ K+ P  +AKLSDIC
Sbjct  130  YNGKYLHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDIC  189

Query  9    IAT  1
            I+T
Sbjct  190  IST  192



>ref|NP_180224.1| phospholipase A 2A [Arabidopsis thaliana]
 sp|O48723.1|PLP2_ARATH RecName: Full=Patatin-like protein 2; Short=AtPLP2; AltName: 
Full=Patatin-related phospholipase A IIalpha; Short=pPLAIIa; 
AltName: Full=Phospholipase A IIA; Short=AtPLAIIA [Arabidopsis 
thaliana]
 gb|AAC14504.1| similar to latex allergen from Hevea brasiliensis [Arabidopsis 
thaliana]
 gb|AAL32722.1| similar to latex allergen [Arabidopsis thaliana]
 gb|AAM13304.1| similar to latex allergen [Arabidopsis thaliana]
 gb|AEC07858.1| phospholipase A 2A [Arabidopsis thaliana]
Length=407

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++  KLGDT+LSQTLT+V+IPTFDIK  +PTIF +++VK+ P K+A L+DI 
Sbjct  125  YDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010514711.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=409

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF +++VK +P KNA L+DI 
Sbjct  127  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKTNPLKNATLADIA  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQV+++KLGD RL +TLT++++PTFDIKT +P IF ++ +K SP  +AKLSDIC
Sbjct  128  YDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>gb|AAM63157.1| similar to latex allergen from Hevea brasiliensis [Arabidopsis 
thaliana]
Length=405

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++  KLGDT+LSQTLT+V+IPTFDIK  +PTIF +++VK+ P K+A L+DI 
Sbjct  123  YDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATLADIA  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_004288052.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++  +GD RLSQTLT+VIIPTFDIKT  P IF T+ V   P KNAKLSDIC
Sbjct  127  YDGKYLHKLIRSIVGDKRLSQTLTNVIIPTFDIKTLLPVIFSTYQVASYPVKNAKLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>gb|KDP38381.1| hypothetical protein JCGZ_04306 [Jatropha curcas]
Length=377

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD R+ QTLT V+IPTFDIK  +PTIF +++ K +P  NA LSDIC
Sbjct  125  YDGKYLHNIVKEKLGDIRIDQTLTHVVIPTFDIKHLQPTIFSSYEAKKNPSMNALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>gb|AAB08427.1| patatin homolog, partial [Nicotiana tabacum]
Length=263

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+VL+DKLG+TRL QTLT+V+IPTFD+K  +P IF   ++ +SP  +AK+SDIC
Sbjct  127  YDGKYLHKVLEDKLGETRLHQTLTNVVIPTFDMKKFQPIIFTKSEIANSPHLDAKMSDIC  186

Query  9    IAT  1
              T
Sbjct  187  YGT  189



>gb|KCW66173.1| hypothetical protein EUGRSUZ_F00009 [Eucalyptus grandis]
Length=224

 Score = 88.6 bits (218),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++D+LGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  124  YDGKYLHSVVRDELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009794856.1| PREDICTED: probable inactive patatin-3-Kuras 1, partial [Nicotiana 
sylvestris]
Length=224

 Score = 88.6 bits (218),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+VL+DKLG+TRL QTLT+V+IPTFD+K  +P IF   ++ +SP  +AK+SDIC
Sbjct  18   YDGKYLHKVLEDKLGETRLHQTLTNVVIPTFDMKKFQPIIFTKSEIANSPHLDAKMSDIC  77

Query  9    IAT  1
              T
Sbjct  78   YGT  80



>emb|CAN80453.1| hypothetical protein VITISV_028107 [Vitis vinifera]
Length=390

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++DKLGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  138  YDGKYLHSVVRDKLGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  197

Query  9    IAT  1
            I+T
Sbjct  198  IST  200



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ RL QTLT+V+IPTFDIK+ +PTIF +++VK  P  NA LSDIC
Sbjct  124  YDGKYLHELVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_010101004.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86652.1| Patatin group A-3 [Morus notabilis]
Length=407

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG T+L QTLT+V+IPTFDIK   PTIF ++ VK++P  +A LSDIC
Sbjct  123  YDGKYLHKLVKEKLGSTKLHQTLTNVVIPTFDIKQQHPTIFSSYGVKNNPSYDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++  LGDTRLSQTLT+V+IPTFDIK  +PTIF T+  K +P K+A LSDIC
Sbjct  133  YDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDIC  192

Query  9    IAT  1
            I T
Sbjct  193  IGT  195



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++  LGDTRLSQTLT+V+IPTFDIK  +PTIF T+  K +P K+A LSDIC
Sbjct  137  YDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDIC  196

Query  9    IAT  1
            I T
Sbjct  197  IGT  199



>ref|XP_010664584.1| PREDICTED: patatin-like protein 2 isoform X2 [Vitis vinifera]
 emb|CBI19548.3| unnamed protein product [Vitis vinifera]
Length=413

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_010064190.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=328

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++D+LGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  46   YDGKYLHSVVRDELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  105

Query  9    IAT  1
            I+T
Sbjct  106  IST  108



>ref|XP_002282481.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=413

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_002880809.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57068.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLHQ++++KLGDTRL QTLT+V+IP+FDIK  +PTIF T++VK  P KNA L+DI 
Sbjct  123  YDGHYLHQLIKEKLGDTRLDQTLTNVVIPSFDIKHLQPTIFTTYEVKTKPFKNALLADIS  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_010064133.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=361

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++D+LGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  124  YDGKYLHSVVRDELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>emb|CBI19552.3| unnamed protein product [Vitis vinifera]
Length=467

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  180  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDIC  239

Query  9    IAT  1
            I T
Sbjct  240  IGT  242



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+TRL+QTLT+V+IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGNTRLNQTLTNVVIPTFDIKRLQPTIFSSYQVKNKPCLDALLSDIC  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010269002.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++ KLG+TRL QTLT+++IPTFDIK  +PTIF +++VK S   +A+LSDIC
Sbjct  125  YDGKYLHSLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDIC  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>emb|CAN76066.1| hypothetical protein VITISV_001725 [Vitis vinifera]
Length=413

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KL DTRL QTLT V+IPTFDIK  +PTIF T+ VK+ P  +A LSDIC
Sbjct  123  YDGKYLHSLVREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_009133998.1| PREDICTED: patatin-like protein 2 [Brassica rapa]
Length=407

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF +++VK +P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADIT  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_006291236.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
 gb|EOA24134.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
Length=405

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL+QTLT+V+IPTFDIK  +P IF +++VK++P KNA L+DI 
Sbjct  123  YDGEYLHQLIHAKLGDTRLNQTLTNVVIPTFDIKHLQPMIFSSYEVKNNPLKNATLADIA  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L+DKL DTRL QTLT+V+IPTFDIK  +PTIF ++ V  +P  +AKL+DIC
Sbjct  120  YDGKYLHSLLKDKLRDTRLHQTLTNVVIPTFDIKELQPTIFSSYQVTTTPSLDAKLADIC  179

Query  9    IAT  1
            I+T
Sbjct  180  IST  182



>ref|XP_006434812.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48052.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=305

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  22   YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  81

