BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13893_g1_i1 len=591 path=[281:0-590]

Length=591
                                                                      Score     E

ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    104   5e-22   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    104   5e-22   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    101   5e-21   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    101   6e-21   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...  98.6    5e-20   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...  96.7    2e-19   
ref|XP_011069500.1|  PREDICTED: probable LRR receptor-like serine...  87.4    3e-18   
emb|CAN61169.1|  hypothetical protein VITISV_010446                   92.4    4e-18   Vitis vinifera
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...  92.0    8e-18   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...  92.0    8e-18   
emb|CBI30745.3|  unnamed protein product                              92.0    1e-17   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...  90.9    2e-17   
emb|CBI30748.3|  unnamed protein product                              90.9    2e-17   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...  90.1    3e-17   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg           90.5    3e-17   
emb|CAN65055.1|  hypothetical protein VITISV_012378                   88.2    8e-17   Vitis vinifera
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  87.8    2e-16   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg           87.8    2e-16   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...  86.7    6e-16   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-15   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-15   
emb|CBI30743.3|  unnamed protein product                              84.0    2e-15   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...  84.0    3e-15   
emb|CDO96888.1|  unnamed protein product                              84.3    3e-15   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-15   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-15   
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    3e-15   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-15   
ref|XP_004296585.1|  PREDICTED: probable LRR receptor-like serine...  79.7    6e-15   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...  82.8    7e-15   
gb|KHG06920.1|  hypothetical protein F383_33692                       79.0    7e-15   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-14   
ref|XP_002522278.1|  kinase, putative                                 82.0    2e-14   Ricinus communis
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...  81.6    2e-14   
ref|XP_007025271.1|  Leucine-rich repeat transmembrane protein ki...  79.3    3e-14   
gb|KCW67603.1|  hypothetical protein EUGRSUZ_F013601                  77.4    3e-14   
ref|XP_006371025.1|  hypothetical protein POPTR_0019s027401g          77.4    3e-14   
gb|KDO36629.1|  hypothetical protein CISIN_1g045421mg                 77.0    3e-14   
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...  81.3    3e-14   
ref|XP_002522279.1|  ATP binding protein, putative                    81.3    4e-14   Ricinus communis
gb|KHF98741.1|  hypothetical protein F383_14220                       77.0    4e-14   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g           80.5    4e-14   
ref|XP_006370934.1|  hypothetical protein POPTR_0019s01910g           76.6    4e-14   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-14   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...  80.5    5e-14   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                       80.1    8e-14   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...  79.7    9e-14   
gb|KCW78573.1|  hypothetical protein EUGRSUZ_C00047                   75.9    1e-13   
ref|XP_006388928.1|  hypothetical protein POPTR_0073s00200g           78.2    1e-13   
ref|XP_006388189.1|  hypothetical protein POPTR_0294s002001g          77.0    1e-13   
gb|KCW48003.1|  hypothetical protein EUGRSUZ_K01737                   79.3    1e-13   
ref|XP_010038874.1|  PREDICTED: probable leucine-rich repeat rece...  79.3    1e-13   
ref|XP_004491049.1|  PREDICTED: probable leucine-rich repeat rece...  75.5    1e-13   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...  79.3    1e-13   
emb|CBI30752.3|  unnamed protein product                              78.6    1e-13   
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                   79.0    1e-13   
gb|KCW48261.1|  hypothetical protein EUGRSUZ_K019901                  75.5    1e-13   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...  79.3    1e-13   
gb|KCW48010.1|  hypothetical protein EUGRSUZ_K017472                  74.3    1e-13   
ref|XP_010088635.1|  putative LRR receptor-like serine/threonine-...  78.6    2e-13   
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...  79.0    2e-13   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-13   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-13   
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                   78.2    2e-13   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg           78.6    2e-13   
gb|KDO35800.1|  hypothetical protein CISIN_1g028061mg                 75.1    2e-13   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...  78.6    2e-13   
ref|XP_008345927.1|  PREDICTED: probable LRR receptor-like serine...  74.3    2e-13   
ref|XP_010046856.1|  PREDICTED: probable leucine-rich repeat rece...  75.5    3e-13   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...  78.6    3e-13   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-13   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    3e-13   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    3e-13   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    3e-13   
ref|XP_010036446.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    3e-13   
ref|XP_010036442.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    3e-13   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    4e-13   
ref|XP_010036440.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    4e-13   
ref|XP_006495027.1|  PREDICTED: probable LRR receptor-like serine...  76.6    4e-13   
ref|XP_010036439.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    4e-13   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...  76.6    4e-13   
gb|KCW48028.1|  hypothetical protein EUGRSUZ_K01762                   77.8    4e-13   
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...  77.8    5e-13   
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase       77.8    5e-13   
gb|KEH28296.1|  LRR receptor-like kinase                              77.4    5e-13   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-13   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-13   
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-13   
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...  77.4    7e-13   
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...  77.0    7e-13   
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g          76.6    7e-13   
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...  77.0    7e-13   
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...  77.0    7e-13   
ref|XP_002528777.1|  ATP binding protein, putative                    77.0    8e-13   Ricinus communis
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g           76.6    8e-13   
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...  77.0    8e-13   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...  77.0    9e-13   
ref|XP_007149540.1|  hypothetical protein PHAVU_005G078800g           75.1    1e-12   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...  76.3    1e-12   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g           76.3    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010064500.1|  PREDICTED: probable LRR receptor-like serine...  72.0    1e-12   
ref|XP_006370931.1|  hypothetical protein POPTR_0019s01880g           75.1    1e-12   
emb|CAN81177.1|  hypothetical protein VITISV_011951                   76.3    1e-12   Vitis vinifera
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-12   
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_010064492.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    2e-12   
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...  75.9    2e-12   
ref|XP_010038964.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...  75.9    2e-12   
gb|KCW48268.1|  hypothetical protein EUGRSUZ_K020001                  74.3    2e-12   
ref|XP_007149532.1|  hypothetical protein PHAVU_005G078100g           75.5    2e-12   
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...  75.9    2e-12   
gb|KCW67580.1|  hypothetical protein EUGRSUZ_F01336                   72.4    2e-12   
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
gb|KCW48033.1|  hypothetical protein EUGRSUZ_K01771                   75.1    2e-12   
gb|KCW48258.1|  hypothetical protein EUGRSUZ_K01987                   75.9    2e-12   
ref|XP_006449568.1|  hypothetical protein CICLE_v10015563mg           74.3    2e-12   
ref|XP_006829381.1|  hypothetical protein AMTR_s04339p00003650        70.9    2e-12   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg           75.9    2e-12   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                   75.5    2e-12   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
ref|XP_006389048.1|  hypothetical protein POPTR_0053s00220g           74.3    2e-12   
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                   75.5    2e-12   
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...  75.5    2e-12   
ref|XP_010038877.1|  PREDICTED: probable LRR receptor-like serine...  75.1    2e-12   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1      75.1    3e-12   
gb|KCW48008.1|  hypothetical protein EUGRSUZ_K017432                  73.9    3e-12   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1      75.1    3e-12   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg           75.1    3e-12   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
ref|XP_006377521.1|  hypothetical protein POPTR_0011s06650g           73.2    3e-12   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                   74.7    3e-12   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    3e-12   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
ref|XP_006377514.1|  hypothetical protein POPTR_0011s06595g           72.8    3e-12   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
emb|CBI30754.3|  unnamed protein product                              74.3    3e-12   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    3e-12   
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g           75.1    3e-12   
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                   72.8    3e-12   
ref|XP_006377598.1|  hypothetical protein POPTR_0011s080251g          72.8    4e-12   
gb|KCW67594.1|  hypothetical protein EUGRSUZ_F013521                  70.5    4e-12   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...  75.1    4e-12   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    4e-12   
ref|XP_010064487.1|  PREDICTED: probable leucine-rich repeat rece...  74.7    4e-12   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    4e-12   
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g           74.3    4e-12   
gb|KCW48041.1|  hypothetical protein EUGRSUZ_K01781                   74.3    4e-12   
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...  74.7    5e-12   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g          73.9    5e-12   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g          73.2    5e-12   
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...  74.3    5e-12   
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g           74.3    6e-12   
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g           73.9    6e-12   
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g           73.9    6e-12   Populus trichocarpa [western balsam poplar]
gb|KCW67576.1|  hypothetical protein EUGRSUZ_F013322                  72.8    6e-12   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    7e-12   
ref|XP_010060741.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    7e-12   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    7e-12   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    8e-12   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    8e-12   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg           73.9    8e-12   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    8e-12   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    8e-12   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    8e-12   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    9e-12   
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    9e-12   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    9e-12   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg           73.9    9e-12   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...  73.9    9e-12   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...  73.2    1e-11   
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-11   
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g           73.2    1e-11   
ref|XP_010040667.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    1e-11   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-11   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   
ref|XP_010313922.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   
ref|XP_006377463.1|  hypothetical protein POPTR_0011s06170g           71.6    1e-11   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g           73.2    1e-11   Populus trichocarpa [western balsam poplar]
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                  71.6    1e-11   
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g          72.8    2e-11   
ref|XP_004251900.1|  PREDICTED: probable LRR receptor-like serine...  73.2    2e-11   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg           72.8    2e-11   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-11   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-11   
ref|XP_010064502.1|  PREDICTED: probable leucine-rich repeat rece...  72.8    2e-11   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-11   
gb|KCW63414.1|  hypothetical protein EUGRSUZ_G01055                   72.8    2e-11   
ref|XP_002882896.1|  leucine-rich repeat family protein               72.8    2e-11   
gb|KGN55041.1|  hypothetical protein Csa_4G624960                     72.4    2e-11   
gb|KCW67607.1|  hypothetical protein EUGRSUZ_F013621                  72.4    2e-11   
ref|XP_004491064.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    2e-11   
ref|XP_008349229.1|  PREDICTED: probable LRR receptor-like serine...  70.1    2e-11   
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    2e-11   
ref|NP_001235287.1|  receptor-like protein kinase                     69.7    3e-11   
ref|XP_010095160.1|  putative LRR receptor-like serine/threonine-...  68.9    3e-11   
ref|XP_007021942.1|  Leucine-rich repeat transmembrane protein ki...  72.4    3e-11   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                   72.0    3e-11   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_008346191.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
gb|KCW45029.1|  hypothetical protein EUGRSUZ_L013821                  70.9    3e-11   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    3e-11   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...  72.0    3e-11   
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                 72.0    3e-11   
ref|XP_006449567.1|  hypothetical protein CICLE_v10014126mg           72.0    3e-11   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...  72.0    3e-11   
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...  72.0    3e-11   
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...  72.0    3e-11   
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...  72.0    4e-11   
ref|XP_007021941.1|  Leucine-rich repeat transmembrane protein ki...  72.0    4e-11   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...  72.0    4e-11   
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    4e-11   
ref|XP_006377505.1|  hypothetical protein POPTR_0011s065402g          70.9    4e-11   
gb|KDP21153.1|  hypothetical protein JCGZ_21624                       71.6    4e-11   
ref|XP_006377493.1|  hypothetical protein POPTR_0011s06440g           69.3    4e-11   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    4e-11   
gb|AAL73330.1|  putative receptor-like protein kinase RLPK1           68.6    4e-11   Glycine max [soybeans]
ref|XP_006377461.1|  hypothetical protein POPTR_0011s06150g           69.7    4e-11   
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...  71.2    5e-11   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910        71.2    5e-11   
ref|XP_008463779.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
ref|XP_008384519.1|  PREDICTED: TMV resistance protein N-like iso...  71.6    5e-11   
ref|XP_008384518.1|  PREDICTED: TMV resistance protein N-like iso...  71.6    5e-11   
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                   71.2    5e-11   
ref|XP_008463778.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...  71.6    5e-11   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g          71.2    5e-11   Populus trichocarpa [western balsam poplar]
gb|AES66495.2|  LRR receptor-like kinase                              71.2    5e-11   
ref|NP_188102.5|  leucine-rich repeat transmembrane protein kinase    71.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847776.1|  hypothetical protein AMTR_s00162p00057050        69.7    5e-11   
ref|XP_008463810.1|  PREDICTED: probable LRR receptor-like serine...  66.6    6e-11   
emb|CBI30750.3|  unnamed protein product                              70.9    6e-11   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...  71.2    6e-11   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                   71.2    6e-11   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g           71.2    6e-11   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...  71.2    6e-11   
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...  70.9    6e-11   
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...  71.2    6e-11   
gb|KHN36924.1|  Putative LRR receptor-like serine/threonine-prote...  70.9    6e-11   
ref|XP_010036447.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    6e-11   
dbj|BAB02650.1|  receptor-like serine/threonine kinase                71.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...  71.2    7e-11   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                  70.9    7e-11   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...  70.9    7e-11   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    7e-11   
ref|XP_010273522.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    7e-11   
gb|KDP24894.1|  hypothetical protein JCGZ_25156                       70.5    7e-11   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...  70.9    8e-11   
ref|XP_006358931.1|  PREDICTED: probable LRR receptor-like serine...  70.9    8e-11   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...  70.9    8e-11   
ref|XP_006449565.1|  hypothetical protein CICLE_v10016248mg           68.6    8e-11   
ref|XP_003596242.1|  Cysteine-rich receptor-like protein kinase       70.9    8e-11   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase            70.9    8e-11   
ref|XP_010059621.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    9e-11   
gb|AES66493.2|  LRR receptor-like kinase                              70.9    9e-11   
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...  70.9    9e-11   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                   70.5    1e-10   
ref|XP_006377511.1|  hypothetical protein POPTR_0011s065701g          70.1    1e-10   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                   70.5    1e-10   
ref|XP_003629866.1|  ATP-binding/protein serine/threonine kinase      70.5    1e-10   
gb|AET04342.2|  LRR receptor-like Serine/Threonine-kinase RFK1, p...  70.5    1e-10   
gb|KHN36927.1|  Putative leucine-rich repeat receptor-like serine...  69.7    1e-10   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...  70.5    1e-10   
emb|CAE54078.1|  receptor-like protein kinase                         67.4    1e-10   
ref|XP_006594719.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
emb|CBI25213.3|  unnamed protein product                              65.9    1e-10   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_006467584.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...  70.1    1e-10   
ref|XP_006296889.1|  hypothetical protein CARUB_v10012882mg           70.1    1e-10   
ref|NP_001238634.1|  receptor-like kinase                             66.6    1e-10   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...  70.1    2e-10   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...  70.1    2e-10   
ref|XP_010272675.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-10   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...  69.7    2e-10   
ref|XP_004166352.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                       69.7    2e-10   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...  69.7    2e-10   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g           69.3    2e-10   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
gb|KFK38835.1|  hypothetical protein AALP_AA3G166500                  69.7    2e-10   
ref|XP_008245552.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-10   
gb|KGN53588.1|  hypothetical protein Csa_4G083620                     69.7    2e-10   
ref|XP_008390633.1|  PREDICTED: probable leucine-rich repeat rece...  65.5    2e-10   
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
gb|KCW67583.1|  hypothetical protein EUGRSUZ_F013432                  69.3    2e-10   
dbj|BAJ53166.1|  JHL10I11.12                                          69.3    2e-10   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                   68.9    2e-10   
ref|XP_007214614.1|  hypothetical protein PRUPE_ppa001161mg           69.3    2e-10   
gb|KCW67601.1|  hypothetical protein EUGRSUZ_F01359                   69.3    2e-10   
ref|XP_010273492.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
ref|XP_010064506.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
gb|KDP21154.1|  hypothetical protein JCGZ_21625                       68.2    3e-10   
ref|XP_010248401.1|  PREDICTED: probable LRR receptor-like serine...  69.3    3e-10   
ref|XP_010273491.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
gb|KEH38577.1|  LRR receptor-like kinase                              69.3    3e-10   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...  69.3    3e-10   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
ref|XP_010064513.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
ref|XP_009798184.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-10   
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g           68.9    3e-10   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-10   
ref|XP_004309629.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-10   
ref|XP_002522276.1|  kinase, putative                                 68.9    4e-10   
gb|KHG25892.1|  putative leucine-rich repeat receptor-like serine...  68.6    4e-10   
ref|XP_006846414.1|  hypothetical protein AMTR_s01688p00009000        64.7    4e-10   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...  68.9    4e-10   
ref|XP_010060736.1|  PREDICTED: probable leucine-rich repeat rece...  68.6    4e-10   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...  68.6    4e-10   
ref|XP_009628284.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-10   
ref|XP_010060735.1|  PREDICTED: probable leucine-rich repeat rece...  68.6    4e-10   
ref|XP_003628417.1|  hypothetical protein MTR_8g057660                67.0    4e-10   
emb|CAN76712.1|  hypothetical protein VITISV_022379                   67.8    4e-10   
ref|XP_009628282.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-10   
gb|KCW67565.1|  hypothetical protein EUGRSUZ_F01314                   68.6    4e-10   
ref|XP_009628281.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-10   
ref|NP_001238159.1|  receptor-like serine/threonine kinase            68.6    4e-10   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...  68.6    5e-10   
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g          68.2    5e-10   
ref|XP_010045443.1|  PREDICTED: probable LRR receptor-like serine...  68.6    5e-10   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g           68.6    5e-10   
ref|XP_010064508.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    5e-10   
ref|XP_004146079.1|  PREDICTED: probable leucine-rich repeat rece...  68.6    5e-10   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g           68.2    5e-10   
ref|XP_011009666.1|  PREDICTED: probable LRR receptor-like serine...  67.8    5e-10   
ref|XP_011009667.1|  PREDICTED: probable LRR receptor-like serine...  67.8    5e-10   
gb|KCW84087.1|  hypothetical protein EUGRSUZ_B00978                   68.2    5e-10   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...  68.2    5e-10   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...  68.2    5e-10   
gb|KCW84086.1|  hypothetical protein EUGRSUZ_B00972                   68.2    5e-10   
ref|XP_006306238.1|  hypothetical protein CARUB_v10012061mg           68.2    6e-10   
ref|XP_010487294.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    6e-10   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    6e-10   
gb|KCW84082.1|  hypothetical protein EUGRSUZ_B00963                   68.2    6e-10   
ref|XP_007025276.1|  Receptor-like kinase in flowers 1, putative      68.2    6e-10   
ref|XP_009798185.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
gb|KCW67586.1|  hypothetical protein EUGRSUZ_F013462                  67.0    6e-10   
ref|XP_010045768.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
ref|XP_010093471.1|  putative LRR receptor-like serine/threonine-...  68.2    6e-10   
ref|XP_010045761.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
ref|XP_009798183.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-10   
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g           68.2    6e-10   
emb|CDP06041.1|  unnamed protein product                              68.2    7e-10   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...  68.2    7e-10   
emb|CBI20136.3|  unnamed protein product                              67.8    7e-10   
ref|XP_010242177.1|  PREDICTED: probable LRR receptor-like serine...  67.8    7e-10   
ref|XP_010465401.1|  PREDICTED: probable leucine-rich repeat rece...  67.8    7e-10   
ref|XP_010242178.1|  PREDICTED: probable LRR receptor-like serine...  67.8    7e-10   
ref|XP_004504262.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  67.8    7e-10   
ref|XP_010502195.1|  PREDICTED: probable leucine-rich repeat rece...  67.8    8e-10   
ref|XP_002532988.1|  conserved hypothetical protein                   67.8    8e-10   
ref|XP_006593319.1|  PREDICTED: receptor-like kinase isoform X1       67.8    8e-10   
ref|XP_004295665.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    8e-10   
gb|KHG20508.1|  hypothetical protein F383_03730                       67.8    8e-10   
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...  67.8    8e-10   
ref|XP_006593320.1|  PREDICTED: receptor-like kinase isoform X2       67.8    8e-10   
ref|XP_006593321.1|  PREDICTED: receptor-like kinase isoform X3       67.8    8e-10   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...  67.8    8e-10   
emb|CBI20122.3|  unnamed protein product                              65.1    9e-10   
gb|KFK44797.1|  hypothetical protein AALP_AA1G304600                  67.4    9e-10   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...  67.8    9e-10   
gb|KEH38576.1|  LRR receptor-like kinase                              67.4    9e-10   
ref|XP_002316847.1|  receptor-like protein kinase                     67.4    1e-09   
ref|XP_009604354.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-09   
ref|XP_010465400.1|  PREDICTED: probable leucine-rich repeat rece...  67.4    1e-09   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                   67.4    1e-09   
ref|XP_006384081.1|  hypothetical protein POPTR_0004s06270g           66.6    1e-09   
ref|XP_006384080.1|  hypothetical protein POPTR_0004s06270g           66.6    1e-09   
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg             66.6    1e-09   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-09   
gb|KHG04296.1|  hypothetical protein F383_04630                       67.4    1e-09   
ref|XP_010909919.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-09   
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...  65.5    1e-09   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g          67.0    1e-09   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-09   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                       67.0    1e-09   
gb|KHG04295.1|  hypothetical protein F383_04630                       67.0    1e-09   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
gb|KCW67574.1|  hypothetical protein EUGRSUZ_F013302                  67.0    1e-09   
ref|XP_011002770.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...  67.0    1e-09   
ref|XP_006442358.1|  hypothetical protein CICLE_v10024393mg           64.3    1e-09   
ref|XP_009788430.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
gb|EYU28129.1|  hypothetical protein MIMGU_mgv1a025582mg              67.0    1e-09   
emb|CAN73789.1|  hypothetical protein VITISV_025000                   66.6    1e-09   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...  67.0    1e-09   
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase            67.0    1e-09   
ref|XP_010093466.1|  putative leucine-rich repeat receptor-like s...  66.2    2e-09   
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g          66.6    2e-09   
ref|XP_009772943.1|  PREDICTED: probable LRR receptor-like serine...  67.0    2e-09   
gb|KEH38591.1|  LRR receptor-like kinase                              67.0    2e-09   
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...  67.0    2e-09   
ref|XP_011014343.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_008226374.1|  PREDICTED: probable leucine-rich repeat rece...  66.2    2e-09   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
gb|KGN47985.1|  hypothetical protein Csa_6G421790                     63.2    2e-09   
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...  66.6    2e-09   
ref|XP_010502723.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
ref|XP_010462239.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
ref|XP_010502721.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
ref|XP_009788429.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_010502720.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
emb|CDX90206.1|  BnaA08g17780D                                        62.8    2e-09   
ref|XP_010502724.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
ref|XP_010502722.1|  PREDICTED: probable leucine-rich repeat rece...  66.6    2e-09   
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
gb|KDO42407.1|  hypothetical protein CISIN_1g0044001mg                65.5    2e-09   
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...  66.6    2e-09   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase    66.6    2e-09   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...  66.6    2e-09   
ref|XP_006301399.1|  hypothetical protein CARUB_v10021813mg           66.6    2e-09   
gb|KDP23043.1|  hypothetical protein JCGZ_00508                       66.2    2e-09   
ref|XP_002305710.2|  hypothetical protein POPTR_0004s06240g           65.9    2e-09   
ref|XP_006377527.1|  hypothetical protein POPTR_0011s067102g          63.9    2e-09   
ref|XP_003596245.1|  Receptor-like protein kinase                     66.2    2e-09   
ref|XP_010430253.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    2e-09   
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  65.9    2e-09   
gb|AES66496.2|  LRR receptor-like kinase                              66.2    2e-09   
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...  66.2    2e-09   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-09   
ref|XP_006304798.1|  hypothetical protein CARUB_v10012394mg           66.2    2e-09   
emb|CBI30739.3|  unnamed protein product                              66.2    2e-09   
ref|XP_011085313.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-09   
emb|CAN81779.1|  hypothetical protein VITISV_034284                   66.2    2e-09   
ref|XP_010316865.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-09   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-09   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-09   
ref|XP_002891752.1|  leucine-rich repeat family protein               66.2    2e-09   
gb|KFK44799.1|  hypothetical protein AALP_AA1G304800                  66.2    2e-09   
gb|KFK44800.1|  hypothetical protein AALP_AA1G304800                  66.2    2e-09   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_006304589.1|  hypothetical protein CARUB_v10011641mg           66.2    3e-09   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...  66.2    3e-09   
gb|KHN19488.1|  Putative leucine-rich repeat receptor-like serine...  66.2    3e-09   
ref|XP_003519558.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_010479903.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
emb|CDO96887.1|  unnamed protein product                              66.2    3e-09   
ref|XP_011085314.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_010479902.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_007147979.1|  hypothetical protein PHAVU_006G170500g           66.2    3e-09   
ref|XP_007147980.1|  hypothetical protein PHAVU_006G170500g           66.2    3e-09   
ref|XP_006358137.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
gb|KHN25993.1|  Putative LRR receptor-like serine/threonine-prote...  64.3    3e-09   
emb|CBI20154.3|  unnamed protein product                              66.2    3e-09   
ref|XP_006388874.1|  hypothetical protein POPTR_0084s00200g           62.8    3e-09   
ref|XP_010500990.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_010675292.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  65.9    3e-09   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_006575670.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_010675291.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_010999735.1|  PREDICTED: probable LRR receptor-like serine...  64.3    3e-09   
ref|XP_010916565.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    3e-09   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
gb|KHN38301.1|  Putative LRR receptor-like serine/threonine-prote...  65.9    3e-09   
ref|XP_010487291.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    3e-09   
ref|XP_010487290.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    4e-09   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...  65.9    4e-09   
ref|XP_010487292.1|  PREDICTED: probable leucine-rich repeat rece...  65.5    4e-09   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g          65.5    4e-09   
ref|XP_010487293.1|  PREDICTED: probable leucine-rich repeat rece...  65.5    4e-09   
ref|XP_010549458.1|  PREDICTED: probable LRR receptor-like serine...  65.5    4e-09   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...  65.5    4e-09   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...  65.5    4e-09   
emb|CBI20124.3|  unnamed protein product                              65.5    4e-09   



