BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13871_g1_i2 len=1533 path=[340:0-297 638:298-433 4779:434-691
1739:692-1532]

Length=1533
                                                                      Score     E

ref|XP_006361400.1|  PREDICTED: macrophage erythroblast attacher-...    194   3e-52   
ref|XP_009767482.1|  PREDICTED: macrophage erythroblast attacher        193   5e-52   
ref|XP_009601755.1|  PREDICTED: macrophage erythroblast attacher        193   5e-52   
ref|XP_010534666.1|  PREDICTED: macrophage erythroblast attacher-...    182   3e-51   
emb|CDP00007.1|  unnamed protein product                                191   5e-51   
ref|XP_004236773.1|  PREDICTED: macrophage erythroblast attacher        190   1e-50   
ref|XP_006436159.1|  hypothetical protein CICLE_v10031660mg             184   2e-50   
gb|KDO67852.1|  hypothetical protein CISIN_1g014891mg                   185   1e-49   
ref|XP_006436161.1|  hypothetical protein CICLE_v10031660mg             185   1e-49   
ref|XP_008233402.1|  PREDICTED: macrophage erythroblast attacher ...    186   2e-49   
ref|XP_007218090.1|  hypothetical protein PRUPE_ppa006477mg             186   2e-49   
gb|KDO67853.1|  hypothetical protein CISIN_1g014891mg                   186   2e-49   
ref|XP_006436162.1|  hypothetical protein CICLE_v10031660mg             186   2e-49   
ref|XP_011076892.1|  PREDICTED: macrophage erythroblast attacher        185   5e-49   
ref|XP_008369829.1|  PREDICTED: macrophage erythroblast attacher-...    183   5e-49   
ref|XP_011018776.1|  PREDICTED: macrophage erythroblast attacher        184   8e-49   
ref|XP_008384314.1|  PREDICTED: macrophage erythroblast attacher        184   1e-48   
ref|XP_008354097.1|  PREDICTED: macrophage erythroblast attacher-...    184   2e-48   
gb|KDP46128.1|  hypothetical protein JCGZ_06639                         183   2e-48   
ref|XP_010259978.1|  PREDICTED: macrophage erythroblast attacher        183   2e-48   
ref|XP_004163068.1|  PREDICTED: macrophage erythroblast attacher-...    174   3e-48   
ref|XP_002311128.1|  hypothetical protein POPTR_0008s04700g             183   3e-48   Populus trichocarpa [western balsam poplar]
emb|CAN63110.1|  hypothetical protein VITISV_043009                     175   4e-48   Vitis vinifera
ref|XP_009357623.1|  PREDICTED: macrophage erythroblast attacher ...    182   4e-48   
ref|XP_004307443.1|  PREDICTED: macrophage erythroblast attacher-...    182   6e-48   
ref|XP_008445812.1|  PREDICTED: macrophage erythroblast attacher        181   1e-47   
gb|KHF97436.1|  Macrophage erythroblast attacher                        181   2e-47   
ref|XP_010032253.1|  PREDICTED: macrophage erythroblast attacher        179   4e-47   
gb|AFK44090.1|  unknown                                                 172   6e-47   
gb|KHG13790.1|  Macrophage erythroblast attacher                        179   7e-47   
gb|KHN27082.1|  Macrophage erythroblast attacher                        177   8e-47   
ref|XP_002281688.1|  PREDICTED: macrophage erythroblast attacher        179   9e-47   Vitis vinifera
ref|XP_002525069.1|  erythroblast macrophage protein emp, putative      179   1e-46   Ricinus communis
gb|KEH44533.1|  macrophage erythroblast attacher-like protein           179   1e-46   
gb|KCW51662.1|  hypothetical protein EUGRSUZ_J01144                     180   1e-46   
ref|XP_007009626.1|  LisH/CRA/RING-U-box domains-containing prote...    178   2e-46   
gb|KHN37306.1|  Macrophage erythroblast attacher                        177   3e-46   
ref|XP_003536784.1|  PREDICTED: macrophage erythroblast attacher-...    177   3e-46   
ref|XP_007009624.1|  LisH/CRA/RING-U-box domains-containing prote...    177   3e-46   
ref|XP_004143593.1|  PREDICTED: macrophage erythroblast attacher-...    178   4e-46   
ref|XP_010931926.1|  PREDICTED: macrophage erythroblast attacher-...    177   4e-46   
ref|XP_003556550.2|  PREDICTED: uncharacterized protein LOC100805248    181   1e-45   
ref|XP_010534449.1|  PREDICTED: macrophage erythroblast attacher        176   1e-45   
ref|XP_004497384.1|  PREDICTED: uncharacterized protein LOC101492204    180   2e-45   
gb|EMS57201.1|  Macrophage erythroblast attacher                        172   2e-45   
ref|XP_008793648.1|  PREDICTED: macrophage erythroblast attacher        175   3e-45   
gb|KFK34753.1|  hypothetical protein AALP_AA5G188800                    174   4e-45   
dbj|BAD94564.1|  hypothetical protein                                   167   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003592786.1|  Macrophage erythroblast attacher                   179   4e-45   
ref|XP_009411983.1|  PREDICTED: macrophage erythroblast attacher-...    174   5e-45   
ref|XP_010921967.1|  PREDICTED: macrophage erythroblast attacher-...    174   5e-45   