Query  9    IAT  1
            +AT
Sbjct  82   VAT  84



>emb|CDY21469.1| BnaC03g27280D [Brassica napus]
Length=407

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF +++VK +P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADIT  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++ KLG+TRL QTLT+++IPTFDIK  +PTIF +++VK S   +A+LSDIC
Sbjct  125  YDGKYLHSLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDIC  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_006434814.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48054.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=300

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  22   YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  81

Query  9    IAT  1
            +AT
Sbjct  82   VAT  84



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T+L +TLT+V+IPTFDIK  +PTIF T++ K     NAKLSDIC
Sbjct  125  YNGKYLHQVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKHSIMNAKLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>gb|ACU21029.1| unknown [Glycine max]
Length=208

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++KLG+T+L QTLT+V+IP FDIK  +PTIF ++ +K  P+ NA LSDIC
Sbjct  45   YNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDIC  104

Query  9    IAT  1
            I+T
Sbjct  105  IST  107



>gb|KCW88897.1| hypothetical protein EUGRSUZ_A01223, partial [Eucalyptus grandis]
Length=404

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH ++++KLGD RL QTLT V+IPTFDIK  +PTIF T+ VK+ P  +A LSDIC
Sbjct  123  YDGNYLHSLVREKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KLGD RL +TLT+V+IPTFDIK+ +P IF ++ +K SP  +AKLSDIC
Sbjct  127  YDGKYLHEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYKLKISPCMDAKLSDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_010068219.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH ++++KLGD RL QTLT V+IPTFDIK  +PTIF T+ VK+ P  +A LSDIC
Sbjct  123  YDGNYLHSLVREKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_009590385.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=326

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+V+Q+KLG TRL +TLT++I+PTFDIK  +P +F T++ K+ P  +A+LSDIC
Sbjct  52   YNGKYLHKVIQEKLGQTRLCKTLTNIIVPTFDIKNLQPIVFSTFEAKEDPLMDARLSDIC  111

Query  9    IAT  1
            I+T
Sbjct  112  IST  114



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+TRL QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  126  YDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T + +TLT+V+IPTFDIK  +PTIF T++ ++ P  +AKLSDIC
Sbjct  126  YNGKYLHQVIKEKLGETYIHETLTNVVIPTFDIKNLQPTIFSTFEAREKPLMDAKLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V++++LGD RL QTLT+V+IPTFDIK+ +PTIF ++ VK  P  +A LSDIC
Sbjct  124  YDGKYLHKVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>gb|KHN41622.1| Patatin-06 [Glycine soja]
Length=247

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++KLG+T+L QTLT+V+IP FDIK  +PTIF ++ +K  P+ NA LSDIC
Sbjct  13   YNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDIC  72

Query  9    IAT  1
            I+T
Sbjct  73   IST  75



>gb|KCW66463.1| hypothetical protein EUGRSUZ_F00261 [Eucalyptus grandis]
Length=383

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+TRL+QTLT+V+IPTFD K  +PTIF +++VK  P  +A LSD+C
Sbjct  124  YDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_002510257.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52444.1| Patatin T5 precursor, putative [Ricinus communis]
Length=407

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH+V+++KLG+TRL QTL  VIIPTFDIK  +PT+F +++VK +P  NA LSDIC
Sbjct  123  YDGAYLHEVVREKLGETRLDQTLAHVIIPTFDIKRLQPTVFSSYEVKKNPSMNALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_010059968.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
Length=411

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+TRL+QTLT+V+IPTFD K  +PTIF +++VK  P  +A LSD+C
Sbjct  124  YDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++  LG+TRL QTLT+V+IPTFDIK  +PTIF ++ VK++P  +A+LSDIC
Sbjct  125  YDGKYLHELIRRNLGETRLHQTLTNVVIPTFDIKRLQPTIFSSYKVKNNPLLDARLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>ref|XP_006419185.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
 gb|ESR32425.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
Length=381

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>ref|XP_010068174.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88861.1| hypothetical protein EUGRSUZ_A01188 [Eucalyptus grandis]
Length=412

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH ++++KLGD RL QTLT V+IPTFDIK  +PTIF T+ VK+ P  +A LSDIC
Sbjct  123  YDGNYLHSLVREKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTFQVKNKPSIDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>ref|XP_006388386.1| hypothetical protein POPTR_0202s00230g, partial [Populus trichocarpa]
 gb|ERP47300.1| hypothetical protein POPTR_0202s00230g, partial [Populus trichocarpa]
Length=309

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLG+T+L QTLT+++IPTFDIK  +PTIF T+ +K++P  +A LSDIC
Sbjct  61   YDGKFLHSIVKEKLGNTQLHQTLTNIVIPTFDIKRLQPTIFSTYQLKNNPSTDALLSDIC  120

Query  9    IAT  1
            I T
Sbjct  121  IGT  123



>ref|XP_010064187.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66460.1| hypothetical protein EUGRSUZ_F00256 [Eucalyptus grandis]
Length=421

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ RL QTLT+V+IPTFDIK  +PTIF +++VK +P  +A LSDIC
Sbjct  124  YDGKYLHKLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009617802.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=343

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K S   +AKLSDIC
Sbjct  53   YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDIC  112

Query  9    IAT  1
            I+T
Sbjct  113  IST  115



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQV+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K +   +AKLSDIC
Sbjct  124  YDGKYLHQVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++  KLGD +L QTLT+V+IPTFDIK  +PTIF +++VK  P  +AKLSDIC
Sbjct  125  YDGKYLHDLVGQKLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+TRL+QTLT+V+IPTFD K  +PTIF +++VK  P  +A LSD+C
Sbjct  124  YDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_007017306.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14531.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLH ++++KLG+TRL QTLT+V+IPTFDIK  +P IF +++VK +P KNA LSDIC
Sbjct  136  YDGRYLHNIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKYNPCKNALLSDIC  195

Query  9    IAT  1
            I T
Sbjct  196  IGT  198



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+ RL QTLT+V+IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  123  YDGKYLHSIVKEKLGEKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_006488153.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
Length=408

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>gb|KCW66175.1| hypothetical protein EUGRSUZ_F00011 [Eucalyptus grandis]
Length=334

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++++LGD RL QTLT+++IPTFDIK+ +PTIF ++ VK  P  +A LSDIC
Sbjct  52   YDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDIC  111

Query  9    IAT  1
            I+T
Sbjct  112  IST  114



>emb|CDX83197.1| BnaA03g23090D [Brassica napus]
Length=407

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLGDTRL QTLT+V+IPTFDIK  +PTIF ++ VK +P KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYGVKKNPLKNATLADIT  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_010101001.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86649.1| Patatin group A-3 [Morus notabilis]
Length=408

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L++KLGD RL QTLT+V+IPTFDIK  +PTIF +++VK +P  +A LSDIC
Sbjct  123  YDGKYLHNLLREKLGDLRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKNPSLDALLSDIC  182

Query  9    IAT  1
              T
Sbjct  183  TGT  185



>ref|XP_006434815.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48055.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=408

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>ref|XP_010059971.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
 gb|KCW66465.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=334

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++++LGD RL QTLT+++IPTFDIK+ +PTIF ++ VK  P  +A LSDIC
Sbjct  52   YDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDIC  111

Query  9    IAT  1
            I+T
Sbjct  112  IST  114



>ref|XP_011030334.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=415

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK++P  +A LSDIC
Sbjct  133  YDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSDIC  192

