BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13901_g2_i1 len=395 path=[1:0-180 182:181-394]

Length=395
                                                                      Score     E

gb|AGB85110.1|  ADP-glucose pyrophosphorylase large subunit 2           112   3e-26   
gb|AFL55397.1|  ADP-glucose pyrophosphorylase large subunit 2           110   1e-25   
dbj|BAF47747.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1B    109   2e-25   Ipomoea batatas [batate]
gb|AGB85109.1|  ADP-glucose pyrophosphorylase large subunit 1         70.1    3e-11   
dbj|BAF47746.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1A  70.1    3e-11   Ipomoea batatas [batate]
gb|AAC21562.1|  ADP-glucose pyrophosphorylase large subunit           69.7    3e-11   Ipomoea batatas [batate]
gb|AFL55396.1|  ADP-glucose pyrophosphorylase large subunit 1         66.2    6e-10   
gb|AAF66436.1|AF249917_1  ADP-glucose pyrophosphorylase large sub...  63.9    3e-09   Perilla frutescens [beefsteak-mint]
ref|XP_011015433.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  63.9    3e-09   
ref|XP_011048155.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  63.9    4e-09   
ref|XP_010690849.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  63.5    5e-09   
ref|XP_002313036.1|  ADP-glucose pyrophosphorylase large subunit ...  61.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011037496.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  56.2    2e-06   
ref|XP_002283855.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  54.3    5e-06   Vitis vinifera
gb|ABC26921.1|  ADPglucose pyrophosphorylase large subunit            53.9    7e-06   Solanum lycopersicum
ref|XP_006365120.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  53.5    1e-05   
ref|XP_011088418.1|  PREDICTED: glucose-1-phosphate adenylyltrans...  50.4    9e-05   
gb|KDO41993.1|  hypothetical protein CISIN_1g0097202mg                46.6    1e-04   
gb|AGS94412.1|  ADP-glucose pyrophosphorylase large subunit 4         50.1    2e-04   
emb|CDO97030.1|  unnamed protein product                              48.9    4e-04   



>gb|AGB85110.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPRENELWGKRMINNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            MDAYCATLKSTTHLPRE+ELWGKRM+ N VLVN FGKSLKLERNGRKIKPGVAFSV
Sbjct  1    MDAYCATLKSTTHLPRESELWGKRMLKNRVLVNQFGKSLKLERNGRKIKPGVAFSV  56



>gb|AFL55397.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPRENELWGKRMINNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            MDAYCATLKSTTHLPRE+ELWGKRM+  SV+VN FGKSLKLERNGRKIKPGVAFSV
Sbjct  1    MDAYCATLKSTTHLPRESELWGKRMLKTSVVVNQFGKSLKLERNGRKIKPGVAFSV  56



>dbj|BAF47747.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1B [Ipomoea 
batatas]
Length=515

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPRENELWGKRMINNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            MDAYCATLKSTTHLPRE+ELWGKRM+ N VLV  FGKSLKLERNGRKIKPGVAFSV
Sbjct  1    MDAYCATLKSTTHLPRESELWGKRMLKNRVLVKQFGKSLKLERNGRKIKPGVAFSV  56



>gb|AGB85109.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -3

Query  159  YCATLKSTTHLPRENELWGKRM---INNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            +CATLKS+ HLPRE E +G R+   +NN+VL++   KSL+L+ N RKIKPGVAFSV
Sbjct  3    FCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSV  58



>dbj|BAF47746.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1A [Ipomoea 
batatas]
Length=517

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -3

Query  159  YCATLKSTTHLPRENELWGKRM---INNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            +CATLKS+ HLPRE E +G R+   +NN+VL++   KSL+L+ N RKIKPGVAFSV
Sbjct  3    FCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSV  58



>gb|AAC21562.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=517

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -3

Query  159  YCATLKSTTHLPRENELWGKRM---INNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            +CATLKS+ HLPRE E +G R+   +NN+VL++   KSL+L+ N RKIKPGVAFSV
Sbjct  3    FCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSV  58



>gb|AFL55396.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -3

Query  159  YCATLKSTTHLPRENELWGKRM---INNSVLVNPFGKSLKLERNGRKIKPGVAFSV  1
            +C TLKS+ HLPRE E +G R+   +NN+VL +   KSL+++ N RKIKPGVAFSV
Sbjct  3    FCPTLKSSAHLPRETEFFGGRIRGSLNNNVLASKSRKSLRVDGNKRKIKPGVAFSV  58



>gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens]
Length=527

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLP---------RENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MDA CATLKST+HL           +N  WG+++   +NN      FGK L LE+ GRKI
Sbjct  1    MDACCATLKSTSHLSNVSKSAFCGEKNGFWGEKIKGSLNNCARAYQFGKKLNLEKRGRKI  60

Query  24   KPGVAFSV  1
            KPGVA+SV
Sbjct  61   KPGVAYSV  68



>ref|XP_011015433.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015434.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015435.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ CATLK+TTH+ +         + E WG+R+   +NNSV VN   KSLK++++  K 
Sbjct  1    MDSCCATLKATTHVAKASKGGFNNGDKEFWGERIRGSLNNSVWVNQLAKSLKVDKSVNKF  60

Query  24   KPGVAFSV  1
            KPGVAFSV
Sbjct  61   KPGVAFSV  68



>ref|XP_011048155.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=540

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ CATLK+TTH+ +         + E WG+R+   +NNSV VN   KSLK++++  K 
Sbjct  1    MDSCCATLKATTHVAKASKGGFNNGDKEFWGERIRGSLNNSVWVNQLAKSLKVDKSVNKF  60