ref|XP_007142677.1|  hypothetical protein PHAVU_007G007400g             174   6e-45   
ref|XP_006851961.1|  hypothetical protein AMTR_s00041p00191400          173   8e-45   
ref|XP_006291207.1|  hypothetical protein CARUB_v10017336mg             173   1e-44   
ref|XP_009393357.1|  PREDICTED: macrophage erythroblast attacher-...    172   3e-44   
ref|XP_009393358.1|  PREDICTED: macrophage erythroblast attacher-...    172   3e-44   
ref|XP_010516063.1|  PREDICTED: macrophage erythroblast attacher-...    171   4e-44   
ref|XP_010669743.1|  PREDICTED: macrophage erythroblast attacher        171   5e-44   
ref|XP_010427253.1|  PREDICTED: macrophage erythroblast attacher-...    171   7e-44   
dbj|BAK01850.1|  predicted protein                                      170   1e-43   
ref|NP_191067.1|  LisH/CRA/RING-U-box domain-containing protein         169   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876284.1|  hypothetical protein ARALYDRAFT_485927             169   2e-43   
emb|CDX73410.1|  BnaC08g25930D                                          168   7e-43   
emb|CDY40198.1|  BnaA09g34800D                                          167   1e-42   
emb|CDY02905.1|  BnaC04g25810D                                          167   1e-42   
ref|NP_001054719.1|  Os05g0160100                                       167   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139201.1|  PREDICTED: macrophage erythroblast attacher-...    167   1e-42   
ref|XP_008812008.1|  PREDICTED: macrophage erythroblast attacher-...    166   1e-42   
ref|XP_006403495.1|  hypothetical protein EUTSA_v10010415mg             167   2e-42   
ref|XP_003568863.1|  PREDICTED: macrophage erythroblast attacher        166   2e-42   
ref|XP_009116209.1|  PREDICTED: macrophage erythroblast attacher-...    165   8e-42   
ref|XP_009116208.1|  PREDICTED: macrophage erythroblast attacher-...    165   9e-42   
gb|EMT07376.1|  hypothetical protein F775_28620                         162   1e-41   
gb|EYU33168.1|  hypothetical protein MIMGU_mgv1a007495mg                163   3e-41   
ref|XP_006655016.1|  PREDICTED: macrophage erythroblast attacher-...    163   3e-41   
gb|ABR16457.1|  unknown                                                 162   1e-40   Picea sitchensis
ref|XP_004977102.1|  PREDICTED: macrophage erythroblast attacher-...    160   3e-40   
gb|EPS71206.1|  hypothetical protein M569_03553                         157   3e-39   
ref|XP_002439337.1|  hypothetical protein SORBIDRAFT_09g004620          156   1e-38   Sorghum bicolor [broomcorn]
ref|NP_001145704.1|  uncharacterized protein LOC100279208               148   3e-38   Zea mays [maize]
ref|XP_001768337.1|  predicted protein                                  153   2e-37   
ref|XP_008647704.1|  PREDICTED: uncharacterized protein LOC100279...    151   5e-37   
ref|XP_001780731.1|  predicted protein                                  146   2e-35   
ref|XP_002970402.1|  hypothetical protein SELMODRAFT_93124              144   2e-34   
ref|XP_002968172.1|  hypothetical protein SELMODRAFT_89330              144   2e-34   
ref|XP_006436158.1|  hypothetical protein CICLE_v10031660mg             128   2e-30   
ref|XP_006436160.1|  hypothetical protein CICLE_v10031660mg             128   1e-29   
ref|XP_002991550.1|  hypothetical protein SELMODRAFT_133748             128   3e-29   
ref|XP_002971744.1|  hypothetical protein SELMODRAFT_147945             128   4e-29   
ref|XP_005847260.1|  hypothetical protein CHLNCDRAFT_57944              117   1e-25   
ref|XP_005651863.1|  hypothetical protein COCSUDRAFT_34765              115   9e-25   
ref|XP_007384346.1|  hypothetical protein PUNSTDRAFT_52824              101   6e-20   
ref|XP_007009625.1|  LisH/CRA/RING-U-box domains-containing prote...    100   8e-20   
ref|XP_004362066.1|  lissencephaly type-1-like motif-containing p...  99.0    5e-19   
ref|XP_007869411.1|  hypothetical protein GLOTRDRAFT_112215           98.6    6e-19   
gb|KEH44532.1|  macrophage erythroblast attacher-like protein         97.4    7e-19   
ref|XP_009549968.1|  hypothetical protein HETIRDRAFT_157383           97.8    9e-19   
gb|KDQ58612.1|  hypothetical protein JAAARDRAFT_34441                 97.8    1e-18   
gb|KDO67856.1|  hypothetical protein CISIN_1g014891mg                 96.7    1e-18   
dbj|GAM20646.1|  hypothetical protein SAMD00019534_038210             96.3    4e-18   
emb|CCL99210.1|  predicted protein                                    95.5    6e-18   
ref|XP_007302044.1|  hypothetical protein STEHIDRAFT_119889           94.7    1e-17   
gb|KFM27605.1|  Macrophage erythroblast attacher                      92.4    5e-17   
ref|NP_001078291.1|  LisH/CRA/RING-U-box domain-containing protein    90.9    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDQ31896.1|  hypothetical protein PLEOSDRAFT_1091869               92.0    1e-16   