Query  9    IAT  1
            I T
Sbjct  193  IGT  195



>ref|XP_010943124.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=223

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++++KLG  RL QTLT+V+IP FDIK  +PTIF +++VK++   +A+LSDIC
Sbjct  20   YDGKYLHQIVKEKLGSLRLHQTLTNVVIPAFDIKRLQPTIFSSYEVKNNALLDAELSDIC  79

Query  9    IAT  1
            I+T
Sbjct  80   IST  82



>ref|XP_006434813.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48053.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=403

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD +L +TLT+V+IPTFDIK  +PTIF ++++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>ref|XP_011030324.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=417

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK++P  +A LSDIC
Sbjct  135  YDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSDIC  194

Query  9    IAT  1
            I T
Sbjct  195  IGT  197



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KL DTRL QTLT V+IPTFDIK  +PTIF T+ VK+ P  +A LSDIC
Sbjct  123  YDGKYLHSLVREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDIC  182

Query  9    IAT  1
            IAT
Sbjct  183  IAT  185



>gb|KCW66458.1| hypothetical protein EUGRSUZ_F00254 [Eucalyptus grandis]
Length=423

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+ RL QTLT+V+IPTFDIK  +PTIF +++VK +P  +A LSDIC
Sbjct  124  YDGKYLHNLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>gb|KGN62540.1| hypothetical protein Csa_2G360570 [Cucumis sativus]
Length=321

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLGDT+L QTLT+V+IPTFDIK  +PTIF ++++K++P  +A LSDIC
Sbjct  26   YDGKYLRKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLDAYLSDIC  85

Query  9    IAT  1
            I+T
Sbjct  86   IST  88



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T L +TLT+V+IPTFDIK  +PTIF T++ +  P  +AKLSDIC
Sbjct  128  YNGKYLHQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KLG+TRL +TLT+++IPTFDIK  +PT+F T++ K++   +A+L+DIC
Sbjct  127  YDGKYLHKVIKEKLGETRLHETLTNIVIPTFDIKNLQPTVFTTFEAKENSLMDARLTDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_002284571.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=425

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+T+L QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  138  YDGKYLHNLVKEKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDALLSDIC  197

Query  9    IAT  1
            I T
Sbjct  198  IGT  200



>ref|XP_007160830.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
 gb|ESW32824.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
Length=407

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD +L QTLT+V+IP FDIK  +PTIF ++ VK  P  N KLSDIC
Sbjct  129  YDGKYLHNLVREKLGDIKLHQTLTNVVIPAFDIKHLQPTIFSSFQVKKRPHLNGKLSDIC  188

Query  9    IAT  1
            I+T
Sbjct  189  IST  191



>ref|XP_008228776.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=428

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++  KLGD +L QTLT+V+IPTFDIK  +PTIF +++VK  P  +AKLSDIC
Sbjct  125  YDGKYLHDLVGQKLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_007227183.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
 gb|EMJ28382.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
Length=383

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++ KLGDT++ QTLT+V+IPTFDIK  +PT+F ++ V+  P  NA LSD+C
Sbjct  101  YDGKYLHGLIRQKLGDTKMDQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYNALLSDVC  160

Query  9    IAT  1
            I T
Sbjct  161  IGT  163



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG TRL QTLT V+IPTFDIK+ +P+IF +++VK SP  +A L+DIC
Sbjct  124  YDGKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADIC  183

Query  9    IAT  1
            I +
Sbjct  184  IGS  186



>ref|XP_010101003.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86651.1| Patatin group A-3 [Morus notabilis]
Length=411

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L++KLGD +L QTLT+VIIPTFDIK  +P IF +++VK +P  +A LSDIC
Sbjct  124  YDGKYLHKLLKEKLGDLKLHQTLTNVIIPTFDIKRLQPIIFSSYEVKRNPSLDALLSDIC  183

Query  9    IAT  1
            I T
Sbjct  184  IGT  186



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG TRL QTLT V+IPTFDIK+ +P+IF +++VK SP  +A L+DIC
Sbjct  170  YDGKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADIC  229

Query  9    IAT  1
            I +
Sbjct  230  IGS  232



>gb|EMT15946.1| Patatin-3-Kuras 1 [Aegilops tauschii]
Length=333

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH  ++  LG+TRLS  LTDV+IPTFD+K  +P IF T+D K  P KNA+L+D+C
Sbjct  54   YNGKYLHGKIKSMLGETRLSDALTDVVIPTFDVKLLQPIIFSTYDAKSMPLKNARLADVC  113

Query  9    IAT  1
            I T
Sbjct  114  IGT  116



>gb|AAX99411.1| patatin-like protein [Gossypium hirsutum]
Length=434

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+T+L QTLT+V+IPTFDIK  +P IF T++VK  P  +A LSDIC
Sbjct  140  YDGKYLHDIVREKLGETKLHQTLTNVVIPTFDIKQLQPRIFSTYEVKSHPCTDALLSDIC  199

Query  9    IAT  1
            IAT
Sbjct  200  IAT  202



>emb|CBI19544.3| unnamed protein product [Vitis vinifera]
Length=460

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+T+L QTLT+V+IPTFDIK  +PTIF T+ VK  P  +A LSDIC
Sbjct  173  YDGKYLHNLVKEKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDALLSDIC  232

Query  9    IAT  1
            I T
Sbjct  233  IGT  235



>ref|XP_006388384.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
 gb|ERP47298.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
Length=332

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF  + VK++P  +A LSDIC
Sbjct  48   YDGKFLHSIVKEKLGDTWLRQTLTNIVIPTFDIKRLQPTIFSNYQVKNNPSTDALLSDIC  107

Query  9    IAT  1
            I T
Sbjct  108  IGT  110



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG TRL QTLT V+IPTFDIK+ +P+IF +++VK SP  +A L+DIC
Sbjct  125  YDGKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADIC  184

Query  9    IAT  1
            I +
Sbjct  185  IGS  187



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T L +TLT+V+IPTFDIK  +PTIF T++ +  P  +AKLSDIC
Sbjct  128  YNGKYLHQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>gb|AAB08428.1| patatin homolog [Nicotiana tabacum]
Length=390

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+VL+DKLG+TRL QTLT+V+IPTFD+K  +P IF   ++ +SP  +AK+SDIC
Sbjct  127  YDGKYLHKVLEDKLGETRLHQTLTNVVIPTFDMKKFQPIIFTKSEIANSPHLDAKMSDIC  186

Query  9    IAT  1
              T
Sbjct  187  YGT  189



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH V+++KLG+ R+ +TLT+++IPTFDIKTS+P IF ++ +K++P  +A+LSDIC
Sbjct  126  YDGNYLHSVVREKLGEIRVHETLTNIVIPTFDIKTSQPIIFSSYKIKNAPCMDARLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG TRL QTLT V+IPTFDIK+ +P+IF +++VK SP  +A L+DIC
Sbjct  125  YDGKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADIC  184

Query  9    IAT  1
            I +
Sbjct  185  IGS  187



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K S   +AKLSDIC
Sbjct  130  YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDIC  189

Query  9    IAT  1
            I+T
Sbjct  190  IST  192



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K S   +AKLSDIC
Sbjct  130  YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDIC  189