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGSN++K++ALR+IKVALLCTNPSPALRP+MS V+ MLEG  D+ E + D      E
Sbjct  897  DPRLGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLDVNESNIDSSAYDDE  956

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            FNFQ +RD YD+M V+ S++  Q+ F S
Sbjct  957  FNFQGLRDKYDEMQVNSSEN--QSLFRS  982



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGSN++K++ALR+IKVALLCTNPSPALRP+MS V+ MLEG  D+ E + D      E
Sbjct  897  DPRLGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLDVNESNIDSSAYDDE  956

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            FNFQ +RD YD+M V+ S++  Q+ F S
Sbjct  957  FNFQGLRDKYDEMQVNSSEN--QSLFRS  982



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   101 bits (252),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 5/89 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGSN+DK++ALR+IKVAL CTNPSPALRP+MS V+NMLEG  ++ E + D      E
Sbjct  897  DPRLGSNYDKKEALRMIKVALQCTNPSPALRPNMSAVVNMLEGRLNVDESNFDSSGYDDE  956

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
            FNFQ +RD YD+M V  S++     FS+D
Sbjct  957  FNFQGLRDKYDEMQVTSSENQ-SVFFSTD  984



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   101 bits (251),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGS +DKE+ALR+IKVAL CTNPSPALRP+MS V+NMLEG  ++ E + D      E
Sbjct  897  DPRLGSYYDKEEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLNVDESNIDSSGYDDE  956

Query  170  FNFQAMRDHYDQMPVHLSDS  229
            FNFQ +RD YD+M V  S++
Sbjct  957  FNFQGLRDKYDEMQVTSSEN  976



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGSN+DK++ALR+IKVAL CTNPSP LRP+MS V+NMLEG  +I E + D      E
Sbjct  827  DPRLGSNYDKKEALRMIKVALRCTNPSPVLRPNMSAVVNMLEGRLNIDESNFDSSGYGDE  886

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
             NFQ +RD YD+M V  S++     FS+D
Sbjct  887  LNFQGLRDKYDEMQVTSSENQ-SVFFSTD  914



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGSN+DK++ALR+IKVAL CTNPSPALRP+MS V+NMLEG  ++ E + D      E
Sbjct  778  DPRLGSNYDKKEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLNVDESNFDSSGYGDE  837

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
             NF  +RD YD+M V  S++     FS+D
Sbjct  838  LNFLGLRDKYDEMQVTSSENQ-SVFFSTD  865



>ref|XP_011069500.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Sesamum indicum]
Length=136