Query  24   KPGVAFSV  1
            KPGVAFSV
Sbjct  61   KPGVAFSV  68



>ref|XP_010690849.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 9/65 (14%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKIKPG  16
            MD+YCATL  +THL R      E+  WG+R+   + ++VLVN    SLK+++  RKIKPG
Sbjct  1    MDSYCATLGGSTHLTRTGKRDGESGFWGERISGSLKSNVLVNKLSMSLKIDQRIRKIKPG  60

Query  15   VAFSV  1
            VAFSV
Sbjct  61   VAFSV  65



>ref|XP_002313036.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86991.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=527

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ CATLK+ TH+ +         + E WG+R+    NNSV VN   KSLK++++  K 
Sbjct  1    MDSCCATLKANTHVAKASKGGFNNGDKEFWGERIRGSFNNSVWVNQLAKSLKVDKSVNKF  60

Query  24   KPGVAFSV  1
            KPGVAFSV
Sbjct  61   KPGVAFSV  68



>ref|XP_011037496.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011037497.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ C  L++ TH+ +         + E WG+R+    NNSV VN F KSLK++++  K 
Sbjct  1    MDSCCVALRANTHVAKASKGGFNNGDTEFWGERIRGSFNNSVWVNQFAKSLKVDKSVNKF  60

Query  24   KPGVAFSV  1
             PGVAF+V
Sbjct  61   TPGVAFAV  68



>ref|XP_002283855.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
Length=527

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ C T K+  HL +         +NE WG+R+   +NNS  V+   K LK E+  RKI
Sbjct  1    MDSCCVTFKAKAHLAKASRGGLSNGDNEFWGERIRGSLNNSGWVSQLAKGLKTEKRPRKI  60

Query  24   KPGVAFSV  1
            KPGVA SV
Sbjct  61   KPGVACSV  68



>gb|ABC26921.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|ABC26922.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=524

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 15/68 (22%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD  CA +KST HL R         E E++G+++   +NN++ +N   KSLKLE   +KI
Sbjct  1    MDTCCAAMKSTVHLGRVSTGGFNNGEKEIFGEKIRGSLNNNLRINQLSKSLKLE---KKI  57

Query  24   KPGVAFSV  1
            KPGVA+SV
Sbjct  58   KPGVAYSV  65



>ref|XP_006365120.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365121.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Solanum tuberosum]
Length=527

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD  C  +KST HL R         E E +G+++   +N+++ +N   KSLKLE+   KI
Sbjct  1    MDTCCVPMKSTVHLGRVSTGGFNNGEKEFFGEKIRGSLNSNLRINQLSKSLKLEKKENKI  60

Query  24   KPGVAFSV  1
            KPGVA+SV
Sbjct  61   KPGVAYSV  68



>ref|XP_011088418.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088419.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088420.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088421.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088422.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088423.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
Length=526

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 13/68 (19%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ CATLK T HL           E  +WG+++   +++    N  G+SL LE  GRKI
Sbjct  1    MDS-CATLKPTAHLGNLSKGGFGNGEKGIWGEKIRGSLSSCGWANQLGRSLSLENKGRKI  59

Query  24   KPGVAFSV  1
            KPGVA+SV
Sbjct  60   KPGVAYSV  67



>gb|KDO41993.1| hypothetical protein CISIN_1g0097202mg, partial [Citrus sinensis]
 gb|KDO41994.1| hypothetical protein CISIN_1g0097202mg, partial [Citrus sinensis]
 gb|KDO41995.1| hypothetical protein CISIN_1g0097202mg, partial [Citrus sinensis]
 gb|KDO41996.1| hypothetical protein CISIN_1g0097202mg, partial [Citrus sinensis]
 gb|KDO41997.1| hypothetical protein CISIN_1g0097202mg, partial [Citrus sinensis]
Length=78

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD+ C  L++ TH+ +         +N LWG+R+   ++N        KSLK E+   K+
Sbjct  1    MDSCCVGLRANTHVVKASKYGSKIGDNALWGERIRGSVSNDGCTKQLKKSLKAEKRDEKV  60

Query  24   KPGVAFSV  1
            KPGVA++V
Sbjct  61   KPGVAYAV  68



>gb|AGS94412.1| ADP-glucose pyrophosphorylase large subunit 4 [Actinidia deliciosa]
Length=524

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 12/68 (18%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---------ENELWGKRM---INNSVLVNPFGKSLKLERNGRKI  25
            MD +C  L   THL +         E+  W +RM   + N++ V+  GKSL+ ER  RKI
Sbjct  1    MDTFCGALGPKTHLGKVRKDCLNDGESGFWRERMRESMKNNLRVDQLGKSLRSERRARKI  60

Query  24   KPGVAFSV  1
            +PGV+ SV
Sbjct  61   RPGVSCSV  68



>emb|CDO97030.1| unnamed protein product [Coffea canephora]
Length=522

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = -3

Query  168  MDAYCATLKSTTHLPR---ENELWGKRM---INNSVLVNPFGKSLKLE-RNGRKIKPGVA  10
            MD   AT+K+T HL     EN +WG+R+   +N +  VN   KSLKL+    +K KPG A
Sbjct  1    MDTGFATMKATAHLATVNGENGIWGERVKGSLNGNFWVNQLAKSLKLDYEKKQKFKPGAA  60

Query  9    FSV  1
            FSV
Sbjct  61   FSV  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514367491556