Query  9    IAT  1
            I+T
Sbjct  190  IST  192



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++++LGD RL QTLT+++IPTFDIK+ +PTIF ++ VK  P  +A LSDIC
Sbjct  146  YDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDIC  205

Query  9    IAT  1
            I+T
Sbjct  206  IST  208



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K S   +AKLSDIC
Sbjct  124  YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009370177.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=416

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLGD RL+ TLT+VIIPTFDIK  +PTIF +++ K     NA LSDIC
Sbjct  131  YDGKYLHEIVKEKLGDKRLNDTLTNVIIPTFDIKQLQPTIFSSYEAKKKSSINALLSDIC  190

Query  9    IAT  1
            IAT
Sbjct  191  IAT  193



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++++LGD RL QTLT+++IPTFDIK+ +PTIF ++ VK  P  +A LSDIC
Sbjct  124  YDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L++ LGD RL QTLT+V+IPTFDIK  +PTIF ++ V  +P  +AKLSDIC
Sbjct  127  YDGKYLHNLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_006374981.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
 gb|ERP52778.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
Length=417

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  135  YDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDIC  194

Query  9    IAT  1
            I T
Sbjct  195  IGT  197



>ref|XP_006645174.1| PREDICTED: patatin-2-Kuras 4-like [Oryza brachyantha]
Length=415

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++ D LGDTR+ +TLT+V+IPTFD+K  +P IF T+  +  P KNA+L+D+C
Sbjct  127  YDGKYLHKLINDLLGDTRMKETLTNVVIPTFDVKCVKPIIFSTFKARHKPLKNARLADVC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>gb|KHG27256.1| Patatin group M-3 [Gossypium arboreum]
Length=412

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH +++DKLG+TRL QTLT+V+IPTFDIK  +P IF ++ VK  P  +A L+DIC
Sbjct  124  YDGKFLHNIVKDKLGETRLHQTLTNVVIPTFDIKHLQPAIFSSYQVKKKPTLDALLTDIC  183

Query  9    IAT  1
            IAT
Sbjct  184  IAT  186



>ref|XP_006374977.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52774.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  133  YDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDIC  192

Query  9    IAT  1
            I T
Sbjct  193  IGT  195



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K +   +AKLSDIC
Sbjct  123  YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_006408594.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
 gb|ESQ50047.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
Length=407

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQ++  KLG+TRL QTLT+V+IPTFDIK  +PTIF +++VK++  KNA L+DI 
Sbjct  125  YDGEYLHQLIHAKLGETRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKNNSLKNATLADIA  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>ref|XP_006388385.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
 gb|ERP47299.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
Length=390

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF +++VK++P  +A LSDIC
Sbjct  126  YDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVKNNPSTDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K +   +AKLSDIC
Sbjct  124  YDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_010064186.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=431

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+ RL QTLT+V+IPTFDIK  +PTIF +++VK +P  +A LSDIC
Sbjct  124  YDGKYLHNLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KLG+ R+ +TLT+++IPTFDIKT +P IF ++ +K +P  +A+LSDIC
Sbjct  126  YDGKYLHEVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKIKKTPCMDARLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>ref|XP_006374973.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
 gb|ERP52770.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
Length=414

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  132  YDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDIC  191

Query  9    IAT  1
            I T
Sbjct  192  IGT  194



>ref|XP_006659498.1| PREDICTED: patatin-T5-like [Oryza brachyantha]
Length=422

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L++KLGDTRLS TLT+V+IPTFDI   +PTIF  +++K  P KNA LSDI 
Sbjct  130  YDGKYLHSILREKLGDTRLSDTLTNVVIPTFDIANLQPTIFSKFELKYKPLKNALLSDIS  189

Query  9    IAT  1
            I T
Sbjct  190  IGT  192



>ref|XP_010269043.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=381

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL  TRL QTLT+V++PTFDIK  +PTIF +++VK  P  +A LSDIC
Sbjct  123  YDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_002324124.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
 gb|EEF04257.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
Length=335

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF  + VK++P  +A LSDIC
Sbjct  52   YDGKFLHSIVKEKLGDTWLRQTLTNIVIPTFDIKRLQPTIFSNYQVKNNPSTDALLSDIC  111

Query  9    IAT  1
            I T
Sbjct  112  IGT  114



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF +++VK++P  +A LSDIC
Sbjct  126  YDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVKNNPSTDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLGDT+L QTLT+V+IPTFDIK  +PTIF ++++K++P  +A LSDIC
Sbjct  121  YDGKYLRKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLDAYLSDIC  180

Query  9    IAT  1
            I+T
Sbjct  181  IST  183



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL  TRL QTLT+V++PTFDIK  +PTIF +++VK  P  +A LSDIC
Sbjct  123  YDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L++ LGD RL QTLT+V+IPTFDIK  +PTIF ++ V  +P  +AKLSDIC
Sbjct  127  YDGKYLHNLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH V++++LGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  121  YNGKYLHSVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  180

Query  9    IAT  1
            I+T
Sbjct  181  IST  183



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH V++++LGD RL QTLT+V+IPTFDIK+ +PTIF ++ +K  P  +A LSDIC
Sbjct  124  YNGKYLHSVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLHQV+++KLG+T+L +TLT+V+IPTFDIK  +P +F T++ ++ P  +AKLSDIC
Sbjct  130  YNGKYLHQVIEEKLGETQLHETLTNVVIPTFDIKNLQPKVFSTFEAREKPLMDAKLSDIC  189

Query  9    IAT  1
             +T
Sbjct  190  AST  192



>ref|XP_006374978.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
 gb|ERP52775.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
Length=417

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++Q+KLGD RL QT+T+++IPTFDIK  +P IF ++ VK+ P  +A LSDIC
Sbjct  133  YDGKFLHSIVQEKLGDKRLHQTMTNIVIPTFDIKRLQPIIFSSYQVKNDPSTDALLSDIC  192

Query  9    IAT  1
            I T
Sbjct  193  IGT  195



>ref|XP_009409647.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=327

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH  +Q+ LGDT+LSQTLT+++IPTFDIK  +P +F T++ K +P K+A LSDIC
Sbjct  50   YDGKYLHSKIQELLGDTKLSQTLTNIVIPTFDIKLLQPIVFSTFETKYTPLKDALLSDIC  109

Query  9    IAT  1
            I T
Sbjct  110  IGT  112



>ref|XP_004310193.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD +L+QTLT+V+IP FDIK  +P IF +++VK+ P  +A LSDIC
Sbjct  125  YDGKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKNLQPAIFSSFEVKNKPTFDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_006372536.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
 gb|ERP50333.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
Length=368

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF + +VK++P  +A LSDIC
Sbjct  126  YDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_008245283.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=287

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L+ KLG+TR  QTLT+V+IPTFDIK  +PTIF +++VK  P  NA LSDI 
Sbjct  123  YDGKYLHNLLKQKLGNTRCQQTLTNVVIPTFDIKRLQPTIFSSFEVKSKPHLNALLSDIG  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_004291132.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD +L+QTLT+V+IP FDIK+ +P IF +++VK+ P  +A LSDIC
Sbjct  125  YDGKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKSLQPAIFSSFEVKNKPTFDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_009797489.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=333