ref|XP_005090204.1|  PREDICTED: macrophage erythroblast attacher-...  91.3    2e-16   
ref|XP_007313967.1|  hypothetical protein SERLADRAFT_457895           90.9    2e-16   
gb|EXX64645.1|  glucose-induced degradation complex subunit FYV10     89.7    2e-16   
gb|EXX64646.1|  glucose-induced degradation complex subunit FYV10     89.7    2e-16   
gb|KDO67855.1|  hypothetical protein CISIN_1g014891mg                 89.7    2e-16   
ref|XP_007271545.1|  hypothetical protein FOMMEDRAFT_129613           90.5    3e-16   
gb|EXX64647.1|  glucose-induced degradation complex subunit FYV10     90.1    4e-16   
gb|ESA15728.1|  hypothetical protein GLOINDRAFT_162711                90.1    4e-16   
ref|XP_010504349.1|  PREDICTED: macrophage erythroblast attacher-...  89.0    4e-16   
ref|XP_010101504.1|  hypothetical protein L484_017254                 84.0    4e-16   
ref|XP_010779450.1|  PREDICTED: macrophage erythroblast attacher-...  84.7    5e-16   
ref|XP_001881100.1|  predicted protein                                89.7    6e-16   Laccaria bicolor S238N-H82
ref|XP_005829604.1|  hypothetical protein GUITHDRAFT_111306           89.0    8e-16   
ref|XP_007003204.1|  hypothetical protein TREMEDRAFT_28694            89.7    9e-16   
gb|KDR80093.1|  hypothetical protein GALMADRAFT_222986                89.0    1e-15   
ref|XP_002741395.1|  PREDICTED: macrophage erythroblast attacher-...  88.6    1e-15   Saccoglossus kowalevskii
ref|XP_006676318.1|  hypothetical protein BATDEDRAFT_84764            88.6    1e-15   
ref|XP_006463289.1|  hypothetical protein AGABI2DRAFT_207985          89.0    1e-15   
gb|KGB74540.1|  hypothetical protein CNBG_0378                        89.4    1e-15   
ref|XP_007332583.1|  hypothetical protein AGABI1DRAFT_62820           89.0    2e-15   
gb|EFA81832.1|  lissencephaly type-1-like motif-containing protein    87.8    2e-15   Heterostelium album PN500
ref|XP_566532.1|  negative regulator of gluconeogenesis               89.0    2e-15   Cryptococcus neoformans var. neoformans JEC21
gb|AFR92317.2|  macrophage erythroblast attacher isoform 1            88.6    3e-15   
ref|XP_002469118.1|  predicted protein                                86.3    3e-15   Postia placenta Mad-698-R
ref|XP_003192082.1|  negative regulation of gluconeogenesis-relat...  87.8    4e-15   
ref|XP_007847846.1|  Macrophage erythroblast attacher                 87.0    5e-15   
ref|XP_002470255.1|  predicted protein                                86.7    6e-15   Postia placenta Mad-698-R
ref|XP_008303525.1|  PREDICTED: macrophage erythroblast attacher-...  82.4    7e-15   
ref|XP_010897019.1|  PREDICTED: macrophage erythroblast attacher ...  85.9    8e-15   
emb|CDS03970.1|  hypothetical protein LRAMOSA06925                    85.9    1e-14   
emb|CDH49414.1|  protein                                              85.5    1e-14   
ref|XP_007392873.1|  hypothetical protein PHACADRAFT_251198           84.7    2e-14   
gb|EPZ35350.1|  CTLH/CRAto LisH motif domain-containing protein       84.3    3e-14   
gb|KDN47068.1|  hypothetical protein RSAG8_03845                      80.5    3e-14   
ref|XP_005994962.1|  PREDICTED: macrophage erythroblast attacher      82.8    5e-14   
ref|XP_005919513.1|  PREDICTED: macrophage erythroblast attacher-...  82.8    6e-14   
ref|XP_002910556.1|  macrophage erythroblast attacher isoform 1       83.6    6e-14   
ref|XP_005726520.1|  PREDICTED: macrophage erythroblast attacher-...  83.2    6e-14   
emb|CEI98702.1|  Putative Macrophage erythroblast attacher isoform 1  81.3    6e-14   
ref|XP_003970622.1|  PREDICTED: macrophage erythroblast attacher-...  83.2    6e-14   
ref|XP_009863794.1|  PREDICTED: macrophage erythroblast attacher      79.3    6e-14   
ref|XP_007896147.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    6e-14   
ref|XP_008324781.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    7e-14   
emb|CAF96979.1|  unnamed protein product                              83.2    7e-14   Tetraodon nigroviridis
emb|CCO30427.1|  Macrophage erythroblast attacher                     83.2    8e-14   
ref|XP_007896146.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    8e-14   
ref|XP_008290979.1|  PREDICTED: macrophage erythroblast attacher      83.2    8e-14   
ref|XP_007233092.1|  PREDICTED: macrophage erythroblast attacher-...  83.2    9e-14   
ref|XP_003443485.1|  PREDICTED: macrophage erythroblast attacher-...  83.2    9e-14   
ref|XP_008324780.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    9e-14   
ref|XP_003970621.1|  PREDICTED: macrophage erythroblast attacher-...  83.2    9e-14   
ref|XP_010897011.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    1e-13   