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD--LH--E  169
            DPRLGSNF+K +A ++I+VALLCT+P+P LRP+MS V++MLEGH +I E++ D  +H  E
Sbjct  30   DPRLGSNFNKNEAEKIIRVALLCTSPAPTLRPAMSEVVSMLEGHVNIQEFNMDSRIHDSE  89

Query  170  FNFQAMRDHYDQMPVHLSDS  229
               QA+R+ YD++   LS +
Sbjct  90   LKLQALREKYDELYDDLSKT  109



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+LG+ F K++A+R+IKVALLCTNPSPALRP+MS V++ML+G   I EY  +      E
Sbjct  559  DPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDE  618

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  YDQM +  S      N SS
Sbjct  619  FGFEALRGQYDQMQLQSSSDIEPLNHSS  646



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+LG+ F K++A+R+IKVALLCTNPSPALRP+MS V++ML+G   I EY  +      E
Sbjct  901  DPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDE  960

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  YDQM +  S      N SS
Sbjct  961  FGFEALRGQYDQMQLQSSSDIEPLNHSS  988



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+LG+ F K++A+R+IKVALLCTNPSPALRP+MS V++ML+G   I EY  +      E
Sbjct  895  DPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDE  954

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  YDQM +  S      N SS
Sbjct  955  FGFEALRGQYDQMQLQSSSDIEPLNHSS  982



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
             DP+LG+ F K++A+R+IKVALLCTNPSPALRP+MS V++ML+G   I EY  +      E
Sbjct  1799  DPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDE  1858

Query  170   FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
             F F+A+R  YDQM +  S      N SS
Sbjct  1859  FGFEALRGQYDQMQLQSSSDIEPLNHSS  1886



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+MS V+NMLEG   + E+  +   F  +
Sbjct  899  DPKLESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDE  958

Query  182  AMRDHYDQMPVHLSDSPYQANFSSDA  259
            A+R  Y QM  H S        SSD+
Sbjct  959  ALRSQYSQMHFHRSSETETIKHSSDS  984



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+MS V+NMLEG   + E+  +   F  +
Sbjct  910  DPKLESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDE  969

Query  182  AMRDHYDQMPVHLSDSPYQANFSSDA  259
            A+R  Y QM  H S        SSD+
Sbjct  970  ALRSQYSQMHFHRSSETETIKHSSDS  995



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD--LH--E  169
            DPRLGSNF+K +A ++I+VALLCT+P+P LRP+MS V++MLEGH +I E++ D  +H  E
Sbjct  709  DPRLGSNFNKNEAEKIIRVALLCTSPAPTLRPAMSEVVSMLEGHVNIQEFNMDSRIHDSE  768

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
               QA+R+ YD++   LS +    + +S
Sbjct  769  LKLQALREKYDELYDDLSKTQTHVHRTS  796



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGSNF KE+A+R++KVALLCTNP+PALRPSMS V++MLEG    HE I++      E
Sbjct  907  DPRLGSNFSKEEAIRMVKVALLCTNPAPALRPSMSSVVSMLEGKTAVHELIMDPSIYGDE  966

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                A+R+ +DQ+    S        SS+A
Sbjct  967  MRLTALRNQFDQIAQESSTGTQSLTRSSNA  996



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+MS V+NMLEG   + E+  +   F  +
Sbjct  468  DPKLESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDE  527

Query  182  AMRDHYDQMPVHLSDSPYQANFSSDA  259
            A+R  Y QM  H S        SSD+
Sbjct  528  ALRSQYSQMHFHRSSETETIKHSSDS  553



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGSNF KE+A+R++KVALLCTNP+PALRP+MS V++MLEG    HE I++      E
Sbjct  907  DPRLGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTVHELIMDPSIYGDE  966

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                A+R+ +D +    S        SSDA
Sbjct  967  MRLTALRNQFDHIAQESSTGTQSLIRSSDA  996



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGSNF KE+A+R++KVALLCTNP+PALRP+MS V++MLEG    HE I++      E
Sbjct  907  DPRLGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVLSMLEGKTAVHELIMDPSIYGDE  966

Query  170  FNFQAMRDHYDQM  208
                A+R+ +DQ+
Sbjct  967  MRLTALRNQFDQI  979



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGSNF +E+A+R++KVALLCTNP+PALRP+MS V++MLEG    HE I++      E
Sbjct  907  DPRLGSNFSEEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTVHELIMDPSIYGDE  966

Query  170  FNFQAMRDHYDQM  208
                A+R+ +DQ+
Sbjct  967  MRLTALRNQFDQI  979



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 7/76 (9%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY-------DTD  160
            D  L S+F K++ALR+I VALLCTNPSPALRP+MS V+++LE H D+ E+       D D
Sbjct  925  DETLSSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLDLPEFNLESRSHDDD  984

Query  161  LHEFNFQAMRDHYDQM  208
              E  FQ +RD YD+M
Sbjct  985  DDELKFQGLRDKYDEM  1000



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP LG+ F KE+A+R+IKVALLCTN SPALRP+MS V++ML+G   + EY  +      E
Sbjct  870  DPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDE  929

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  +DQ  +  S      N SS
Sbjct  930  FGFEALRGQHDQTQLQSSSEIEPLNHSS  957



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            DP LG+ F KE+A+R+IKVALLCTN SPALRP+MS V++ML+G   + EY  +      E
Sbjct  424  DPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDE  483

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  +DQ  +  S      N SS
Sbjct  484  FGFEALRGQHDQTQLQSSSEIEPLNHSS  511



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LGS F+KE+A+R+IKVALLCTNPSPALRP+MS V++MLEG    HE  I       E
Sbjct  547  DPKLGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGRAIVHELNINPSIYCDE  606

Query  170  FNFQAMRDHYD----------QMPVHLSDSPYQANFSS  253
              F+++RD  +          Q  ++LSD+    + SS
Sbjct  607  MRFKSLRDESNLSVQQSWCETQSLIYLSDARGTTSSSS  644



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEF---  172
             DPRLGSN ++ +A+R+IKVALLCTNPSPALRP+MS  + MLEG     E+ +D   +   
Sbjct  919   DPRLGSNINEGEAIRMIKVALLCTNPSPALRPTMSAALGMLEGRISTQEFSSDPSVYNDG  978

Query  173   -NFQAMRDHYDQMPVHLSDSPYQANFSSD  256
              N Q +RD YD++    S  P   + SSD
Sbjct  979   LNLQGLRDKYDELQFS-SIEPQSFSTSSD  1006



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP LG+ F KE+A+R+IKVALLCTN SPALRP+MS V++ML+G   + EY  +      E
Sbjct  892  DPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDE  951

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  +DQ  +  S      N SS
Sbjct  952  FGFEALRGQHDQTQLQSSSEIEPLNHSS  979



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP LG+ F KE+A+R+IKVALLCTN SPALRP+MS V++ML+G   + EY  +      E
Sbjct  870  DPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDE  929

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
            F F+A+R  +DQ  +  S      N SS
Sbjct  930  FGFEALRGQHDQTQLQSSSEIEPLNHSS  957



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+F++E+A+R++KVALLCTNP+PALRP+MS V++MLEG    HE I++      E
Sbjct  869  DPRLGSDFNQEEAIRMVKVALLCTNPAPALRPTMSAVVSMLEGRSVVHELIMDPSIYGDE  928

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANF--SSDA  259
                A+RD +++     S S    +F  +SDA
Sbjct  929  TRLTALRDRFERFVTEDSSSSGAQSFLRASDA  960



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            D  L S+F K++ALR+I VALLCTNPSPALRP+MS V+++LE H D+ E++ +      E
Sbjct  898  DETLNSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLDLPEFNLESRSHDDE  957

Query  170  FNFQAMRDHYDQM  208
              FQ +RD YD+M
Sbjct  958  LKFQGLRDKYDEM  970



>ref|XP_004296585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=206

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDL-----H  166
            DP+L S F+KE+A+R+IKVALLCT+PSPALRP+MS  ++MLEG   I E +T       H
Sbjct  103  DPKLESKFNKEEAMRMIKVALLCTHPSPALRPTMSAALSMLEGRAVIHELNTSSSMYSDH  162

Query  167  EFNFQAMRDHYDQMPVH  217
            E  F++ RD Y  + + 
Sbjct  163  ELAFESFRDEYHDVSIQ  179



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+F+ E+A R+IKVAL CTNPSPALRP+MS V++MLEG    HE +++      +
Sbjct  521  DPRLGSDFNTEEAARMIKVALQCTNPSPALRPTMSAVVSMLEGRTLVHELVMDPSVYADQ  580

Query  170  FNFQAMRDHYDQM  208
              FQA+ ++ D +
Sbjct  581  LRFQALTEYIDHL  593



>gb|KHG06920.1| hypothetical protein F383_33692 [Gossypium arboreum]
Length=164

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
            DPRLG+ F++E+A+R+ KVALLCTN SPALRP+MS V+NMLEG     E I++      E
Sbjct  63   DPRLGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFADE  122

Query  170  FNFQAMRDHYDQMPVHLSDS  229
              F A++D +++M    S +
Sbjct  123  SRFGAVKDQFNRMQSQSSKT  142



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS F KE+A+R++KVALLCTNP+PAL P+MS V+ MLEG    HE I++      E
Sbjct  672  DPRLGSQFSKEEAIRMVKVALLCTNPAPALXPTMSAVVRMLEGETAVHELIMDPSIYGDE  731

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                A+R+ +DQ+    S        SSD+
Sbjct  732  MXLTAVRNQFDQIAQESSSGTQSRLRSSDS  761



>ref|XP_002522278.1| kinase, putative [Ricinus communis]
 gb|EEF40136.1| kinase, putative [Ricinus communis]
Length=965

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            DPRL S F+KE+A R+I++ALLCTN SP LRP+MS V++MLEG   + E  +D    + +
Sbjct  839  DPRLESEFNKEEAERMIRMALLCTNESPTLRPTMSAVVSMLEGETSVEEVISDPSIYVDD  898

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
              ++  +DHY Q     S    + NFSSD
Sbjct  899  MRYKPPKDHYQQTQRKSSSGSQRLNFSSD  927



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGS+F+KE+A+R+IK+A+LCTN SPALRP MS V++MLEG    H+ I++      E
Sbjct  814  DPNLGSDFNKEEAVRMIKIAILCTNQSPALRPIMSAVVSMLEGRTAVHDLIMDPSIYGDE  873

Query  170  FNFQAMRDHYDQM  208
              F A+R  +DQM
Sbjct  874  LRFTALRKQFDQM  886



>ref|XP_007025271.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27893.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=346

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            DPRLGS F++E+A+R+IKVALLCTN SPALRP MS V+NMLEG   + E   D   F   
Sbjct  239  DPRLGSEFNEEEAIRMIKVALLCTNSSPALRPIMSEVLNMLEGRALVPELIMDPSIFGDE  298

Query  176  --FQAMRDHYDQM  208
              F A+RD  ++M
Sbjct  299  SRFGALRDQLNRM  311



>gb|KCW67603.1| hypothetical protein EUGRSUZ_F013601, partial [Eucalyptus grandis]
Length=168

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI---IEYDTDLHEF  172
            D RLGS+FD+++ L +I VALLCTN +PALRP MS VI+MLEG   +      DT + E 
Sbjct  65   DQRLGSHFDEKEVLAMINVALLCTNATPALRPPMSSVISMLEGKVVVPLLDSEDTIITEE  124

Query  173  NFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
              +AMR H+  M   L+D P+    SS +
Sbjct  125  TIEAMRKHFKSM---LTDGPWTGTASSTS  150



>ref|XP_006371025.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
 gb|ERP48822.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
Length=177

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 20/104 (19%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  65   DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  124

Query  149  --YDTDLHEFNFQ-----AMRDHYDQMPVHLSDSPYQANFSSDA  259
              Y T LH+   Q     ++R+   Q  V  S+ P+ A+ SS A
Sbjct  125  SGYATALHKKFAQSSVNGSLRE--SQSLVKSSEGPWTASSSSSA  166



>gb|KDO36629.1| hypothetical protein CISIN_1g045421mg, partial [Citrus sinensis]
Length=169

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE---DIIEYDTDLHE-  169
            DPRLGS F+K +A R+IK+ALLCTN SP+LRP+MS V++MLEG     D+I   + L E 
Sbjct  9    DPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSED  68

Query  170  FNFQAMRDHYDQM  208
              F+ +RDH  +M
Sbjct  69   LRFKTLRDHPREM  81



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLGS F++E+A+R+IKVALLCTN SPALRP MS V+NMLEG   + E   D      E
Sbjct  834  DPRLGSEFNEEEAIRMIKVALLCTNSSPALRPIMSEVVNMLEGRTLVPELIMDSSIFGDE  893

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                A+RD  ++M     D       SSD+
Sbjct  894  LRIGALRDQCNRMQTGKDDETSTFRHSSDS  923



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +2

Query  2    DPRLG--SNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI--IEYDTDLH-  166
            DPRL   S F+KE  LRVI+VALLCTNPSPA+RP+MS V++MLEG  +I  +  D  L+ 
Sbjct  876  DPRLDLKSKFEKE-VLRVIEVALLCTNPSPAVRPAMSTVVSMLEGRGEIHNLAIDPSLYG  934

Query  167  -EFNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
             EF F+AMR  YDQ+ V  S        SSD
Sbjct  935  DEFRFKAMRKQYDQILVEGSRETQSLVNSSD  965



>gb|KHF98741.1| hypothetical protein F383_14220 [Gossypium arboreum]
Length=167

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
            DPRLG+ F++E+A+R+ KVALLCTN SPALRP+MS V+NMLEG     E I++      E
Sbjct  63   DPRLGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFADE  122

Query  170  FNFQAMRDHYDQM  208
              F A++D  ++M
Sbjct  123  SRFGAVKDQLNRM  135



>ref|XP_006370936.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
 gb|ERP48733.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
Length=580

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            DPRLGS+F K++A R+IKVALLCTN SPALRP+MS V+ MLEG  D+ E   D   F   
Sbjct  474  DPRLGSDFKKKEAARMIKVALLCTNQSPALRPTMSAVVRMLEGKGDVQELVVDPSTFGDS  533

Query  176  --FQAMRDHYDQMPVHLSDSPYQANFSSD  256
              F++ + + DQ  V   D       SSD
Sbjct  534  LRFKSFQGYSDQSSVLSIDETQSLVRSSD  562