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH+V+++KLG+T L +TLT+V+IP FDIK  +PTIF T++  ++P  +AKLSDIC
Sbjct  128  YGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH ++++KLGD +L +TLTDV+IPTFDIK+ +P IF +++VK+ P  +A LSDIC
Sbjct  125  YDGIYLHSLIKEKLGDVKLHETLTDVVIPTFDIKSLQPVIFSSYEVKNEPSLDASLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQV+++KLGD RL +TLT++++PTFDIKT +P IF ++ +K SP  +AKLSDI 
Sbjct  128  YDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIR  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_011017228.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011017229.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=405

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KL D RL QTLT+V+IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  123  YDGKYLHSIVKEKLRDKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_010061769.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW68764.1| hypothetical protein EUGRSUZ_F02363 [Eucalyptus grandis]
Length=395

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH+++++KLGDTRL QTLT+VIIPTFD+K  +PTIF ++ V  +P  +A +SDIC
Sbjct  118  YSGKYLHRLIKEKLGDTRLHQTLTNVIIPTFDVKQLQPTIFSSFQVNKNPSLDALVSDIC  177

Query  9    IAT  1
            I T
Sbjct  178  IGT  180



>ref|NP_001274813.1| patatin-like protein 1 [Solanum tuberosum]
 gb|ABB86254.1| patatin-like protein 1 [Solanum tuberosum]
Length=162

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL QV+++KLG+T+L +TLT+V+IPTFDIK  +PTIF T+  K     +AKLSDIC
Sbjct  53   YDGKYLRQVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFKAKKYSIMDAKLSDIC  112

Query  9    IAT  1
            I T
Sbjct  113  IGT  115



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +V+++KLG TRL +TLT+++IPTFDIKT +P IF ++ +K SP  +A+LSDIC
Sbjct  126  YDGKYLKEVVREKLGQTRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +LQ K+G T+L QTLT+V+IPTFDIK  +PTIF ++ +K+ P  +  LSDIC
Sbjct  124  YDGKYLHNLLQQKVGKTKLHQTLTNVVIPTFDIKLLQPTIFSSYAIKNEPSLDGVLSDIC  183

Query  9    IAT  1
            I T
Sbjct  184  IGT  186



>ref|XP_006374982.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
 gb|ERP52779.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
Length=417

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH + ++K+GD RL QT+T+++IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  135  YDGKFLHSIAKEKMGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSMDALLSDIC  194

Query  9    IAT  1
            I T
Sbjct  195  IGT  197



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH  +Q  LGDT+LSQTLT+V+IPTFDIK  +P IF T++ K +P K+A LSD+C
Sbjct  126  YDGKYLHSKVQQLLGDTKLSQTLTNVVIPTFDIKFLQPIIFSTFETKSTPLKDALLSDVC  185

Query  9    IAT  1
            ++T
Sbjct  186  VST  188



>ref|XP_008813727.1| PREDICTED: patatin-like protein 2, partial [Phoenix dactylifera]
Length=376

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQ++++KLG  +L QTLT+V+IPTFDIK  +PTIF +++VK++   +A LSDIC
Sbjct  123  YDGKYLHQIIKEKLGTLKLHQTLTNVVIPTFDIKKLQPTIFSSYEVKNNGLLDAHLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_006488152.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD +L +TLT+V+IPTFDIK  +PTIF + ++K +P  +A LSDIC
Sbjct  125  YDGKYLHHLVKEKLGDKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            +AT
Sbjct  185  VAT  187



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH+V+++KLG+T L +TLT+V+IP FDIK  +PTIF T++  ++P  +AKLSDIC
Sbjct  128  YGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++D L DTRL QTLT+V+IPTFDIK  +P IF ++ V ++P K+A LSDIC
Sbjct  125  YDGKYLHKLVRDILKDTRLHQTLTNVVIPTFDIKKIQPVIFSSYQVPNNPIKDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLHQV+++KLG+ RL +TLT++++PTFDIK   PTIF T++ K+    +A+LSD+C
Sbjct  126  YDGRYLHQVVREKLGEIRLHETLTNIVVPTFDIKNLHPTIFSTYEAKEKKSMDARLSDLC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>ref|XP_007017307.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14532.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=410

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDTRL QTLT+V+IPTFDI   +PTIF ++ VK  P  +A LSDIC
Sbjct  124  YDGKFLHSLVKEKLGDTRLHQTLTNVVIPTFDIHHLQPTIFSSYQVKTKPTLDALLSDIC  183

Query  9    IAT  1
            I T
Sbjct  184  IGT  186



>gb|AGS13487.1| PLP protein [Chimonanthus praecox]
Length=376

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG YLH ++ +KLG+TRLSQ LT V+IPTFDIK  +P +F ++ ++  P  NAKLSDIC
Sbjct  112  YDGTYLHNLINEKLGETRLSQALTHVVIPTFDIKLLQPAVFSSYKIETKPSMNAKLSDIC  171

Query  9    IAT  1
            I T
Sbjct  172  IGT  174



>ref|XP_006372534.1| hypothetical protein POPTR_0017s025303g, partial [Populus trichocarpa]
 gb|ERP50331.1| hypothetical protein POPTR_0017s025303g, partial [Populus trichocarpa]
Length=258

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y G +LH ++++KLGDTRL QTLT+++IPTFDIK  +PTIF ++ VK++P  +A LSDIC
Sbjct  59   YYGNFLHSIVKEKLGDTRLHQTLTNIVIPTFDIKRLQPTIFSSYKVKNNPLTDALLSDIC  118

Query  9    IAT  1
            I T
Sbjct  119  IGT  121



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF + +VK++P  +A LSDIC
Sbjct  126  YDGKFLHGIVKEKLGDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +T+T+++IPTFDIK+ +P IF ++ ++ SP  +AKLSDIC
Sbjct  82   YDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDIC  141

Query  9    IAT  1
            I+T
Sbjct  142  IST  144



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF + +VK++P  +A LSDIC
Sbjct  127  YDGKFLHGIVKEKLGDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH  +Q+ LG+TRL Q LTD++IPTFDIK  +PTIF T++ + +P K+A LSDIC
Sbjct  125  YSGKYLHSKIQELLGETRLHQVLTDIVIPTFDIKLLQPTIFSTFEARHAPLKDALLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>ref|XP_006434817.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
 gb|ESR48057.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
Length=408

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ +L +TLT+V+IPTFDIK  +PTIF + ++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V++++LGD RL QTLT+V+IPTFDIK+ +PTIF ++ VK  P  +A L DIC
Sbjct  124  YDGKYLHKVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKRDPSVDALLWDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+ +L +TLT+V+IPTFDIK  +PTIF + ++K +P  +A LSDIC
Sbjct  125  YDGKYLHRLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH+V+++KLG T L +TLT+V+IPTFDIK  +PTIF +++ + +P  +AKLSDIC
Sbjct  131  YAGKYLHKVIKEKLGGTHLHETLTNVVIPTFDIKNMQPTIFSSYEARKNPLMDAKLSDIC  190

Query  9    IAT  1
            I+T
Sbjct  191  IST  193



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +T+T+++IPTFDIK+ +P IF ++ ++ SP  +AKLSDIC
Sbjct  128  YDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_006374976.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52773.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK LH ++++KLGD RL QT+T+++IPTFDIK  +PTIF ++ VK+ P  +A LSDIC
Sbjct  133  YDGKILHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDIC  192