ref|XP_007896145.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    1e-13   
sp|Q7SXR3.2|MAEA_DANRE  RecName: Full=Macrophage erythroblast att...  82.8    1e-13   Danio rerio [leopard danio]
ref|NP_955843.1|  macrophage erythroblast attacher                    82.8    1e-13   Danio rerio [leopard danio]
ref|XP_008324779.1|  PREDICTED: macrophage erythroblast attacher ...  82.8    1e-13   
ref|XP_007771440.1|  hypothetical protein CONPUDRAFT_108277           82.8    1e-13   
ref|XP_003287656.1|  hypothetical protein DICPUDRAFT_151775           82.8    1e-13   
ref|XP_009488266.1|  PREDICTED: macrophage erythroblast attacher      79.3    1e-13   
ref|XP_003383314.1|  PREDICTED: macrophage erythroblast attacher-...  82.4    1e-13   
ref|XP_007439291.1|  PREDICTED: macrophage erythroblast attacher      81.6    1e-13   
ref|XP_004073063.1|  PREDICTED: macrophage erythroblast attacher-...  82.0    1e-13   
ref|XP_009502805.1|  PREDICTED: macrophage erythroblast attacher      79.3    1e-13   
emb|CEJ05334.1|  hypothetical protein RMCBS344292_19277               81.6    2e-13   
ref|NP_001007963.1|  macrophage erythroblast attacher                 81.6    2e-13   Xenopus tropicalis [western clawed frog]
ref|XP_004073062.1|  PREDICTED: macrophage erythroblast attacher-...  82.0    2e-13   
emb|CDQ74752.1|  unnamed protein product                              81.6    2e-13   
ref|XP_638565.2|  hypothetical protein DDB_G0284463                   82.0    2e-13   Dictyostelium discoideum AX4
ref|XP_008938588.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    2e-13   
gb|EJT45337.1|  negative regulator of gluconeogenesis                 82.4    2e-13   
gb|EMC83044.1|  Macrophage erythroblast attacher                      79.7    2e-13   
ref|XP_010147680.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    3e-13   
ref|NP_001085357.2|  macrophage erythroblast attacher                 81.6    3e-13   Xenopus laevis [clawed frog]
gb|AAH71124.1|  MGC81431 protein                                      81.3    3e-13   Xenopus laevis [clawed frog]
ref|XP_008938587.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    3e-13   
ref|XP_008919197.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    3e-13   
gb|KFZ61624.1|  Macrophage erythroblast attacher                      79.7    3e-13   
ref|XP_002676279.1|  predicted protein                                81.6    3e-13   Naegleria gruberi strain NEG-M
gb|EUC59117.1|  macrophage erythroblast attacher                      81.6    3e-13   
ref|XP_010165175.1|  PREDICTED: macrophage erythroblast attacher      79.7    3e-13   
gb|KFZ50296.1|  Macrophage erythroblast attacher                      79.7    3e-13   
ref|XP_010147679.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    3e-13   
emb|CEG70497.1|  hypothetical protein RMATCC62417_06384               81.3    3e-13   
gb|EMD35442.1|  hypothetical protein CERSUDRAFT_116204                81.3    3e-13   
ref|XP_006629704.1|  PREDICTED: macrophage erythroblast attacher-...  80.9    3e-13   
ref|XP_008919195.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    4e-13   
ref|XP_006874175.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    4e-13   
ref|XP_002117764.1|  hypothetical protein TRIADDRAFT_32981            81.3    4e-13   Trichoplax adhaerens
ref|XP_005427936.1|  PREDICTED: macrophage erythroblast attacher      80.1    4e-13   
gb|KDR16975.1|  Macrophage erythroblast attacher                      80.9    5e-13   
gb|KDQ20772.1|  hypothetical protein BOTBODRAFT_26790                 80.9    5e-13   
ref|XP_003773500.1|  PREDICTED: macrophage erythroblast attacher ...  80.5    5e-13   
ref|XP_008643326.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    5e-13   
ref|XP_009554301.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    5e-13   
ref|XP_008118396.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    5e-13   
emb|CDQ85287.1|  unnamed protein product                              80.9    5e-13   
ref|XP_006629703.1|  PREDICTED: macrophage erythroblast attacher-...  80.9    5e-13   
gb|KFP59366.1|  Macrophage erythroblast attacher                      80.1    5e-13   
ref|XP_010147678.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    5e-13   
ref|XP_005016192.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    5e-13   
ref|XP_009201271.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    5e-13   
ref|XP_008643325.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    6e-13   
ref|XP_010373641.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    6e-13   
ref|NP_001284360.1|  macrophage erythroblast attacher isoform 4       79.7    6e-13   
gb|EKD00291.1|  negative regulator of gluconeogenesis                 81.6    6e-13   
ref|XP_005490889.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    6e-13   