>ref|XP_006370934.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
 gb|ERP48731.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
Length=173

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  63   DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  122

Query  149  --YDTDLH-EFNFQAMRDHYDQMP--VHLSDSPYQANFSSDA  259
              Y   LH +F   ++     + P  V  S+ P+ A+ SS A
Sbjct  123  SGYAMALHNKFAQSSVNGSLRETPSLVKSSEGPWTASSSSSA  164



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGS+F+KEQA+R+IKVA+LCTNP+PALRP+MS V++MLEG    HE  I       E
Sbjct  874  DPXLGSDFNKEQAMRMIKVAILCTNPAPALRPTMSAVVSMLEGRAIVHELNINPSIYGDE  933

Query  170  FNFQAMRD  193
              F+++RD
Sbjct  934  MRFESLRD  941



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP LG  F+KE+A+R+IKVALLCTNPSPALRP+MS V+ ML+G   + E   D      E
Sbjct  907  DPSLGGEFNKEEAVRMIKVALLCTNPSPALRPNMSEVVKMLKGRTHVPELIMDPSIFGDE  966

Query  170  FNFQAMRDHYDQM  208
                A+RD ++QM
Sbjct  967  LRLGALRDQFNQM  979



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DPRLGS F KE+ +R+ KVALLCTN SPALRP+MS V+ MLEG   + E       Y  +
Sbjct  851  DPRLGSKFKKEEVIRMAKVALLCTNTSPALRPTMSEVVGMLEGRTPVRELVMGSGFYGDE  910

Query  161  LHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
            L     + + + YDQ+ +H S  P     SS+A
Sbjct  911  LRS---KVLSNQYDQISLHSSSDPRSFIHSSEA  940



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+ GS F+KE+A R+IKVALLCTNPS ALRP MS V++MLEG    HE I++   +   
Sbjct  820  DPKSGSEFNKEEANRMIKVALLCTNPSQALRPGMSEVVSMLEGRTAVHELIMDPSNNHDP  879

Query  170  FNFQAMRDHYD  202
              F A+RD +D
Sbjct  880  LRFNALRDQFD  890



>gb|KCW78573.1| hypothetical protein EUGRSUZ_C00047 [Eucalyptus grandis]
Length=179

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FD+E+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  63   DPRLGSHFDREEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  122

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  123  KIEAMRKHF  131



>ref|XP_006388928.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
 gb|ERP47842.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
Length=415

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  305  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  364

Query  149  --YDTDLH-EFNFQAMRDHYDQMP--VHLSDSPYQANFSSDA  259
              Y T LH +F   ++     + P  V  S+ P+ A+ SS A
Sbjct  365  SGYATALHNKFAQSSVNGSISETPSLVKSSEGPWTASSSSSA  406



>ref|XP_006388189.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
 gb|ERP47103.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
Length=325

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (58%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  215  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  274

Query  149  --YDTDLHEFNFQAMRDHY---DQMPVHLSDSPYQANFSSDA  259
              Y T LH    Q+  +      Q  V  S+ P+ A+ SS A
Sbjct  275  SGYATALHNKFAQSSANGSLSETQSLVKSSEGPWTASSSSSA  316



>gb|KCW48003.1| hypothetical protein EUGRSUZ_K01737 [Eucalyptus grandis]
Length=658

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  542  DPRLGSHFDKEEALALIKVALMCTNATPALRPQMSSVVSMLEGKVAVPVLDSAGAIMTEE  601

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  602  KIEAMRKHF  610



>ref|XP_010038874.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=669

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  553  DPRLGSHFDKEEALALIKVALMCTNATPALRPQMSSVVSMLEGKVAVPVLDSAGAIMTEE  612

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  613  KIEAMRKHF  621



>ref|XP_004491049.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=167

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            D RLG+NF+KE+A+ +I VALLCTN +  LRP+MS V++MLEG  DI E  T+  E +  
Sbjct  63   DKRLGTNFNKEEAMVMINVALLCTNVTSNLRPAMSSVVSMLEGTIDIQEVFTESSEVSDE  122

Query  176  --FQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
               +AMR +Y +  + + + P+ A+ S+ AN
Sbjct  123  KKMEAMRQYYQEHSIQM-EGPWTAS-STSAN  151



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDLHEFN  175
            DPRLGS+FDK + +R+I VALLCTN SPALRP+MS V++MLEG   I E+       E  
Sbjct  867  DPRLGSDFDKGEVMRMINVALLCTNSSPALRPAMSAVVSMLEGGAIIQEFVSQPSYDESR  926

Query  176  FQAMRDHYDQ  205
            ++A+++H+ Q
Sbjct  927  YKAIQNHFQQ  936



>emb|CBI30752.3| unnamed protein product [Vitis vinifera]
Length=511

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
            DP+LGS F++++A R+IKVA+LCTN SP LRP MS V++MLEG     E I +   D   
Sbjct  386  DPKLGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDY  445

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
             NF+++ D++ +M   +      + FSSD  
Sbjct  446  LNFKSLGDYHKRMQKQILSGSEASKFSSDGT  476



>gb|KCW48256.1| hypothetical protein EUGRSUZ_K01985 [Eucalyptus grandis]
Length=684

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + E 
Sbjct  568  DPRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTEE  627

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  628  KIEAMRKHF  636



>gb|KCW48261.1| hypothetical protein EUGRSUZ_K019901, partial [Eucalyptus grandis]
Length=173

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+ L +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  65   DPRLGSDFDKEEVLALIKVALMCTNVTPALRPLMSSVVSMLEGKVAVPVLDSAGAIMTEE  124

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  125  KIEAMRKHF  133



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI--IEYDTDLH--E  169
            D +LGS F+KE+A+R+I+VALLCTNPSPALRP+MS  ++MLEGH  +  I  +   H  +
Sbjct  889  DTKLGSKFNKEEAMRIIRVALLCTNPSPALRPTMSTAVSMLEGHTAVHEISGEPSFHGDD  948

Query  170  FNFQAMRDHYDQMPVHLSDS  229
              F++  D YDQ+ +  S++
Sbjct  949  MRFKSFPD-YDQVVLQSSET  967



>gb|KCW48010.1| hypothetical protein EUGRSUZ_K017472, partial [Eucalyptus grandis]
Length=131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDT---DLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + + 
Sbjct  15   DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGATMTQE  74

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  75   RIEAMRKHF  83



>ref|XP_010088635.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36797.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=550

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            DP LGS+F+KE+A+R+IKVA+LC NPSPALRP+MS V+++L+G   I E   D      E
Sbjct  442  DPNLGSDFNKEEAVRMIKVAILCINPSPALRPTMSTVVSVLKGRTAIPELIMDPSIYGDE  501

Query  170  FNFQAMRDHYDQMPVHLSDSP  232
                A+R  ++Q+  H S  P
Sbjct  502  LRLMALRKQFNQIAQHDSTQP  522



>ref|XP_010038955.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=873

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + E 
Sbjct  757  DPRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTEE  816

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  817  KIEAMRKHF  825



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 13/97 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LGS F+KE+A+R+IKVALLC NPSPALRP+MS V++MLEG    HE  I       E
Sbjct  891  DPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDE  950

Query  170  FNFQAMR-----DH--YD--QMPVHLSDSPYQANFSS  253
              F+A       DH  YD  Q  ++ S+  + A+ SS
Sbjct  951  LGFKAFTEDSDIDHSSYDETQSLIYSSNEKWTASTSS  987



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 13/97 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LGS F+KE+A+R+IKVALLC NPSPALRP+MS V++MLEG    HE  I       E
Sbjct  894  DPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDE  953

Query  170  FNFQAMR-----DH--YD--QMPVHLSDSPYQANFSS  253
              F+A       DH  YD  Q  ++ S+  + A+ SS
Sbjct  954  LGFKAFTEDSDIDHSSYDETQSLIYSSNEKWTASTSS  990



>gb|KCW48051.1| hypothetical protein EUGRSUZ_K01793 [Eucalyptus grandis]
Length=642

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  526  DPRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  585

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  586  KIEAMRKHF  594



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LGS F+KE+A+R+IKVALLC NPSPALRP+MS V++MLEG    HE  I       E
Sbjct  857  DPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDE  916

Query  170  FNFQAMRDHYD  202
              F+A  +  D
Sbjct  917  LGFKAFTEDSD  927



>gb|KDO35800.1| hypothetical protein CISIN_1g028061mg [Citrus sinensis]
Length=214

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE---DIIEYDTDLHE-  169
            DPRLGS F+K +A R+IK+ALLCTN SP+LRP+MS V++MLEG     D+I     L E 
Sbjct  63   DPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSED  122

Query  170  FNFQAMRDHYDQM  208
              F+ +RDH  +M
Sbjct  123  LRFKTLRDHPREM  135



>ref|XP_010273497.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Nelumbo nucifera]
Length=979

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDL--HE  169
            DPRLG  F+ E+ + +I VALLCTN S +LRP+MS V+ MLEG   + E+  DT +  H+
Sbjct  862  DPRLGPEFNNEEVMTMINVALLCTNASASLRPTMSTVVRMLEGQTTVQEFVLDTSISSHD  921

Query  170  FNFQAMRDHYDQ  205
             N  A+RDHY Q
Sbjct  922  LNSDAVRDHYQQ  933



>ref|XP_008345927.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Malus domestica]
Length=159

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            D +LGS F+KE+A+R+IKVALLC NPSPALRP+MS V++MLEG    HE  I       E
Sbjct  63   DRKLGSEFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTLVHEVKINPSIYGDE  122

Query  170  FNFQ-------AMRDHYDQMPVHLSDSPYQANFSSDA  259
              F+          +   Q  ++ SD+ + A+ SS A
Sbjct  123  MRFRDFTEDPDTTTEESTQSLLYSSDTKWTASTSSSA  159



>ref|XP_010046856.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=268

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FD+E+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  152  DPRLGSHFDREEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  211

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  212  KIEAMRKHF  220



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DPRLG  F+K++A+++I VALLCTN    LRP+MS V+ MLEG   + E+ +D      E
Sbjct  894  DPRLGLEFNKDEAMKMINVALLCTNTCAPLRPTMSAVVGMLEGQASVTEFVSDTSISSVE  953

Query  170  FNFQAMRDHYDQMPVHLSDSPYQ  238
            + F+ M +HY Q+  H S S  Q
Sbjct  954  WRFKTMMNHYSQVQDHPSISVSQ  976



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 10/75 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+ ++++ALR++ VALLCT+PSPALRP+MS V+ +LE H D+ E+        D 
Sbjct  893  DATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHLDLPEFTMESRFYDDY  952

Query  158  DLHEFNFQAMRDHYD  202
            DL  FNFQ +RD Y+
Sbjct  953  DL--FNFQGLRDKYE  965



>ref|XP_010038894.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=1076

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
             DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  960   DPRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  1019

Query  173   NFQAMRDHY  199
               +AMR H+
Sbjct  1020  KIEAMRKHF  1028



>ref|XP_010273493.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Nelumbo nucifera]
Length=1025

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDL--HE  169
            DPRLG  F+ E+ + +I VALLCTN S +LRP+MS V+ MLEG   + E+  DT +  H+
Sbjct  908  DPRLGPEFNNEEVMTMINVALLCTNASASLRPTMSTVVRMLEGQTTVQEFVLDTSISSHD  967

Query  170  FNFQAMRDHYDQ  205
             N  A+RDHY Q
Sbjct  968  LNSDAVRDHYQQ  979



>ref|XP_010273494.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=1021

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDL--HE  169
            DPRLG  F+ E+ + +I VALLCTN S +LRP+MS V+ MLEG   + E+  DT +  H+
Sbjct  904  DPRLGPEFNNEEVMTMINVALLCTNASASLRPTMSTVVRMLEGQTTVQEFVLDTSISSHD  963

Query  170  FNFQAMRDHYDQ  205
             N  A+RDHY Q
Sbjct  964  LNSDAVRDHYQQ  975



>ref|XP_010036446.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=167

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  63   DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  122

Query  173  NFQAMRDHY  199
              +AM+ H+
Sbjct  123  KIEAMKKHF  131



>ref|XP_010036442.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Eucalyptus grandis]
Length=659

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  548  DPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  607

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  608  KIEAMRKHF  616



>ref|XP_010273495.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Nelumbo nucifera]
Length=991

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDL--HE  169
            DPRLG  F+ E+ + +I VALLCTN S +LRP+MS V+ MLEG   + E+  DT +  H+
Sbjct  874  DPRLGPEFNNEEVMTMINVALLCTNASASLRPTMSTVVRMLEGQTTVQEFVLDTSISSHD  933

Query  170  FNFQAMRDHYDQ  205
             N  A+RDHY Q
Sbjct  934  LNSDAVRDHYQQ  945



>ref|XP_010036440.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=714

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  603  DPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  662

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  663  KIEAMRKHF  671



>ref|XP_006495027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=380

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI---IEYDTDLHE-  169
            DPRLGS FDK +A R+IKVALLCTN SP+LRP+MS V++MLEG  +I   I     L E 
Sbjct  229  DPRLGSEFDKVEAERMIKVALLCTNASPSLRPTMSEVVSMLEGSSNIPYVIPEAGGLSED  288

Query  170  FNFQAMRDHYDQM  208
              F+ +RDH  +M
Sbjct  289  LRFKTLRDHPREM  301



>ref|XP_010036439.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
 ref|XP_010036441.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Eucalyptus grandis]
Length=815

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  704  DPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  763

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  764  KIEAMRKHF  772



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS VI +LE H D+ E+        D 
Sbjct  321  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVIRILEDHLDLPEFNVESRFYDDC  380

Query  158  DLHEFNFQAMRDHYDQMPVHLSDSPYQ  238
            D H  NFQ +RD Y  M   LS S  Q
Sbjct  381  DDH-LNFQGLRDKYGPM---LSSSQSQ  403



>gb|KCW48028.1| hypothetical protein EUGRSUZ_K01762 [Eucalyptus grandis]
Length=817

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  706  DPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  765

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  766  KIEAMRKHF  774



>ref|XP_010273496.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Nelumbo nucifera]
Length=986