Query  9    IAT  1
            I T
Sbjct  193  IGT  195



>ref|XP_007160831.1| hypothetical protein PHAVU_001G020200g [Phaseolus vulgaris]
 gb|ESW32825.1| hypothetical protein PHAVU_001G020200g [Phaseolus vulgaris]
Length=402

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL ++++D+LGDTRL QTLT+V+IP FDIK  +PTIF ++ V+  P+ N  LSDIC
Sbjct  119  YDGKYLRKLIRDELGDTRLDQTLTNVVIPAFDIKRLQPTIFSSFQVETRPDLNGLLSDIC  178

Query  9    IAT  1
            I+T
Sbjct  179  IST  181



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V+++KLGD RL +T+T+++IPTFDIK+ +P IF ++ ++ SP  +AKLSDIC
Sbjct  128  YDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDIC  187

Query  9    IAT  1
            I+T
Sbjct  188  IST  190



>ref|XP_003544451.1| PREDICTED: patatin-05-like [Glycine max]
Length=408

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++KLG+T+L QTLT+V+IP FDIK  +PTIF ++ +K  P+ NA LSDIC
Sbjct  127  YNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_003544453.1| PREDICTED: patatin-05 [Glycine max]
Length=408

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++KLG+T+L QTLT+V+IP FDIK  +PTIF ++ +K  P+ NA LSDIC
Sbjct  127  YNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>gb|EMS59852.1| Patatin-3-Kuras 1 [Triticum urartu]
Length=328

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH  ++  LG+TRL   LTDV+IPTFD+K  +P IF T+D K  P KNA+L+DIC
Sbjct  49   YSGKYLHGKIRSMLGETRLCDALTDVVIPTFDVKLLQPIIFSTYDAKSMPLKNARLADIC  108

Query  9    IAT  1
            I T
Sbjct  109  IGT  111



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V+++KL D+ LS T+T+V+IPTFDIK  +PTIF T++ K S   +AKLSDIC
Sbjct  124  YDGKYLHEVIKEKLKDSLLSNTITNVVIPTFDIKKLQPTIFSTYETKRSARYDAKLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++ LG+TRL Q LT+++IPTFDIK  +PTIF T++ + +P K++ LSDIC
Sbjct  200  YDGKYLHSIIRELLGETRLHQALTNIVIPTFDIKLLQPTIFSTFEARHAPLKDSLLSDIC  259

Query  9    IAT  1
            I+T
Sbjct  260  IST  262



>ref|XP_004152795.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++++K +   +A LSDIC
Sbjct  122  YDGKYLHRLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDIC  181

Query  9    IAT  1
            I+T
Sbjct  182  IST  184



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++D L DTRL QTLT+V+IPTFDIK  +P IF ++ V +SP  +A LSDIC
Sbjct  125  YDGKYLHKLVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_004160046.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++++K +   +A LSDIC
Sbjct  122  YDGKYLHRLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDIC  181

Query  9    IAT  1
            I+T
Sbjct  182  IST  184



>ref|XP_006601293.1| PREDICTED: patatin-11-like [Glycine max]
 gb|KHN12763.1| Patatin group A-3 [Glycine soja]
Length=408

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++KLGDT+L QTLT+V+IP FDIK  +P IF ++ +K  P+ NA LSDIC
Sbjct  127  YNGKYLHKLIREKLGDTKLHQTLTNVVIPAFDIKHLQPAIFSSFQLKKRPDLNASLSDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++D L DTRL QTLT+V+IPTFDIK  +P IF ++ V +SP  +A LSDIC
Sbjct  125  YDGKYLHKLVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_007017305.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14530.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YL  ++++KLG TRL QTLT+V+IPTFDIK  +P +F + +VK++P  NA LSD+C
Sbjct  136  YDGRYLQNIVREKLGGTRLHQTLTNVVIPTFDIKQLQPKVFSSLEVKNNPSINALLSDVC  195

Query  9    IAT  1
            I T
Sbjct  196  IGT  198



>gb|ACR34670.1| unknown [Zea mays]
Length=249

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V  D LG TR+ +TLT+V+IPTFD+K  +PTIF T+  + S   NA+L+D+C
Sbjct  127  YDGKYLHKVTSDLLGGTRVEETLTNVVIPTFDVKCVKPTIFSTFKARSSALMNARLADVC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_008360670.1| PREDICTED: patatin-like protein 3 [Malus domestica]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL  + ++ LGD  L QTLT+VIIPTFDIK  +P +F T D K+SP KNAKLSDIC
Sbjct  42   YDGKYLRTLTKELLGDLTLKQTLTNVIIPTFDIKHLQPVLFSTIDAKESPLKNAKLSDIC  101

Query  9    IAT  1
            I+T
Sbjct  102  IST  104



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YD KYLH +++DKLG+TRL  T+T+++IPTFDIK  +PT+F +++V+ SP+ + KLSDIC
Sbjct  155  YDEKYLHGLMRDKLGETRLHDTVTNLVIPTFDIKRLQPTVFSSYEVRSSPDLDVKLSDIC  214

Query  9    IAT  1
            I T
Sbjct  215  IGT  217



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH V++++LGD RL QTLT+V+IPTFDIK+ +PTIF ++ VK     +A LSDIC
Sbjct  124  YDGKYLHNVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDRSVDALLSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  124  YDGKYLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  183

Query  9    IAT  1
            I +
Sbjct  184  IGS  186



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYL +V+++K+G+TRL +TLT+++IPTFDIKT +P IF ++ +K SP  +A+LSDIC
Sbjct  126  YNGKYLQEVVREKVGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>emb|CDP01337.1| unnamed protein product [Coffea canephora]
Length=407

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L+ KLG+T+L QTLT+V+IPTFDIK  +PTIF ++ +K  P  +A L DIC
Sbjct  124  YDGKYLHNLLKQKLGETKLHQTLTNVVIPTFDIKLLQPTIFSSYALKHHPSLDALLRDIC  183

Query  9    IAT  1
            I T
Sbjct  184  IGT  186



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLHQV+++KLGD RL +TLT++++PTFDIKT +P IF ++  + SP  +AKLSDIC
Sbjct  128  YDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSY--QRSPCLDAKLSDIC  185

Query  9    IAT  1
            I+T
Sbjct  186  IST  188



>ref|XP_007224534.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
 gb|EMJ25733.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
Length=399

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L+ KLG+TR  QTLT+V+IPTFDIK  +PTIF +++VK  P  NA LSDI 
Sbjct  123  YDGKYLHNLLKQKLGNTRCQQTLTNVVIPTFDIKRLQPTIFSSFEVKSKPHLNALLSDIG  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>dbj|BAK06341.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y GKYLH  ++  LG+TRL   LTDV+IPTFD+K  +P IF T+D ++ P KNA+L+DIC
Sbjct  136  YSGKYLHGKIRSMLGETRLCDALTDVVIPTFDVKLLQPIIFSTYDARNMPLKNARLADIC  195

Query  9    IAT  1
            I T
Sbjct  196  IGT  198



>gb|KGN62539.1| hypothetical protein Csa_2G360560 [Cucumis sativus]
Length=329

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++++K +   +A LSDIC
Sbjct  38   YDGKYLHRLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDIC  97

Query  9    IAT  1
            I+T
Sbjct  98   IST  100



>gb|EEE68593.1| hypothetical protein OsJ_27119 [Oryza sativa Japonica Group]
Length=332