dbj|BAB14072.1|  unnamed protein product                              79.7    6e-13   Homo sapiens [man]
ref|XP_006122969.1|  PREDICTED: macrophage erythroblast attacher ...  80.5    6e-13   
ref|XP_005045610.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    6e-13   
ref|XP_005517965.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    6e-13   
ref|XP_005016191.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    7e-13   
ref|XP_001365484.1|  PREDICTED: macrophage erythroblast attacher      80.1    7e-13   Monodelphis domestica
gb|EOB03758.1|  Macrophage erythroblast attacher                      80.1    7e-13   
gb|KFU91590.1|  Macrophage erythroblast attacher                      80.5    7e-13   
ref|XP_005292466.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    7e-13   
ref|XP_010708924.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
ref|XP_003227109.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
ref|XP_008991974.1|  PREDICTED: macrophage erythroblast attacher-...  77.8    8e-13   
ref|XP_010221934.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
ref|XP_006038728.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
ref|XP_009283698.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
gb|EAW82590.1|  macrophage erythroblast attacher, isoform CRA_d       79.0    8e-13   Homo sapiens [man]
gb|ELU43420.1|  macrophage erythroblast attacher isoform 1            81.3    8e-13   
ref|XP_005517964.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    8e-13   
ref|XP_008149139.1|  PREDICTED: macrophage erythroblast attacher ...  79.3    8e-13   
ref|NP_001012622.1|  macrophage erythroblast attacher                 80.1    8e-13   Gallus gallus [bantam]
ref|XP_008643323.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    9e-13   
ref|XP_005490888.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    9e-13   
ref|XP_006122967.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    9e-13   
ref|XP_010017714.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    9e-13   
gb|KFW07742.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFO13991.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFV86996.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFO88535.1|  Macrophage erythroblast attacher                      80.1    9e-13   
ref|XP_006122968.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    9e-13   
ref|XP_005816591.1|  PREDICTED: macrophage erythroblast attacher-...  79.7    9e-13   
gb|KFQ54041.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KGL83442.1|  Macrophage erythroblast attacher                      80.1    9e-13   
ref|XP_009283695.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    9e-13   
gb|KFR10848.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFP69191.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFP11159.1|  Macrophage erythroblast attacher                      80.1    9e-13   
gb|KFW03170.1|  Macrophage erythroblast attacher                      80.1    1e-12   
gb|KFV40778.1|  Macrophage erythroblast attacher                      80.1    1e-12   
gb|KFR04543.1|  Macrophage erythroblast attacher                      80.1    1e-12   
gb|KFP07059.1|  Macrophage erythroblast attacher                      80.1    1e-12   
gb|KFP38266.1|  Macrophage erythroblast attacher                      80.1    1e-12   
gb|KFO55279.1|  Macrophage erythroblast attacher                      80.1    1e-12   
ref|XP_009283694.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    1e-12   
ref|XP_005016190.1|  PREDICTED: macrophage erythroblast attacher ...  79.7    1e-12   
ref|XP_004579301.1|  PREDICTED: macrophage erythroblast attacher ...  79.0    1e-12   
ref|XP_006122964.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    1e-12   
gb|ELU07028.1|  hypothetical protein CAPTEDRAFT_123183                79.7    1e-12   
gb|KFV06494.1|  Macrophage erythroblast attacher                      80.1    1e-12   
ref|XP_005088192.1|  PREDICTED: macrophage erythroblast attacher-...  77.0    1e-12   
ref|XP_006276443.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    1e-12   
dbj|BAG54590.1|  unnamed protein product                              76.6    1e-12   Homo sapiens [man]
ref|XP_007577944.1|  PREDICTED: macrophage erythroblast attacher      79.7    1e-12   
ref|XP_005292464.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    1e-12   
gb|KFO72543.1|  Macrophage erythroblast attacher                      79.7    1e-12   
ref|XP_009445476.1|  PREDICTED: macrophage erythroblast attacher ...  79.3    1e-12   
ref|XP_006122966.1|  PREDICTED: macrophage erythroblast attacher ...  80.1    1e-12   
ref|XP_007670109.1|  PREDICTED: macrophage erythroblast attacher      80.1    1e-12   