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDL--HE  169
            DPRLG  F+ E+ + +I VALLCTN S +LRP+MS V+ MLEG   + E+  DT +  H+
Sbjct  869  DPRLGPEFNNEEVMTMINVALLCTNASASLRPTMSTVVRMLEGQTTVQEFVLDTSISSHD  928

Query  170  FNFQAMRDHYDQ  205
             N  A+RDHY Q
Sbjct  929  LNSDAVRDHYQQ  940



>ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES99711.1| LRR receptor-like kinase [Medicago truncatula]
Length=996

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            D RLGSNF+KE+A+ +I VALLCTN + +LRP+MS V++MLEG     E ++E    L E
Sbjct  891  DKRLGSNFNKEEAMLMINVALLCTNVTSSLRPAMSSVVSMLEGKIAIQELVLESSEVLDE  950

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
               +AMR HY    + + + P+ A+ SS
Sbjct  951  KKMEAMRKHYQDQSISM-EGPWTASSSS  977



>gb|KEH28296.1| LRR receptor-like kinase [Medicago truncatula]
Length=864

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            D RLGSNF+KE+A+ +I VALLCTN + +LRP+MS V++MLEG     E ++E    L E
Sbjct  759  DKRLGSNFNKEEAMLMINVALLCTNVTSSLRPAMSSVVSMLEGKIAIQELVLESSEVLDE  818

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSS  253
               +AMR HY    + + + P+ A+ SS
Sbjct  819  KKMEAMRKHYQDQSISM-EGPWTASSSS  845



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
             DPRLGS+F K++A R+IKV LLCTN SPALRP+MS V+ MLEG  D+ E   D   F   
Sbjct  916   DPRLGSDFKKKEAARMIKVTLLCTNQSPALRPTMSAVVRMLEGKGDVQELVVDPSTFGDS  975

Query  176   --FQAMRDHYDQMPVHLSDSPYQANFSSD  256
               F++ + + DQ  V   D       SSD
Sbjct  976   LRFKSFQGNSDQSSVLSIDETQSLVRSSD  1004



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDL----HE  169
            DP LG+ F+K++A  +IKVALLCTN S  LRP+MS V+ MLEG + I E  +D      +
Sbjct  767  DPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKD  826

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                 +RDHY  M +  S      NFS D 
Sbjct  827  MRISPLRDHYQHMEMQSSSGSLAPNFSLDG  856



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDL----HE  169
            DP LG+ F+K++A  +IKVALLCTN S  LRP+MS V+ MLEG + I E  +D      +
Sbjct  908  DPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKD  967

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                 +RDHY  M +  S      NFS D 
Sbjct  968  MRISPLRDHYQHMEMQSSSGSLAPNFSLDG  997



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDL----HE  169
            DP LG+ F+K++A  +IKVALLCTN S  LRP+MS V+ MLEG + I E  +D      +
Sbjct  908  DPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKD  967

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                 +RDHY  M +  S      NFS D 
Sbjct  968  MRISPLRDHYQHMEMQSSSGSLAPNFSLDG  997



>ref|XP_010655582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=1001

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
            DP+LGS F++++A R+IKVA+LCTN SP LRP MS V++MLEG     E I +   D   
Sbjct  876  DPKLGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDY  935

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
             NF+++ D++ +M   +      + FSSD 
Sbjct  936  LNFKSLGDYHKRMQKQILSGSEASKFSSDG  965



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 60/102 (59%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  489  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  548

Query  149  --YDTDLHEFNFQAMRDHY---DQMPVHLSDSPYQANFSSDA  259
              Y T LH+   Q+  +      Q  V  S+ P+ A+ SS A
Sbjct  549  SGYATALHKKFAQSSVNGSLGESQSLVKSSEGPWTASSSSSA  590



>ref|XP_010655581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=1009

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
            DP+LGS F++++A R+IKVA+LCTN SP LRP MS V++MLEG     E I +   D   
Sbjct  884  DPKLGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDY  943

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
             NF+++ D++ +M   +      + FSSD 
Sbjct  944  LNFKSLGDYHKRMQKQILSGSEASKFSSDG  973



>ref|XP_010655580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1038

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDLHE  169
             DP+LGS F++++A R+IKVA+LCTN SP LRP MS V++MLEG     E I +   D   
Sbjct  913   DPKLGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDY  972

Query  170   FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
              NF+++ D++ +M   +      + FSSD 
Sbjct  973   LNFKSLGDYHKRMQKQILSGSEASKFSSDG  1002



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--DTDLHEFN  175
            D RL S F K++A+R+IKVALLCTNPSP+LRP+MS  + MLEG   + E+     ++   
Sbjct  875  DERLESKFSKKEAVRMIKVALLCTNPSPSLRPTMSEAVRMLEGRAAVPEFVMGQSVYADG  934

Query  176  FQAMRDHYDQM  208
            F A+R+ YDQ+
Sbjct  935  FGALRNQYDQI  945



>ref|XP_006377482.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
 gb|ERP55279.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
Length=617

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS V+NMLEG  +I E       YD D
Sbjct  496  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVLNMLEGQTNIPEVTSDPSIYDND  555

Query  161  LHEFNFQAMRDHYDQM  208
            L     + ++ HY Q+
Sbjct  556  LQS---KRVKGHYQQV  568



>ref|XP_004295408.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1071

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 10/74 (14%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
             DP+LGS F+KE+ALR+IKVALLC N SPALRP+MS V++MLEG  D+ E       YD  
Sbjct  963   DPKLGSGFNKEEALRMIKVALLCANSSPALRPTMSQVVSMLEGRTDVHEVTINPSIYDD-  1021

Query  161   LHEFNFQAMRDHYD  202
               E  F+A  +  D
Sbjct  1022  --EMRFKAFTEDSD  1033



>ref|XP_006467585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1045

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI---IEYDTDLHE-  169
            DPRLGS FDK +A R+IKVALLCTN SP+LRP+MS V++MLEG  +I   I     L E 
Sbjct  894  DPRLGSEFDKVEAERMIKVALLCTNASPSLRPTMSEVVSMLEGSSNIPYVIPEAGGLSED  953

Query  170  FNFQAMRDHYDQM  208
              F+ +RDH  +M
Sbjct  954  LRFKTLRDHPREM  966



>ref|XP_007149540.1| hypothetical protein PHAVU_005G078800g, partial [Phaseolus vulgaris]
 gb|ESW21534.1| hypothetical protein PHAVU_005G078800g, partial [Phaseolus vulgaris]
Length=366

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS F+KE+AL VIKVALLCT  +  LRP+MS V++MLEG   + E  T+    L E
Sbjct  264  DRRLGSEFNKEEALVVIKVALLCTQVTTTLRPTMSAVVSMLEGRSVVEEVVTETSEVLDE  323

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
               +AMR +Y ++ + +   P+ A+ +S ++
Sbjct  324  KRMEAMRQYYHELSIEV---PWTASSTSASD  351



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS V+++LE   D+ E+        D 
Sbjct  711  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDY  770

Query  158  DLHEFNFQAMRDHYDQ  205
            D H  NFQ +RD Y +
Sbjct  771  DDH-LNFQGLRDKYGE  785



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP+LGS FDK++A+R+I+VALLCTN SPALRP MS V+ MLEG  D+ E   D   F   
Sbjct  898  DPKLGSGFDKKEAVRMIQVALLCTNQSPALRPKMSAVVKMLEGKGDVQELVMDPSTFGDP  957

Query  182  AMRDHYDQMP  211
            +    Y   P
Sbjct  958  SRFKGYKHKP  967



>ref|XP_010064500.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Eucalyptus grandis]
Length=138

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  70   DQRLGSHFDEKEVLAMIKVALLCTNATPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEE  129

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  130  TIEAMRKHF  138



>ref|XP_006370931.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
 gb|ERP48728.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
Length=414

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            DPRLGS+F K++A R+IKVALLCTN SPA RP MS V+ MLEG  D+ E   D   F   
Sbjct  308  DPRLGSDFKKKEAARMIKVALLCTNQSPAHRPIMSAVVRMLEGKGDVQELVVDPSTFGDS  367

Query  176  --FQAMRDHYDQMPVHLSDSPYQANFSSD  256
              F++ + + DQ  V   D       +SD
Sbjct  368  LRFKSFQGNSDQSSVLSIDETQSLGRASD  396



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHED-----IIEYDTDLH  166
            DP+LG++ +KE+A  +IKVALLCTNPSPALRP+MS V++ML+G        I++  +   
Sbjct  757  DPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSD  816

Query  167  EFNFQAMRDHYDQM  208
               F A+R  YDQM
Sbjct  817  HLKFNALRGQYDQM  830



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS V+++LE   D+ E+        D 
Sbjct  892  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDY  951

Query  158  DLHEFNFQAMRDHYDQ  205
            D H  NFQ +RD Y +
Sbjct  952  DDH-LNFQGLRDKYGE  966



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS V+++LE   D+ E+        D 
Sbjct  755  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDY  814

Query  158  DLHEFNFQAMRDHYDQ  205
            D H  NFQ +RD Y +
Sbjct  815  DDH-LNFQGLRDKYGE  829



>ref|XP_010064492.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=326

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   I   D++   + E 
Sbjct  211  DRRLGSHFDKEEALALIKVALMCTNATPALRPLMSSVVSMLEGKVAIPVLDSEGAIMTEE  270

Query  173  NFQAMRDHY  199
               AMR H+
Sbjct  271  KIDAMRKHF  279



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 10/75 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+ ++++ALR++ VALLCT+PSPALRP+MS V+ +LE H D+ E+        D 
Sbjct  679  DATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHLDLPEFTMESRFYDDY  738

Query  158  DLHEFNFQAMRDHYD  202
            DL   NFQ +RD Y+
Sbjct  739  DL--LNFQGLRDKYE  751



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS V+++LE   D+ E+        D 
Sbjct  810  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDY  869

Query  158  DLHEFNFQAMRDHYDQ  205
            D H  NFQ +RD Y +
Sbjct  870  DDH-LNFQGLRDKYGE  884



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            D  LGS+  +++ALR+I VALLCTNPSPALRP+MS V+++LE   D+ E+        D 
Sbjct  892  DETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDY  951

Query  158  DLHEFNFQAMRDHYDQ  205
            D H  NFQ +RD Y +
Sbjct  952  DDH-LNFQGLRDKYGE  966



>ref|XP_010036641.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
 ref|XP_010036642.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
 ref|XP_010036643.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=710

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  594  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  653

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  654  RIEAMRKHF  662



>ref|XP_010038964.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420 [Eucalyptus grandis]
Length=737

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  626  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  685

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  686  RIEAMRKHF  694



>ref|XP_010036639.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
Length=739

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  623  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  682

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  683  RIEAMRKHF  691



>gb|KCW48268.1| hypothetical protein EUGRSUZ_K020001, partial [Eucalyptus grandis]
Length=365

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  254  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  313

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  314  RIEAMRKHF  322



>ref|XP_007149532.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
 gb|ESW21526.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
Length=690

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 61/102 (60%), Gaps = 15/102 (15%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGSNF++++ + +IKV LLCTN +  LRPSMS V++MLEG   I E+ +D    + E
Sbjct  574  DRRLGSNFNEKEVMMMIKVGLLCTNTTANLRPSMSSVLSMLEGKTVIPEFISDSSEVMDE  633

Query  170  FNFQAMRDHYDQM---------PVHLS--DSPYQANFSSDAN  262
               +AMR +Y QM           H S  D P+ A+ SS A+
Sbjct  634  MKLEAMRQYYSQMEENERSETHTTHSSSKDGPWTASSSSAAD  675



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+F++++  R+IKVALLC   SP LRPSMS V++MLEG     ++I +      +
Sbjct  844  DPRLGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGSMAIQDEISDPSISGED  903

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q*KIASFTNIVQEIRLVS  319
              F  +R+++ QM +  S      N SS+      I+S +  VQ++ L++
Sbjct  904  SRFSGIREYFQQMILQDSSGAQTQNLSSEGT---WISSSSLSVQDVYLIN  950



>gb|KCW67580.1| hypothetical protein EUGRSUZ_F01336 [Eucalyptus grandis]
Length=193

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDK++ L +I VALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  77   DQRLGSHFDKKEVLAMINVALLCTNATPALRPPMSSVVSMLEGKVAVPVLDSEGTIITEE  136

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR H+    DQ          L+D P+    SS +
Sbjct  137  TIEAMRKHFKGDEDQAVDENITKSMLTDGPWTGTASSTS  175



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHED-----IIEYDTDLH  166
            DP+LG++ +KE+A  +IKVALLCTNPSPALRP+MS V++ML+G        I++  +   
Sbjct  753  DPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSD  812

Query  167  EFNFQAMRDHYDQM  208
               F A+R  YDQM
Sbjct  813  HLKFNALRGQYDQM  826



>gb|KCW48033.1| hypothetical protein EUGRSUZ_K01771 [Eucalyptus grandis]
Length=522

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  415  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEE  474

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  475  KIEAMRKHF  483



>gb|KCW48258.1| hypothetical protein EUGRSUZ_K01987 [Eucalyptus grandis]
Length=1002

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  886  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  945

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  946  RIEAMRKHF  954



>ref|XP_006449568.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
 gb|ESR62808.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
Length=386

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEF-NF  178
            DPRLGS F+K +A ++IKVALLCTN SP+LRP+MS V++MLEG  +I +   +   +  F
Sbjct  242  DPRLGSEFNKVEAEKMIKVALLCTNVSPSLRPTMSEVVSMLEGSSNIPDVIPEAEAYLKF  301

Query  179  QAMRDHYDQM  208
            +AMRD +  M
Sbjct  302  KAMRDSHIHM  311



>ref|XP_006829381.1| hypothetical protein AMTR_s04339p00003650, partial [Amborella 
trichopoda]
 gb|ERM96797.1| hypothetical protein AMTR_s04339p00003650, partial [Amborella 
trichopoda]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDII----EYDTDLHE  169
            DP LGSN+ K++AL+++ V LLCT+PSP LRPSMS +++MLEG+ +++       +   E
Sbjct  15   DPELGSNYSKDEALKMLNVGLLCTSPSPTLRPSMSAIVSMLEGNANVLAPLPRSGSTSEE  74