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YL  ++Q+ LGDTR+SQ +T+V+IPTFDIK  +PTIF  +D +    KNA LSD+C
Sbjct  49   YDGRYLRSIVQELLGDTRISQAITNVVIPTFDIKLLQPTIFSRFDAQKDASKNALLSDVC  108

Query  9    IAT  1
            I+T
Sbjct  109  IST  111



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  186  DGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDICI  7
            DGKYLH+V+++KL DTRLS T+T+V+IPTFDIK  +PTIF T++ K +   +AKLSDICI
Sbjct  124  DGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICI  183

Query  6    AT  1
             T
Sbjct  184  GT  185



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  124  YDGKYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  183

Query  9    IAT  1
            I +
Sbjct  184  IGS  186



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF ++ VK++P  +  LSDIC
Sbjct  126  YDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDVLLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLGDT L QTLT+++IPTFDIK  +PTIF ++ VK++P  +  LSDIC
Sbjct  127  YDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDVLLSDIC  186

Query  9    IAT  1
            I T
Sbjct  187  IGT  189



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGK+LH ++++KLG+ +L QTLT+++IPTFDIK  +PTIF T+ VK++P  +  LSDIC
Sbjct  126  YDGKFLHSIVKEKLGNIQLHQTLTNIVIPTFDIKRLQPTIFSTYQVKNNPSTDTLLSDIC  185

Query  9    IAT  1
            I T
Sbjct  186  IGT  188



>ref|XP_010548405.1| PREDICTED: patatin-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=383

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L+  LGD RL QTLT+V+IPTFDIK  +P IF ++ +   P  +AKLSDIC
Sbjct  125  YDGKYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIFSSYQILSDPALDAKLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>emb|CAN71270.1| hypothetical protein VITISV_001906 [Vitis vinifera]
Length=306

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG+ RL QTLT V+IPTFDIK  +PTIF ++ VK  P  +A LSDIC
Sbjct  123  YNGKYLHSLVREKLGNIRLHQTLTKVVIPTFDIKLLQPTIFSSFKVKHDPTIDASLSDIC  182

Query  9    IAT  1
            + T
Sbjct  183  MGT  185



>gb|AAK18751.1| patatin-like protein [Vigna unguiculata]
 gb|AAK27797.1| patatin-like protein [Vigna unguiculata]
Length=400

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+++++KLG+T+L  TLT+V+IP FDIK  +P IF ++ VK  P  NA LSDIC
Sbjct  124  YDGKYLHKLVREKLGNTKLEHTLTNVVIPAFDIKNLQPAIFSSFQVKKRPYLNAALSDIC  183

Query  9    IAT  1
            I+T
Sbjct  184  IST  186



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  124  YDGKYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  183

Query  9    IAT  1
            I +
Sbjct  184  IGS  186



>gb|EAZ06806.1| hypothetical protein OsI_29050 [Oryza sativa Indica Group]
Length=442

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YL  ++Q+ LGDTR+SQ +T+V+IPTFDIK  +PTIF  +D +    KNA LSD+C
Sbjct  159  YDGRYLRSIVQELLGDTRISQAITNVVIPTFDIKLLQPTIFSRFDAQKDASKNALLSDVC  218

Query  9    IAT  1
            I+T
Sbjct  219  IST  221



>ref|XP_010269079.1| PREDICTED: patatin-like protein 2 isoform X3 [Nelumbo nucifera]
Length=324

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG +RL  TLT+V+IPTFDIK  +PTIF +++VK  P  +A+LSDIC
Sbjct  123  YNGKYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++DKLG+ RL  TLT VIIPTFDI+  +PTIF +++V  SP  +A+LSDIC
Sbjct  122  YDGKYLHGLIKDKLGEARLHDTLTHVIIPTFDIERLQPTIFSSYEVVRSPCLDARLSDIC  181

Query  9    IAT  1
            I T
Sbjct  182  IGT  184



>ref|XP_010548404.1| PREDICTED: patatin-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=407

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L+  LGD RL QTLT+V+IPTFDIK  +P IF ++ +   P  +AKLSDIC
Sbjct  125  YDGKYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIFSSYQILSDPALDAKLSDIC  184

Query  9    IAT  1
            I T
Sbjct  185  IGT  187



>emb|CDP07842.1| unnamed protein product [Coffea canephora]
Length=409

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L++KLG+TRL +TLT+V+IPTFD+K  +P IF T++    P  +A+LSDIC
Sbjct  134  YDGKYLHKILKEKLGETRLRKTLTNVVIPTFDVKCLQPIIFSTFEDAKYPLLDARLSDIC  193

Query  9    IAT  1
            I+T
Sbjct  194  IST  196



>ref|XP_008220197.1| PREDICTED: patatin-like protein 2 isoform X2 [Prunus mume]
Length=331

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L++KLGD  L  TLT+V+IPTFDIK  +P IF  +++K  P  +A LSDIC
Sbjct  123  YDGKYLHKILKEKLGDKHLRDTLTNVVIPTFDIKRLQPVIFSNYELKKKPSLDALLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++  KLG  +L QTLT+V+IPTFDIK  +PTIF +++VK  P  +A LSDIC
Sbjct  125  YDGKYLHDLVGQKLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPSFDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_008393824.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=326

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++  KLG  +L QTLT+V+IPTFDIK  +PTIF +++VK  P  +A LSDIC
Sbjct  125  YDGKYLHDLVGQKLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPFFDALLSDIC  184

Query  9    IAT  1
            IAT
Sbjct  185  IAT  187



>ref|XP_003523877.1| PREDICTED: uncharacterized protein LOC100804004 [Glycine max]
Length=248

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL  V+++KLGD RL +TLT+V I TFDIK+ +P IF ++ +K+SP  +AKLSDIC
Sbjct  115  YDGKYLDGVVREKLGDIRLHETLTNVFISTFDIKSLQPIIFSSYQIKNSPSLDAKLSDIC  174

Query  9    IAT  1
            I+T
Sbjct  175  IST  177



>sp|Q6ZJD3.1|PLP2_ORYSJ RecName: Full=Patatin-like protein 2; Short=OsPLP2 [Oryza sativa 
Japonica Group]
 sp|A2YW91.1|PLP2_ORYSI RecName: Full=Patatin-like protein 2 [Oryza sativa Indica Group]
 dbj|BAD08998.1| putative patatin [Oryza sativa Japonica Group]
 gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group]
 gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group]
Length=405

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +L++KLGDTRL + LT+V+IPTFDI   +PTIF  +++K  P KNA LSDI 
Sbjct  127  YDGKYLHSLLREKLGDTRLDKALTNVVIPTFDIANLQPTIFSKFELKYKPLKNALLSDIS  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_010269072.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG +RL  TLT+V+IPTFDIK  +PTIF +++VK  P  +A+LSDIC
Sbjct  123  YNGKYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL ++ ++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  118  YDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  177

Query  9    IAT  1
            I +
Sbjct  178  IGS  180



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD RL+ TLT+VIIPTFDIK  +PTIF +++ K     +A LSDIC
Sbjct  130  YDGKYLHNIVKEKLGDKRLNDTLTNVIIPTFDIKRLQPTIFSSYEAKKKSCVDALLSDIC  189