dbj|BAB12151.1|  hypothetical protein                                 76.6    1e-12   Macaca fascicularis [crab eating macaque]
emb|CDY07502.1|  BnaC06g15620D                                        73.6    1e-12   
ref|XP_008206909.1|  PREDICTED: macrophage erythroblast attacher ...  79.0    1e-12   
ref|XP_001604075.1|  PREDICTED: macrophage erythroblast attacher ...  79.3    2e-12   Nasonia vitripennis
ref|XP_006745988.1|  PREDICTED: macrophage erythroblast attacher-...  76.6    2e-12   
gb|KFM83088.1|  Macrophage erythroblast attacher                      78.6    2e-12   
ref|XP_009009681.1|  hypothetical protein HELRODRAFT_62544            79.0    2e-12   
gb|KFH65513.1|  hypothetical protein MVEG_08990                       78.6    2e-12   
dbj|BAC35873.1|  unnamed protein product                              77.0    2e-12   Mus musculus [mouse]
gb|AEQ34986.1|  erythroblast macrophage protein emp                   76.6    3e-12   
ref|XP_008703870.1|  PREDICTED: macrophage erythroblast attacher      77.4    3e-12   
gb|EMP32174.1|  hypothetical protein UY3_10663                        79.7    3e-12   
ref|XP_008545827.1|  PREDICTED: macrophage erythroblast attacher      78.2    3e-12   
dbj|BAE00422.1|  unnamed protein product                              77.0    3e-12   
emb|CCA75428.1|  related to macrophage erythroblast attacher          78.2    3e-12   
dbj|BAG58910.1|  unnamed protein product                              77.0    4e-12   
ref|XP_004656101.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|NP_001284359.1|  macrophage erythroblast attacher isoform 3       77.4    4e-12   
ref|XP_003811337.1|  PREDICTED: macrophage erythroblast attacher      77.0    4e-12   
gb|EPB91212.1|  hypothetical protein HMPREF1544_01917                 78.2    4e-12   
ref|XP_004579302.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    4e-12   
ref|XP_004432268.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    4e-12   
ref|XP_004383586.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    4e-12   
ref|XP_002603719.1|  hypothetical protein BRAFLDRAFT_126879           76.6    4e-12   
ref|NP_001284362.1|  macrophage erythroblast attacher isoform 6       77.4    4e-12   
gb|ERL90184.1|  hypothetical protein D910_07538                       77.8    4e-12   
gb|ENN81629.1|  hypothetical protein YQE_01992                        77.8    4e-12   
ref|XP_007537789.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    4e-12   
ref|XP_004847496.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_003465093.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_003364796.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_005366136.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_009445474.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
gb|EPQ20447.1|  Macrophage erythroblast attacher                      77.0    4e-12   
ref|XP_004579300.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_005319101.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_005366135.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    4e-12   
ref|XP_008567446.1|  PREDICTED: macrophage erythroblast attacher      77.4    5e-12   
ref|XP_004715132.1|  PREDICTED: macrophage erythroblast attacher      77.4    5e-12   
ref|XP_006177875.1|  PREDICTED: macrophage erythroblast attacher      77.4    5e-12   
ref|XP_004317905.1|  PREDICTED: macrophage erythroblast attacher      77.4    5e-12   
gb|AEE62244.1|  unknown                                               77.8    5e-12   
gb|EAW82586.1|  macrophage erythroblast attacher, isoform CRA_a       77.0    5e-12   
ref|XP_004396284.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_004383585.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_004265239.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_004656100.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_006874174.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_006893656.1|  PREDICTED: macrophage erythroblast attacher      77.4    5e-12   
ref|XP_007181543.1|  PREDICTED: macrophage erythroblast attacher      77.0    5e-12   
ref|XP_007114205.1|  PREDICTED: macrophage erythroblast attacher      77.0    5e-12   
ref|XP_006213112.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    5e-12   
ref|XP_004432267.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|NP_005873.2|  macrophage erythroblast attacher isoform 2          77.4    5e-12   
ref|XP_006771499.1|  PREDICTED: macrophage erythroblast attacher      77.0    5e-12   
ref|XP_007467946.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    5e-12   
ref|XP_008149138.1|  PREDICTED: macrophage erythroblast attacher ...  76.6    5e-12   
ref|XP_007537787.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    5e-12   