Query  170  FNFQA  184
            + F+A
Sbjct  75   WRFKA  79



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
             DPRLGS+F++++  R+IKVALLC   SP LRPSMS V++MLEG     ++I +      +
Sbjct  898   DPRLGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGSMAIQDEISDPSISGED  957

Query  170   FNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q*KIASFTNIVQEIRLVS  319
               F  +R+++ QM +  S      N SS+      I+S +  VQ++ L++
Sbjct  958   SRFSGIREYFQQMILQDSSGAQTQNLSSEGT---WISSSSLSVQDVYLIN  1004



>ref|XP_006449566.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
 gb|ESR62806.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
Length=1024

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE---DIIEYDTDLHE-  169
            DPRLGS F+K +A R+IK+ALLCTN SP+LRP+MS V++MLEG     D+I     L E 
Sbjct  873  DPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSED  932

Query  170  FNFQAMRDHYDQM  208
              F+ +RDH  +M
Sbjct  933  LRFKTLRDHPREM  945



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHED-----IIEYDTDLH  166
            DP+LG++ +KE+A  +IKVALLCTNPSPALRP+MS V++ML+G        I++  +   
Sbjct  875  DPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSD  934

Query  167  EFNFQAMRDHYDQM  208
               F A+R  YDQM
Sbjct  935  HLKFNALRGQYDQM  948



>gb|KCW67564.1| hypothetical protein EUGRSUZ_F01313 [Eucalyptus grandis]
Length=660

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   I   D++   + E 
Sbjct  545  DRRLGSHFDKEEALALIKVALMCTNATPALRPLMSSVVSMLEGKVAIPVLDSEGAIMTEE  604

Query  173  NFQAMRDHY  199
               AMR H+
Sbjct  605  KIDAMRKHF  613



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHED-----IIEYDTDLH  166
            DP+LG++ +KE+A  +IKVALLCTNPSPALRP+MS V++ML+G        I++  +   
Sbjct  874  DPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSD  933

Query  167  EFNFQAMRDHYDQM  208
               F A+R  YDQM
Sbjct  934  HLKFNALRGQYDQM  947



>ref|XP_006389048.1| hypothetical protein POPTR_0053s00220g [Populus trichocarpa]
 gb|ERP47962.1| hypothetical protein POPTR_0053s00220g [Populus trichocarpa]
Length=387

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPA+RP+MS V++MLEG  D+ E           
Sbjct  277  DPRLGSEFNKKEVVRMINVALLCTNQSPAVRPTMSTVVSMLEGKTDVEELVMVPSTLVDP  336

Query  149  --YDTDLHEFNFQAMRDHY---DQMPVHLSDSPYQANFSSDA  259
              Y T  H    Q+  +      Q  V  S+ P+ A+ SS A
Sbjct  337  SGYATASHNKFAQSSVNGSLSESQSLVKSSEGPWTASSSSSA  378



>gb|KCW67557.1| hypothetical protein EUGRSUZ_F01307 [Eucalyptus grandis]
Length=1008

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  892  DWRLGSHFDKEEALALIKVALMCTNATPALRPPMSSVVSMLEGKVAVPVLDSEGTIMTEE  951

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  952  KIEAMRKHF  960



>ref|XP_010064485.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=1015

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  899  DWRLGSHFDKEEALALIKVALMCTNATPALRPPMSSVVSMLEGKVAVPVLDSEGTIMTEE  958

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  959  KIEAMRKHF  967



>ref|XP_010038877.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420 [Eucalyptus grandis]
Length=628

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  517  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVVVPVLDSAGTIMTQE  576

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  577  RIEAMRKHF  585



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHED-----IIEYDTDLH  166
            DP+LG++ +KE+A  +IKVALLCTNPSPALRP+MS V++ML+G        I++  +   
Sbjct  897  DPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSD  956

Query  167  EFNFQAMRDHYDQM  208
               F A+R  YDQM
Sbjct  957  HLKFNALRGQYDQM  970



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  521  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIQEVTSDPSIYGDD  580

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  581  LHS---KRLKGHYQQV  593



>gb|KCW48008.1| hypothetical protein EUGRSUZ_K017432, partial [Eucalyptus grandis]
Length=365

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  254  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVVVPVLDSAGTIMTQE  313

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  314  RIEAMRKHF  322



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  485  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  544

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  545  LHS---KHLKGHYQQV  557



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD  160
            D +LGS F+KE+A+R+IKVALLCTNPSPALRP+MS V++MLEG   + E + +
Sbjct  821  DLKLGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGQAIVHELNIN  873



>ref|XP_010665669.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Beta vulgaris subsp. vulgaris]
Length=858

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP MS V++MLEG     E  +      ++
Sbjct  753  DPKLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEGSMVVQELTLAPGIHSND  812

Query  170  FNFQAMRDHYDQMPVHLSDSPYQA  241
            + +QA R ++D MP   SDS  Q+
Sbjct  813  WIYQASRRYHD-MP---SDSETQS  832



>ref|XP_006377521.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
 gb|ERP55318.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
Length=331

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  209  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  268

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  269  LHS---KLLKGHYQQV  281



>gb|KCW67558.1| hypothetical protein EUGRSUZ_F01308 [Eucalyptus grandis]
Length=656

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  545  DRRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSKDAMMTEE  604

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  605  QIEAMRKHF  613



>ref|XP_004488996.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Cicer arietinum]
Length=876

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS+F+K++A+ VI VALLCTN +  LRPSMS V+NMLEG   + E+ +D    + E
Sbjct  759  DRRLGSDFNKKEAMVVINVALLCTNDTSNLRPSMSSVVNMLEGRIVVPEFVSDSSEVMDE  818

Query  170  FNFQAMRDHYDQM  208
              F+ MR +Y QM
Sbjct  819  NKFEVMRQYYSQM  831



>ref|XP_010665667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=976

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP MS V++MLEG     E  +      ++
Sbjct  871  DPKLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEGSMVVQELTLAPGIHSND  930

Query  170  FNFQAMRDHYDQMPVHLSDSPYQA  241
            + +QA R ++D MP   SDS  Q+
Sbjct  931  WIYQASRRYHD-MP---SDSETQS  950



>ref|XP_006377514.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
 gb|ERP55311.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
Length=308

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  187  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  246

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  247  LHS---KHLKGHYQQV  259



>ref|XP_010665666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=999

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP MS V++MLEG     E  +      ++
Sbjct  894  DPKLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEGSMVVQELTLAPGIHSND  953

Query  170  FNFQAMRDHYDQMPVHLSDSPYQA  241
            + +QA R ++D MP   SDS  Q+
Sbjct  954  WIYQASRRYHD-MP---SDSETQS  973



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            DP LG+ F+K++A  +IKVALLCTN S  LRP+MS V+ MLEG + I E  +D      +
Sbjct  442  DPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKD  501

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDA  259
                 +RDHY  M +  S      NFS D 
Sbjct  502  MRISPLRDHYQHMEMQSSSGSLAPNFSLDG  531



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP MS V++MLEG     E  +      ++
Sbjct  895  DPKLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEGSMVVQELTLAPGIHSND  954

Query  170  FNFQAMRDHYDQMPVHLSDSPYQA  241
            + +QA R ++D MP   SDS  Q+
Sbjct  955  WIYQASRRYHD-MP---SDSETQS  974



>ref|XP_004488997.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Cicer arietinum]
Length=876

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS+F+K++A+ VI VALLCTN +  LRPSMS V+NMLEG   + E+ +D    + E
Sbjct  759  DRRLGSDFNKKEAMVVINVALLCTNDTSNLRPSMSSVVNMLEGRIVVPEFVSDSSEVMDE  818

Query  170  FNFQAMRDHYDQM  208
              F+ MR +Y QM
Sbjct  819  NKFEVMRQYYSQM  831



>ref|XP_007149537.1| hypothetical protein PHAVU_005G078500g [Phaseolus vulgaris]
 gb|ESW21531.1| hypothetical protein PHAVU_005G078500g [Phaseolus vulgaris]
Length=998

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIEYDTDLHEF  172
            D RLGSNF+KE+ L +IKVALLCTN +  +RPSMS V+++LEG    E++    +D+ E 
Sbjct  895  DRRLGSNFNKEEVLVLIKVALLCTNVTTTVRPSMSSVVSILEGRTFVEEVFSEASDVEEK  954

Query  173  NFQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
              + MR +Y ++ +   D P+ ++ +S A+
Sbjct  955  KLEKMRQYYQELSIS-KDEPWTSSSTSAAD  983



>gb|KCW67582.1| hypothetical protein EUGRSUZ_F01341 [Eucalyptus grandis]
Length=301

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  185  DQRLGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEE  244

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR H+    DQ          L+D P+    SS +
Sbjct  245  TIEAMRKHFKGDEDQAVDENITKSTLTDGPWTGTASSTS  283



>ref|XP_006377598.1| hypothetical protein POPTR_0011s080251g, partial [Populus trichocarpa]
 gb|ERP55395.1| hypothetical protein POPTR_0011s080251g, partial [Populus trichocarpa]
Length=308

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  221  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIPEVTLDPSIYGDD  280

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  281  LHS---KRVKGHYQQV  293



>gb|KCW67594.1| hypothetical protein EUGRSUZ_F013521, partial [Eucalyptus grandis]
Length=130

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL + KVAL+CTN +PALRP M  V++MLEG   +   D++   + E 
Sbjct  14   DRRLGSHFDKEEALALTKVALMCTNATPALRPPMLSVVSMLEGKVAVPVLDSEGAVMTEE  73

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  74   QIEAMRKHF  82



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP MS V++MLEG     E  +      ++
Sbjct  757  DPKLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEGSMVVQELTLAPGIHSND  816

Query  170  FNFQAMRDHYDQMPVHLSDSPYQA  241
            + +QA R ++D MP   SDS  Q+
Sbjct  817  WIYQASRRYHD-MP---SDSETQS  836



>ref|XP_004488995.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Cicer arietinum]
Length=1008

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS+F+K++A+ VI VALLCTN +  LRPSMS V+NMLEG   + E+ +D    + E
Sbjct  891  DRRLGSDFNKKEAMVVINVALLCTNDTSNLRPSMSSVVNMLEGRIVVPEFVSDSSEVMDE  950

Query  170  FNFQAMRDHYDQM  208
              F+ MR +Y QM
Sbjct  951  NKFEVMRQYYSQM  963



>ref|XP_010064487.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=804

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + E 
Sbjct  693  DRRLGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSKDAMMTEE  752

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  753  QIEAMRKHF  761



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            D RLGS FDKE+ +R+I VALLCTN S  LRP+MS V++MLEG   I E+  D      E
Sbjct  898  DIRLGSEFDKEEVMRMINVALLCTNTSSTLRPAMSAVVSMLEGQAAIQEFVPDSSITDDE  957

Query  170  FNFQAMRDHYDQ  205
              ++A++DH+ Q
Sbjct  958  VRYKAIQDHFWQ  969



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS V+NMLEG   I E       YD D
Sbjct  442  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVLNMLEGQTSIPEVTSDPSIYDND  501

Query  161  LHEFNFQAMRDHYDQM  208
            L     + ++ HY Q+
Sbjct  502  LQS---KRVKGHYQQV  514



>gb|KCW48041.1| hypothetical protein EUGRSUZ_K01781 [Eucalyptus grandis]
Length=694

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYD---TDLHEF  172
            DPRLGS+F+KE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D   T + + 
Sbjct  590  DPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTQE  649

Query  173  NFQAMRDHY  199
              +AM+ H+
Sbjct  650  KIEAMKKHF  658



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
             D RLGS+++KEQA+R+ KVALLCTN +P+LRP+MS+V++MLEG   + E   D      +
Sbjct  1566  DQRLGSDYNKEQAIRMAKVALLCTNSAPSLRPTMSVVVSMLEGKTAVPELIMDPSIYGDK  1625

Query  170   FNFQAMRDHYDQM  208
                 A+R+ +DQ+
Sbjct  1626  MRMTALRNQFDQI  1638


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE--DIIEYDTDLH  166
            DPRLGS+F+K++ALR IKVALLC NP+ ALRP MS V++MLEG    D +  D  +H
Sbjct  538  DPRLGSDFNKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPVDEVALDPSIH  594



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ +           
Sbjct  510  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEDLVMVPSTLVDP  569

Query  149  --YDTDLHEFNFQ---AMRDHYDQMPVHLSDSPYQANFSSDA  259
              Y T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  570  SGYATALHNKFAQSSVSGSLSESQSLVKSSEGPWTASSSSSA  611



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  297  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  356

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  357  LHS---KHLKGHYQQV  369



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+  +E+A+R+IKVALLC N +PALRP+MS V++MLEG    HE + +  T   E
Sbjct  769  DPRLGSDVSEEEAIRMIKVALLCINAAPALRPAMSAVVSMLEGRTAVHELVTDPSTYGDE  828

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANF----SSDA  259
                A+ + +D    + S +P Q +     SSDA
Sbjct  829  LRLTALTNQFDH---NSSQNPSQTHLIVPSSSDA  859



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E
Sbjct  671  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  719



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  434  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  493

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  494  LHS---KRLKGHYQQV  506



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  470  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIPEVTSDPSIYGDD  529

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  530  LHS---KRVKGHYQQV  542



>gb|KCW67576.1| hypothetical protein EUGRSUZ_F013322, partial [Eucalyptus grandis]
Length=379

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKEQ L +IKVALLCTN +P LRP MS V++MLEG   +   D++     E 
Sbjct  254  DARLGSHFDKEQVLAMIKVALLCTNATPTLRPVMSSVVSMLEGKVAVPVLDSEGAIKAEE  313

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  314  KIEAMRKHF  322



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  723  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  782

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  783  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  824



>ref|XP_010060741.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=193

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (59%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  77   DQRLGSHFDEKEVLAMIKVALLCTNATPALRPPMSSVVSMLEGKAAVPMLDSEAAIIMEE  136

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR  +    DQ          L+D P+    SS +
Sbjct  137  TIEAMRKRFKGDEDQAVDENITKSTLTDGPWTGTASSTS  175



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E
Sbjct  870  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  918



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  894  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  953

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  954  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  995



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  894  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  953

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  954  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  995



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+  +E+A+R+IKVALLC N +PALRP+MS V++MLEG    HE + +  T   E
Sbjct  822  DPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDE  881