Query  9    IAT  1
            IAT
Sbjct  190  IAT  192



>ref|XP_004291130.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=419

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLGD +L++TLT+V+IPTFDIK  +PTIF + +VK  P  +A L DIC
Sbjct  127  YDGKYLHNLVREKLGDKKLNKTLTNVVIPTFDIKQLQPTIFSSLEVKSKPCSDAFLRDIC  186

Query  9    IAT  1
            IAT
Sbjct  187  IAT  189



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+ R+ +TLT+++IPTFDIKT +P IF ++ VK +P  +A+LSDIC
Sbjct  121  YDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSDIC  180

Query  9    IAT  1
            I T
Sbjct  181  IGT  183



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH ++++KLG+ R+ +TLT+++IPTFDIKT +P IF ++ VK +P  +A+LSDIC
Sbjct  128  YDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSDIC  187

Query  9    IAT  1
            I T
Sbjct  188  IGT  190



>ref|XP_002510260.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52447.1| Patatin T5 precursor, putative [Ricinus communis]
Length=405

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++ VK     NA LSD+C
Sbjct  125  YNGKYLHNLVKEKLGNTKLNQTLTNVVIPTFDIKRLQPTVFSSFQVKKDSSLNALLSDVC  184

Query  9    IAT  1
            I+T
Sbjct  185  IST  187



>emb|CBI19554.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG+ RL QTLT V+IPTFDIK  +PTIF ++ VK  P  +A LSDIC
Sbjct  123  YNGKYLHSLVREKLGNIRLHQTLTKVVIPTFDIKLLQPTIFSSFKVKHDPTIDASLSDIC  182

Query  9    IAT  1
            + T
Sbjct  183  MGT  185



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L+  LGD RL QTLT+++IPTFDIK   PTIF ++ +   P  +AKLSDIC
Sbjct  118  YDGKYLHELLRKLLGDKRLHQTLTNIVIPTFDIKKLNPTIFSSYKILTDPTLDAKLSDIC  177

Query  9    IAT  1
            I+T
Sbjct  178  IST  180



>ref|XP_008220177.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=406

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH +++ KLGD ++ QTLT+V+IPTFDIK  +PT+F ++ V+  P  +A LSD+C
Sbjct  124  YDGKYLHGLIRQKLGDKKMHQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYDALLSDVC  183

Query  9    IAT  1
            I T
Sbjct  184  IGT  186



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL ++ ++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  129  YDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  188

Query  9    IAT  1
            I +
Sbjct  189  IGS  191



>ref|XP_008220196.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=403

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++L++KLGD  L  TLT+V+IPTFDIK  +P IF  +++K  P  +A LSDIC
Sbjct  123  YDGKYLHKILKEKLGDKHLRDTLTNVVIPTFDIKRLQPVIFSNYELKKKPSLDALLSDIC  182

Query  9    IAT  1
            I T
Sbjct  183  IGT  185



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG  RL +TLT+++IPTFDIK  +PTIF +++VK  P  +A LSDIC
Sbjct  127  YNGKYLHGLVREKLGKRRLHETLTNIVIPTFDIKQLQPTIFSSYEVKKQPSLDALLSDIC  186

Query  9    IAT  1
            I+T
Sbjct  187  IST  189



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH ++++KLG +RL  TLT+V+IPTFDIK  +PTIF +++VK  P  +A+LSDIC
Sbjct  123  YNGKYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDIC  182

Query  9    IAT  1
            I+T
Sbjct  183  IST  185



>gb|EMS48009.1| Patatin-3-Kuras 1 [Triticum urartu]
Length=314

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y G++LH +L+ +LGDTR+SQTL  ++IPTFDIK  +P IF T+D K    KNA LSD+C
Sbjct  45   YSGQHLHSILKKQLGDTRISQTLKSIVIPTFDIKLLQPIIFSTYDAKKDVSKNALLSDVC  104

Query  9    IAT  1
            I+T
Sbjct  105  IST  107



>ref|XP_008444642.1| PREDICTED: patatin-like protein 2 isoform X2 [Cucumis melo]
Length=412

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLH+++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++++K +   +A LSDIC
Sbjct  121  YDGEYLHKLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDIC  180

Query  9    IAT  1
            I+T
Sbjct  181  IST  183



>ref|NP_001061678.1| Os08g0376500 [Oryza sativa Japonica Group]
 dbj|BAC45096.1| putative patatin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAD05294.1| putative patatin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAF23592.1| Os08g0376500 [Oryza sativa Japonica Group]
Length=442

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YL  ++Q+ LGDTR+SQ +T+V+IPTFDIK  +PTIF  +D +    KNA LSD+C
Sbjct  159  YDGRYLRSIVQELLGDTRISQAITNVVIPTFDIKLLQPTIFSRFDAQKDASKNALLSDVC  218

Query  9    IAT  1
            I+T
Sbjct  219  IST  221



>gb|ACF87158.1| unknown [Zea mays]
 tpg|DAA56334.1| TPA: hypothetical protein ZEAMMB73_796575 [Zea mays]
Length=300

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH+V  D LG TR+ +TLT+V+IPTFD+K  +PTIF T+  + S   NA+L+D+C
Sbjct  6    YDGKYLHKVTSDLLGGTRVEETLTNVVIPTFDVKCVKPTIFSTFKARSSALMNARLADVC  65

Query  9    IAT  1
            I T
Sbjct  66   IGT  68



>ref|XP_008444641.1| PREDICTED: patatin-like protein 2 isoform X1 [Cucumis melo]
Length=413

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDG+YLH+++++KLG+T+L+QTLT+V+IPTFDIK  +PT+F ++++K +   +A LSDIC
Sbjct  122  YDGEYLHKLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDIC  181

Query  9    IAT  1
            I+T
Sbjct  182  IST  184



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH +L++KLG+TRL Q LT+V+IPTFD+K  +P IF +++ K +   +A+LSDIC
Sbjct  128  YNGKYLHGILREKLGETRLHQALTNVVIPTFDVKQLQPIIFSSFEAKTTSAMDARLSDIC  187

Query  9    IAT  1
            IAT
Sbjct  188  IAT  190



>ref|XP_008813725.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008813726.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
Length=336

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            Y+GKYLH+++++ LG  RL QTLT+V+IPTFDIK   PTIF +++VK     NA+LSDIC
Sbjct  52   YNGKYLHKLIRENLGSMRLHQTLTNVVIPTFDIKRLHPTIFSSYEVKRKSILNAQLSDIC  111

Query  9    IAT  1
            I T
Sbjct  112  IGT  114



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL ++ ++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  155  YDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  214

Query  9    IAT  1
            I +
Sbjct  215  IGS  217



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYL +++++KLG TRL +TLT V+IPTFDIK+ +PTIF T++VK SP  +A L+DIC
Sbjct  124  YDGKYLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADIC  183

Query  9    IAT  1
            I +
Sbjct  184  IGS  186



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  YDGKYLHQVLQDKLGDTRLSQTLTDVIIPTFDIKTSEPTIFITWDVKDSPEKNAKLSDIC  10
            YDGKYLH++++ KLGDT+  QTLT+V+IPTFDIKT +PTIF ++ +      + +LSDIC
Sbjct  126  YDGKYLHELIRKKLGDTKFHQTLTNVVIPTFDIKTLQPTIFSSFKIATEATLDVELSDIC  185

Query  9    IAT  1
            IAT
Sbjct  186  IAT  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524026180552