ref|XP_004891018.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    5e-12   
ref|XP_006045026.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    5e-12   
ref|XP_004480460.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    5e-12   
ref|XP_009054359.1|  hypothetical protein LOTGIDRAFT_117625           77.4    5e-12   
gb|EFB18684.1|  hypothetical protein PANDA_013808                     77.4    6e-12   
ref|XP_004847495.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|XP_005554324.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|XP_009201195.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    6e-12   
ref|XP_005963606.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  77.4    6e-12   
ref|XP_004038371.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|NP_001284361.1|  macrophage erythroblast attacher isoform 5       77.4    6e-12   
ref|XP_006045025.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|XP_005618597.1|  PREDICTED: macrophage erythroblast attacher      77.4    6e-12   
gb|AAP35603.1|  macrophage erythroblast attacher                      77.4    6e-12   
ref|XP_003706571.1|  PREDICTED: macrophage erythroblast attacher-...  77.0    6e-12   
ref|XP_008016355.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|XP_004847494.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    6e-12   
ref|XP_008149137.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    6e-12   
sp|Q4R9A8.1|MAEA_MACFA  RecName: Full=Macrophage erythroblast att...  77.4    6e-12   
ref|XP_010847329.1|  PREDICTED: macrophage erythroblast attacher      77.0    6e-12   
dbj|BAA91499.1|  unnamed protein product                              77.4    7e-12   
ref|NP_001017405.1|  macrophage erythroblast attacher isoform 1       77.4    7e-12   
ref|XP_006213111.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
gb|ELK24409.1|  Macrophage erythroblast attacher                      77.4    7e-12   
ref|XP_010957227.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_004579299.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
dbj|BAE40928.1|  unnamed protein product                              77.4    7e-12   
ref|XP_517061.2|  PREDICTED: macrophage erythroblast attacher iso...  77.4    7e-12   
ref|XP_001143290.2|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
gb|AAH06470.2|  MAEA protein                                          77.4    7e-12   
gb|AAP36347.1|  Homo sapiens macrophage erythroblast attacher         77.0    7e-12   
ref|XP_004383584.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
gb|EFN63282.1|  Macrophage erythroblast attacher                      77.0    7e-12   
ref|XP_006931333.1|  PREDICTED: macrophage erythroblast attacher      77.4    7e-12   
ref|XP_005319100.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
ref|XP_004847493.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
ref|NP_067475.2|  macrophage erythroblast attacher                    77.4    7e-12   
ref|XP_006874173.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
gb|AAH39054.1|  Maea protein                                          77.0    7e-12   
ref|XP_006152943.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_004480459.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_003801164.1|  PREDICTED: macrophage erythroblast attacher      77.0    7e-12   
dbj|BAC28857.1|  unnamed protein product                              77.0    7e-12   
ref|XP_004432266.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_004396283.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_006152942.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
ref|XP_006045024.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_004656099.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
gb|EFN80439.1|  Macrophage erythroblast attacher                      77.0    7e-12   
ref|XP_003465092.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
gb|ERE87889.1|  macrophage erythroblast attacher-like protein         77.0    7e-12   
ref|XP_004891017.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_002924461.1|  PREDICTED: macrophage erythroblast attacher-...  77.4    7e-12   
ref|XP_004265238.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_007537786.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    7e-12   
ref|XP_004772374.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    7e-12   
ref|XP_010589656.1|  PREDICTED: macrophage erythroblast attacher      77.4    8e-12   
ref|XP_004432265.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
ref|XP_008840037.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
ref|XP_004396282.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
ref|XP_004265237.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
ref|XP_010639980.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