Query  170  FNFQAMRDHYDQMPVHLSDSPYQAN----FSSDA  259
                A+ + +D      S +P Q       SSDA
Sbjct  882  LRLTALTNQFDHSS---SQNPSQTQSLVPSSSDA  912



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E
Sbjct  894  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E
Sbjct  894  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  892  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  951

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  952  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  993



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  894  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  953

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  954  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  995



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E
Sbjct  892  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  940



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  892  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLGDP  951

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              + T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  952  SGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGPWTASSSSSA  993



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+  +E+A+R+IKVALLC N +PALRP+MS V++MLEG    HE + +  T   E
Sbjct  833  DPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDE  892

Query  170  FNFQAMRDHYDQ  205
                A+ + +D 
Sbjct  893  LRLTALTNQFDH  904



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 8/94 (9%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGSNF K++A+ ++ +ALLCTNPSP LRP+MS V++MLEG       II  ++D  +
Sbjct  892  DPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSVVSMLEGKTAVQAPIIRRNSDSQD  951

Query  170  FNFQAMRDHYDQMPVHLS----DSPYQANFSSDA  259
              F+A          H+S    +S  Q   S DA
Sbjct  952  ARFRAFEILSQDSQTHVSTLSQESEMQRTMSIDA  985



>gb|KHG23496.1| putative LRR receptor-like serine/threonine-protein kinase RFK1 
[Gossypium arboreum]
Length=746

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 10/72 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDII----EYDTD  160
            D +LGSN++K +A R+IKVALLCTN SP+LRP+MS V+ MLEG     D+I     Y+ D
Sbjct  639  DDKLGSNYNKSEAERMIKVALLCTNASPSLRPTMSDVVGMLEGTITIPDVIPNACSYNED  698

Query  161  LHEFNFQAMRDH  196
            L    F+A+RDH
Sbjct  699  LR---FKAIRDH  707



>ref|XP_011002041.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=1009

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  904  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDD  963

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + +  HY Q+
Sbjct  964  LHS---KRLEGHYQQV  976



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  452  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  511

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  512  LHS---KHLKGHYQQV  524



>ref|XP_010040667.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=619

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RL S+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   I   D++   + + 
Sbjct  503  DRRLSSHFDKEEALALIKVALMCTNATPALRPPMSSVVSMLEGKVAIPVLDSEGAMMTDE  562

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  563  QIEAMRKHF  571



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE  148
            D +LGS F+KE+A+R+IKVALLC NPSPALRPSMS V++MLEG   + E
Sbjct  892  DRKLGSGFNKEEAMRMIKVALLCANPSPALRPSMSAVVSMLEGQTLVQE  940



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I +ALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  882  DPRLGSEFNKKEVVRMINIALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLVDP  941

Query  149  --YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  259
              Y T LH+   Q+  +      Q  V  S+ P  A+ SS A
Sbjct  942  SGYATALHKKFAQSSVNGSLSESQSLVKSSEGPGTASSSSSA  983



>ref|XP_011002042.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=1002

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  880  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDD  939

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + +  HY Q+
Sbjct  940  LHS---KRLEGHYQQV  952



>ref|XP_011002039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1026

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  904  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDD  963

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + +  HY Q+
Sbjct  964  LHS---KRLEGHYQQV  976



>ref|XP_011002040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=1024

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  902  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDD  961

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + +  HY Q+
Sbjct  962  LHS---KRLEGHYQQV  974



>ref|XP_010313922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=919

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLG+N+ K++A+R+I V+LLCTNPSP LRPSMS V++MLEG       II+  T   E
Sbjct  794  DPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGKLPVQAPIIKRTTSDDE  853

Query  170  FNFQA  184
              F++
Sbjct  854  MRFKS  858



>ref|XP_006377463.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
 gb|ERP55260.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
Length=363

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V +MLEG   I E       Y  D
Sbjct  241  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVASMLEGQTSIQEMISDPSIYGDD  300

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY Q+
Sbjct  301  LHS---KLLKGHYQQV  313



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ +           
Sbjct  862  DPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEDLVMVPSTLVDP  921

Query  149  --YDTDLHEFNFQ---AMRDHYDQMPVHLSDSPYQANFSSDA  259
              Y T LH    Q   +      Q  V  S+ P+ A+ SS A
Sbjct  922  SGYATALHNKFAQSSVSGSLSESQSLVKSSEGPWTASSSSSA  963



>gb|KCW67550.1| hypothetical protein EUGRSUZ_F013052, partial [Eucalyptus grandis]
Length=337

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DPRLGSN+ +E+A+R++ +ALLCTNPSP LRP+MS V++MLEG   I
Sbjct  215  DPRLGSNYSEEEAMRMLNLALLCTNPSPTLRPAMSSVVSMLEGKGAI  261



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  591  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  650

Query  161  LHEFNFQAMRDHYDQ  205
            LH    + +  HY Q
Sbjct  651  LHS---KHLIGHYQQ  662



>ref|XP_004251900.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
 ref|XP_010313921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
Length=1018

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLG+N+ K++A+R+I V+LLCTNPSP LRPSMS V++MLEG       II+  T   E
Sbjct  893  DPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGKLPVQAPIIKRTTSDDE  952

Query  170  FNFQA  184
              F++
Sbjct  953  MRFKS  957



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 8/94 (9%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGSNF K++A+ ++ +ALLCTNPSP LRP+MS  ++MLEG       II  ++D  +
Sbjct  842  DPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSMLEGKTAVQAPIIRRNSDSQD  901

Query  170  FNFQAM----RDHYDQMPVHLSDSPYQANFSSDA  259
              F+A     +D   Q+     +S  Q   S DA
Sbjct  902  ARFRAFEILSQDSQTQVSTLSQESEMQRTMSIDA  935



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 16/100 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPR+G+ F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  895  DPRMGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLVDP  954

Query  149  --YDTDL-HEFNFQAMRDHYDQMP--VHLSDSPYQANFSS  253
              Y T L ++F   ++ +   + P  V  S+ P+ A+ SS
Sbjct  955  SRYATSLQNKFAQSSVNESSSETPSLVKSSEGPWTASSSS  994



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 16/100 (16%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-----------  148
            DPR+G+ F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E           
Sbjct  893  DPRMGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLVDP  952

Query  149  --YDTDL-HEFNFQAMRDHYDQMP--VHLSDSPYQANFSS  253
              Y T L ++F   ++ +   + P  V  S+ P+ A+ SS
Sbjct  953  SRYATSLQNKFAQSSVNESSSETPSLVKSSEGPWTASSSS  992



>ref|XP_010064502.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=1028

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDKEQ L +IKVALLCTN +P LRP MS V++MLEG   +   D++     E 
Sbjct  903  DARLGSHFDKEQVLAMIKVALLCTNATPTLRPVMSSVVSMLEGKVAVPVLDSEGAIKAEE  962

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  963  KIEAMRKHF  971



>ref|XP_010060733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG  130
            DPRLGSN+ +E+A+R++ +ALLCTNPSP LRP+MS V++MLEG
Sbjct  888  DPRLGSNYSEEEAMRMLNLALLCTNPSPTLRPAMSSVVSMLEG  930



>gb|KCW63414.1| hypothetical protein EUGRSUZ_G01055 [Eucalyptus grandis]
Length=918

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            DPRLGS+F+K +AL +IKVAL+CTN +PALRP MS V++MLEG   +   D+    + + 
Sbjct  829  DPRLGSHFNKAEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTQE  888

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  889  KIEAMRKHF  897



>ref|XP_002882896.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59155.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=988

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 64/100 (64%), Gaps = 13/100 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH-----EDIIE--YDTD  160
            DPRLG++++K++A+ +IK+ +LCT+P+P  RPSMS V++MLEGH     E ++E   + +
Sbjct  871  DPRLGTDYNKQEAMTMIKIGMLCTSPAPGDRPSMSTVVSMLEGHSTVNVEKLLEASLNNE  930

Query  161  LHEFNFQAMRDHYDQM------PVHLSDSPYQANFSSDAN  262
              E + +AM+ HY  +          +D P+ ++ +S AN
Sbjct  931  KDEESVRAMKRHYATIGEEEITNTTATDGPFTSSSTSTAN  970



>gb|KGN55041.1| hypothetical protein Csa_4G624960 [Cucumis sativus]
Length=941

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP L SN+ KE+ +R+I +ALLCTNPSP LRPSMS V++MLEG       II+ DT   E
Sbjct  822  DPNLDSNYPKEEVMRMINIALLCTNPSPTLRPSMSSVVSMLEGKIAVQAPIIKRDTVDQE  881

Query  170  FNFQA  184
              F+A
Sbjct  882  ARFKA  886



>gb|KCW67607.1| hypothetical protein EUGRSUZ_F013621, partial [Eucalyptus grandis]
Length=933

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  817  DQRLGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEE  876

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR H+    DQ          L+D P+    SS +
Sbjct  877  TIEAMRKHFKSDEDQAVGENITESMLTDGPWAGTASSTS  915



>ref|XP_004491064.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=908

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            D RLG+NF+KE+A+ +I VALLCTN +  LRP+MS V++MLEG  DI E  T+  E +  
Sbjct  804  DKRLGTNFNKEEAMVMINVALLCTNVTSNLRPAMSSVVSMLEGTIDIQEVFTESSEVSDE  863

Query  176  --FQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
               +AMR +Y +  + + + P+ A+ S+ AN
Sbjct  864  KKMEAMRQYYQEHSIQM-EGPWTAS-STSAN  892



>ref|XP_008349229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=284

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+ + E+AL ++KVALLC NP+PALRP+MS V++MLEG     E ++  +    E
Sbjct  171  DPRLGSDIEVEEALTMVKVALLCINPAPALRPTMSAVVSMLEGRTLVRESVMNPNIYGDE  230

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  262
                 +R+ +D      +        SSDA 
Sbjct  231  LKLSTLRNPFDPTAKGGTSGTQSLVGSSDAT  261



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 10/71 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIE----YDTD  160
            DP+LGS F++++A R+IKVALLCTN SP LRP+MS V++MLEG    +D+I     Y+ D
Sbjct  771  DPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQTVVQDVISDPGIYNDD  830

Query  161  LHEFNFQAMRD  193
            L    F+ +RD
Sbjct  831  LR---FRPLRD  838



>ref|XP_010060749.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
Length=1021

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
             D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  905   DQRLGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEE  964

Query  173   NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
               +AMR H+    DQ          L+D P+    SS +
Sbjct  965   TIEAMRKHFKSDEDQAVGENITESMLTDGPWAGTASSTS  1003



>ref|NP_001235287.1| receptor-like protein kinase [Glycine max]
 gb|ACM89557.1| receptor-like protein kinase [Glycine max]
Length=272

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 15/102 (15%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS+F++ + + +IKVALLCTN +  LRP+MS V++MLEG   I E+ +D    + E
Sbjct  156  DRRLGSDFNENEVMMMIKVALLCTNTTSNLRPTMSSVLSMLEGKTMIPEFVSDPSEIMDE  215

Query  170  FNFQAMRDHYDQMPVHLSDS-----------PYQANFSSDAN  262
               +AMR HY Q     S++           P+ A+ SS A+
Sbjct  216  MKLEAMRQHYFQKENERSETQEQNHSLSIEGPWTASSSSAAD  257



>ref|XP_010095160.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC41541.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=179

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG  130
            DP LGS + KE+A+R++ +ALLCTNPSP LRP+MS V++MLEG
Sbjct  63   DPSLGSKYSKEEAMRMLNIALLCTNPSPTLRPTMSSVVSMLEG  105



>ref|XP_007021942.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
3 [Theobroma cacao]
 gb|EOY13467.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
3 [Theobroma cacao]
Length=887

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 13/100 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY-DTDL--HEF  172
            DPR+GS  + E+ + +I VALLCTNP+ A RPSMS V++MLEG   I E+ D+     E 
Sbjct  770  DPRIGSECNIEEVMAMINVALLCTNPTAAARPSMSSVVSMLEGRAAISEFIDSSFSAKEM  829

Query  173  NFQAMRDHYDQMPVH----------LSDSPYQANFSSDAN  262
            N +AM+  Y Q+  +          LSD P+ ++ +S A+
Sbjct  830  NAEAMKKLYQQLEQNDADNSQTKSMLSDGPWTSSSTSAAD  869



>gb|KCW75321.1| hypothetical protein EUGRSUZ_E04067 [Eucalyptus grandis]
Length=648

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RL  +FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  537  DQRLNCHFDKEEALVLIKVALMCTNATPALRPPMSSVVSMLEGKVTVPVLDSEGAIMTEE  596

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  597  KIEAMRKHF  605



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            D +LGS F+KE+ALR+IKVA+LC N SPALRP+MS V++MLEG   + E   +      E
Sbjct  892  DRKLGSEFNKEEALRMIKVAVLCVNSSPALRPTMSAVVSMLEGQTPVCEVKINPSIYGDE  951

Query  170  FNFQAMRDHYDQMPVHLSDS  229
              F+A  +  D   V  + S
Sbjct  952  LRFRAFTEDSDTASVQSTQS  971



>ref|XP_011002047.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=983

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  881  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  940

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  941  LHSKRVKGHYQQV  953



>ref|XP_004146083.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
 ref|XP_004167552.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
Length=1012

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP L SN+ KE+ +R+I +ALLCTNPSP LRPSMS V++MLEG       II+ DT   E
Sbjct  893  DPNLDSNYPKEEVMRMINIALLCTNPSPTLRPSMSSVVSMLEGKIAVQAPIIKRDTVDQE  952

Query  170  FNFQA  184
              F+A
Sbjct  953  ARFKA  957



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  857  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  916

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  917  LHSKRVKGHYQQV  929



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  861  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  920

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  921  LHSKRVKGHYQQV  933



>ref|XP_011002045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=985

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  883  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  942

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  943  LHSKRVKGHYQQV  955



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  900  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  959

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  960  LHSKRVKGHYQQV  972



>ref|XP_011002044.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1007

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  905  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  964

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  965  LHSKRVKGHYQQV  977



>ref|XP_008346191.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Malus domestica]
Length=193

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIEYDTDLH--  166
            DP LGS F++++A+R+IKVALLCTN SP LRP+MS V++MLEG     +++  ++ ++  
Sbjct  112  DPMLGSEFNEQEAMRMIKVALLCTNRSPTLRPTMSAVVSMLEGRAIVRELLNVNSSIYSD  171

Query  167  EFNFQAMR  190
            E  F+++R
Sbjct  172  EVRFKSLR  179



>gb|KCW45029.1| hypothetical protein EUGRSUZ_L013821, partial [Eucalyptus grandis]
Length=370

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RL S+FDKE+AL +IKVAL+CTN +PALRP MS V++MLEG   I   D++   + + 
Sbjct  254  DRRLSSHFDKEEALALIKVALMCTNATPALRPPMSSVVSMLEGKVAIPVLDSEGAMMTDE  313

Query  173  NFQAMRDHY  199
              +AMR H+
Sbjct  314  QIEAMRKHF  322



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+  +E+A+R+IKVALLC N +PALRP+MS V++MLEG    HE + +  T   E
Sbjct  869  DPRLGSDVSEEEAIRMIKVALLCINAAPALRPAMSAVVSMLEGRTAVHELVTDPSTYGDE  928

Query  170  FNFQAMRDHYDQMPVHLSDSPYQAN----FSSDA  259
                A+ + +D    + S +P Q       SSDA
Sbjct  929  LRLTALPNQFDH---NSSQNPSQTQSLVPSSSDA  959



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEF---  172
            DP LGS F+K++A+ +IKVALLCTN SPALRP MS V+ MLEG  D+ E   D   F   
Sbjct  724  DPNLGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGDVQELVMDPSTFGDP  783

Query  173  -NFQAMRDHYDQMP----------VHLSDSPYQANFSSDA  259
             +F+  +   DQ            V  SD P+  + S+ A
Sbjct  784  SSFKGYKHKSDQSSFGNISENQSLVRSSDGPWIDSSSTSA  823



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 8/94 (9%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGSNF K++A+ ++ +ALLCTNPSP LRP+MS  ++MLEG       II  ++D  +
Sbjct  892  DPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSMLEGKTAVQAPIIRRNSDSQD  951

Query  170  FNFQAMRDHYDQMPVHLS----DSPYQANFSSDA  259
              F+A          H+S    +S  Q   S DA
Sbjct  952  ARFRAFEILSQDSQTHVSTLSQESEMQRTMSIDA  985



>ref|XP_006449567.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
 gb|ESR62807.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
Length=1023

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 4/69 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE---DII-EYDTDLHE  169
            D RLGS ++KE+A R+IKV+LLCTN SP+LRP+MS V+NMLEG     D+I E  +   +
Sbjct  884  DERLGSKYNKEEAERMIKVSLLCTNASPSLRPTMSEVVNMLEGKTAIPDMIPEAGSYSQD  943

Query  170  FNFQAMRDH  196
              F+A+RD 
Sbjct  944  LRFKALRDQ  952



>ref|XP_011002046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=983

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLH----E  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      E
Sbjct  881  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDE  940

Query  170  FNFQAMRDHYDQM  208
             + + ++ HY Q+
Sbjct  941  LHSKRVKGHYQQV  953



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 10/71 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIE----YDTD  160
            DP+LGS F++++A R+IKVALLCTN SP LRP+MS V++MLEG    +D+I     Y+ D
Sbjct  898  DPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQTVVQDVISDPGIYNDD  957

Query  161  LHEFNFQAMRD  193
            L    F+ +RD
Sbjct  958  LR---FRPLRD  965



>ref|XP_007021940.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY13465.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1020

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 13/100 (13%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY-DTDL--HEF  172
             DPR+GS  + E+ + +I VALLCTNP+ A RPSMS V++MLEG   I E+ D+     E 
Sbjct  903   DPRIGSECNIEEVMAMINVALLCTNPTAAARPSMSSVVSMLEGRAAISEFIDSSFSAKEM  962

Query  173   NFQAMRDHYDQMPVH----------LSDSPYQANFSSDAN  262
             N +AM+  Y Q+  +          LSD P+ ++ +S A+
Sbjct  963   NAEAMKKLYQQLEQNDADNSQTKSMLSDGPWTSSSTSAAD  1002



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 10/71 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIE----YDTD  160
            DP+LGS F++++A R+IKVALLCTN SP LRP+MS V++MLEG    +D+I     Y+ D
Sbjct  885  DPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQTVVQDVISDPGIYNDD  944

Query  161  LHEFNFQAMRD  193
            L    F+ +RD
Sbjct  945  LR---FRPLRD  952



>ref|XP_007021941.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2 [Theobroma cacao]
 gb|EOY13466.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2 [Theobroma cacao]
Length=881

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 13/100 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY-DTDL--HEF  172
            DPR+GS  + E+ + +I VALLCTNP+ A RPSMS V++MLEG   I E+ D+     E 
Sbjct  764  DPRIGSECNIEEVMAMINVALLCTNPTAAARPSMSSVVSMLEGRAAISEFIDSSFSAKEM  823

Query  173  NFQAMRDHYDQMPVH----------LSDSPYQANFSSDAN  262
            N +AM+  Y Q+  +          LSD P+ ++ +S A+
Sbjct  824  NAEAMKKLYQQLEQNDADNSQTKSMLSDGPWTSSSTSAAD  863



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEF---  172
            DP LGS F+K++A+ +IKVALLCTN SPALRP MS V+ MLEG  D+ E   D   F   
Sbjct  901  DPNLGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGDVQELVMDPSTFGDP  960

Query  173  -NFQAMRDHYDQMP----------VHLSDSPYQANFSSDA  259
             +F+  +   DQ            V  SD P+  + S+ A
Sbjct  961  SSFKGYKHKSDQSSFGNISENQSLVRSSDGPWIDSSSTSA  1000



>ref|XP_010064503.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=865

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FDK++ L +I VALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  749  DQRLGSHFDKKEVLAMINVALLCTNATPALRPPMSSVVSMLEGKVAVPVLDSEGTIITEE  808

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR H+    DQ          L+D P+    SS +
Sbjct  809  TIEAMRKHFKGDEDQAVDENITKSMLTDGPWTGTASSTS  847



>ref|XP_006377505.1| hypothetical protein POPTR_0011s065402g, partial [Populus trichocarpa]
 gb|ERP55302.1| hypothetical protein POPTR_0011s065402g, partial [Populus trichocarpa]
Length=413

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK ALLCTN SP+LRP+MS +++MLEG   I E       Y  D
Sbjct  293  DPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSDMMSMLEGQTSIQEMISDPSIYGDD  352

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ HY+Q+
Sbjct  353  LHS---KHLKGHYEQV  365



>gb|KDP21153.1| hypothetical protein JCGZ_21624 [Jatropha curcas]
Length=745

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFN--  175
            D +LGS+F K +A R+IKVALLCTN SP+LRP MS V+N LEG   I +  ++   +N  
Sbjct  639  DEKLGSDFKKVEAERMIKVALLCTNGSPSLRPGMSEVVNRLEGATAITDVISEASSYNED  698

Query  176  --FQAMRDHYDQMPVHLSDSPYQANFSS  253
              F+A+R++  Q+ +  S   +  +FSS
Sbjct  699  LRFKAIRENRKQI-IESSSGNHNQDFSS  725



>ref|XP_006377493.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
 gb|ERP55290.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
Length=276

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 11/77 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEY--------DT  157
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E         D 
Sbjct  156  DPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTCIPEVTSDPSIYDDD  215

Query  158  DLHEFNFQAMRDHYDQM  208
            DLH    + ++ HY Q+
Sbjct  216  DLHS---KRVKGHYQQV  229



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DPRLGS+  +E+ +R+IKVALLC N +PALRP+MS V++MLEG    HE + +  T   E
Sbjct  891  DPRLGSDVSEEEVIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDE  950

Query  170  FNFQAMRDHYDQMPVHLSDSPYQAN----FSSDA  259
                A+ + +D    + S +P Q       SSDA
Sbjct  951  LRLTALTNQFDH---NSSQNPSQTQSLIPSSSDA  981



>gb|AAL73330.1| putative receptor-like protein kinase RLPK1 [Glycine max]
Length=225

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDLHE  169
            DP LGS +  E+A+R++++ALLCTNPSP LRPSMS V++MLEG       II+    + +
Sbjct  103  DPSLGSKYSSEEAMRMLQLALLCTNPSPTLRPSMSSVVSMLEGKTPIQAPIIKRSDSVED  162

Query  170  FNFQA  184
              F+A
Sbjct  163  VRFKA  167



>ref|XP_006377461.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
 gb|ERP55258.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
Length=313

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------YDTD  160
            DP+L S F+KE+A R+IK+ALLCTN SP+LRP+MS V++MLEG   I E       Y  D
Sbjct  191  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  250

Query  161  LHEFNFQAMRDHYDQM  208
            LH    + ++ H  Q+
Sbjct  251  LHS---KLLKGHCQQV  263



>ref|XP_010064505.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=607

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD---LHEF  172
            D RLGS+FD+++ L +IKVALLCTN +PALRP MS V++MLEG   +   D++   + E 
Sbjct  491  DQRLGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEE  550

Query  173  NFQAMRDHY----DQ------MPVHLSDSPYQANFSSDA  259
              +AMR H+    DQ          L+D P+    SS +
Sbjct  551  TIEAMRKHFKGDEDQAVDENITKSTLTDGPWTGTASSTS  589



>ref|XP_006847775.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
 gb|ERN09356.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
Length=559

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DP LGSN+ K++AL+++ V LLCTNPSP LRPSMS V++MLEG+ ++
Sbjct  431  DPELGSNYSKDEALKMLNVGLLCTNPSPTLRPSMSAVVSMLEGNANV  477



>ref|XP_008463779.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Cucumis melo]
Length=852

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DPRLGSNF++ +ALR+IK+AL CTN SPA RP+MS V++MLEG ++I
Sbjct  737  DPRLGSNFNEGEALRMIKIALHCTNVSPAARPNMSSVVSMLEGRQEI  783



>ref|XP_008384519.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=913

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 7/67 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP LGS+F+ E+A+ ++KVALLC NP+ ALRP+MS V++MLEG        T +HE    
Sbjct  795  DPSLGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGR-------TLVHELKLS  847

Query  182  AMRDHYD  202
            A+R+ +D
Sbjct  848  ALRNPFD  854



>ref|XP_008384518.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=915

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 7/67 (10%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTDLHEFNFQ  181
            DP LGS+F+ E+A+ ++KVALLC NP+ ALRP+MS V++MLEG        T +HE    
Sbjct  797  DPSLGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGR-------TLVHELKLS  849

Query  182  AMRDHYD  202
            A+R+ +D
Sbjct  850  ALRNPFD  856



>gb|KCW71078.1| hypothetical protein EUGRSUZ_F04177 [Eucalyptus grandis]
Length=771

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DPRLGS++ KE+A+R++ +ALLCTNPSP LRP MS V+++LEG+  I
Sbjct  649  DPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPPMSTVVSILEGNSPI  695



>ref|XP_008463778.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Cucumis melo]
Length=1015

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DPRLGSNF++ +ALR+IK+AL CTN SPA RP+MS V++MLEG ++I
Sbjct  900  DPRLGSNFNEGEALRMIKIALHCTNVSPAARPNMSSVVSMLEGRQEI  946



>ref|XP_010063817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1009

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DPRLGS++ KE+A+R++ +ALLCTNPSP LRP MS V+++LEG+  I
Sbjct  887  DPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPPMSTVVSILEGNSPI  933



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            DP+L S F+KE+A R+IK ALLCTN SP++RP+MS V++MLEG   I E  +D      +
Sbjct  549  DPKLHSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIFYDD  608

Query  170  FNFQAMRDHYDQM  208
             + + +  HY Q+
Sbjct  609  LHSKRVNGHYQQV  621



>gb|AES66495.2| LRR receptor-like kinase [Medicago truncatula]
Length=994

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD----LHE  169
            D RLGS+F+K++A+ +I VALLCTN +  LRPSMS V++MLEG   + E+ +D    + E
Sbjct  885  DSRLGSDFNKKEAMVMINVALLCTNDTSNLRPSMSSVVSMLEGRTVVPEFVSDSSEVMDE  944

Query  170  FNFQAMRDHYDQMPVHLSDSPYQANFSSD  256
               + MR +Y QM  +        + SSD
Sbjct  945  QKLEVMRQYYSQMEKNKVCKSQSRSLSSD  973



>ref|NP_188102.5| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 sp|C0LGN2.1|Y3148_ARATH RecName: Full=Probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ACN59317.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75574.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1020

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 64/100 (64%), Gaps = 13/100 (13%)
 Frame = +2

Query  2     DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH-----EDIIE--YDTD  160
             DPRLG++++K++AL +I++ +LCT+P+P  RPSMS V++MLEGH     E ++E   + +
Sbjct  903   DPRLGTDYNKQEALMMIQIGMLCTSPAPGDRPSMSTVVSMLEGHSTVNVEKLLEASVNNE  962

Query  161   LHEFNFQAMRDHYDQM------PVHLSDSPYQANFSSDAN  262
               E + +AM+ HY  +          +D P+ ++ +S AN
Sbjct  963   KDEESVRAMKRHYATIGEEEITNTTTTDGPFTSSSTSTAN  1002



>ref|XP_006847776.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
 gb|ERN09357.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
Length=326

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDI  142
            DP LGSN+ K++AL+++ V  LCTNPSP LRPSMS V++MLEG+ ++
Sbjct  208  DPELGSNYSKDEALKMLNVGFLCTNPSPTLRPSMSAVVSMLEGNANV  254



>ref|XP_008463810.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Cucumis melo]
Length=106

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIEYDTD  160
            DP+LGSNF++E+A++++ +A LCTN SP+ RP+MS V++MLEG   + E  +D
Sbjct  5    DPKLGSNFNEEEAMKMMNIAFLCTNVSPSARPTMSSVVSMLEGKVSVKELISD  57



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 10/71 (14%)
 Frame = +2

Query  2    DPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH---EDIIE----YDTD  160
            DP+LGS F++++A R+IKVALLCTN SP LRP+MS V++MLEG    +D+I     Y+ D
Sbjct  432  DPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQTVVQDVISDPGIYNDD  491

Query  161  LHEFNFQAMRD  193
            L    F+ +RD
Sbjct  492  LR---FRPLRD  499



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 704648528304