gb|ELR55988.1|  Macrophage erythroblast attacher                      77.0    8e-12   
ref|XP_007467945.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    8e-12   
gb|EFZ12028.1|  hypothetical protein SINV_11420                       77.0    8e-12   
gb|EKC39324.1|  Macrophage erythroblast attacher                      77.0    8e-12   
gb|EZA61257.1|  Macrophage erythroblast attacher                      77.0    8e-12   
ref|XP_006045022.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    8e-12   
ref|XP_011053492.1|  PREDICTED: macrophage erythroblast attacher      77.0    8e-12   
ref|XP_007642824.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  77.4    8e-12   
ref|NP_001029587.1|  macrophage erythroblast attacher                 77.0    8e-12   
ref|XP_003489992.1|  PREDICTED: macrophage erythroblast attacher-...  76.6    9e-12   
ref|XP_007467944.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    9e-12   
ref|XP_006108272.1|  PREDICTED: macrophage erythroblast attacher      77.0    9e-12   
ref|XP_005896372.1|  PREDICTED: macrophage erythroblast attacher      77.4    9e-12   
ref|XP_008149136.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    9e-12   
dbj|BAG62274.1|  unnamed protein product                              76.6    9e-12   
ref|XP_003706570.1|  PREDICTED: macrophage erythroblast attacher-...  76.6    1e-11   
gb|AAF72195.1|AF263247_1  erythroblast macrophage protein EMP         77.0    1e-11   
ref|XP_005886542.1|  PREDICTED: macrophage erythroblast attacher      77.0    1e-11   
ref|XP_004847490.1|  PREDICTED: macrophage erythroblast attacher ...  77.4    1e-11   
ref|XP_395151.3|  PREDICTED: macrophage erythroblast attacher-lik...  76.6    1e-11   
ref|XP_003690180.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  76.6    1e-11   
emb|CDX73411.1|  BnaC08g25920D                                        70.9    1e-11   
ref|XP_004847491.1|  PREDICTED: macrophage erythroblast attacher ...  77.0    1e-11   
ref|XP_003397163.1|  PREDICTED: macrophage erythroblast attacher-...  76.6    1e-11   
emb|CDX73412.1|  BnaC08g25910D                                        71.6    1e-11   
ref|XP_002950122.1|  hypothetical protein VOLCADRAFT_90636            76.3    1e-11   
ref|XP_004010214.1|  PREDICTED: uncharacterized protein LOC101107446  77.4    1e-11   
ref|XP_788550.3|  PREDICTED: macrophage erythroblast attacher-like    76.3    1e-11   
ref|XP_004622822.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  75.9    1e-11   
emb|CDW52414.1|  macrophage erythroblast attacher                     75.9    2e-11   
gb|KFD53952.1|  hypothetical protein M513_05219                       75.9    2e-11   
ref|XP_006919107.1|  PREDICTED: macrophage erythroblast attacher ...  75.9    2e-11   
ref|XP_002160860.1|  PREDICTED: macrophage erythroblast attacher-...  75.9    2e-11   
ref|XP_005716339.1|  unnamed protein product                          76.6    2e-11   
dbj|BAN20947.1|  erythroblast macrophage protein emp                  75.5    2e-11   
gb|ABK91831.1|  macrophage erythroblast attacher isoform 2-like p...  71.2    2e-11   
ref|XP_006919106.1|  PREDICTED: macrophage erythroblast attacher ...  75.9    2e-11   
dbj|BAE31283.1|  unnamed protein product                              75.5    2e-11   
gb|ELK06595.1|  Macrophage erythroblast attacher                      75.9    3e-11   
ref|XP_966605.1|  PREDICTED: macrophage erythroblast attacher         75.1    4e-11   
ref|XP_004346694.1|  macrophage erythroblast attacher protein         75.1    4e-11   
gb|EPT02200.1|  hypothetical protein FOMPIDRAFT_1022992               75.1    4e-11   
ref|XP_002429461.1|  erythroblast macrophage protein emp, putative    74.7    5e-11   
dbj|GAK68238.1|  macrophage erythroblast attacher                     74.7    5e-11   
ref|XP_003743565.1|  PREDICTED: macrophage erythroblast attacher-...  74.3    5e-11   
ref|XP_007340536.1|  hypothetical protein AURDEDRAFT_111798           74.3    6e-11   
dbj|GAC71422.1|  uncharacterized conserved protein                    74.3    7e-11   
ref|XP_009859268.1|  PREDICTED: macrophage erythroblast attacher      73.9    7e-11   
ref|XP_001948876.1|  PREDICTED: macrophage erythroblast attacher      73.9    8e-11   
ref|XP_003328144.2|  hypothetical protein PGTG_09438                  74.3    8e-11   
gb|ETS65321.1|  hypothetical protein PaG_00049                        73.9    9e-11   
ref|XP_007878434.1|  hypothetical protein PFL1_02727                  74.7    9e-11   
ref|XP_003027812.1|  hypothetical protein SCHCODRAFT_70617            73.6    1e-10   
gb|EFA09808.1|  hypothetical protein TcasGA2_TC011953                 73.2    1e-10   
ref|XP_008527533.1|  PREDICTED: macrophage erythroblast attacher ...  72.8    1e-10   
ref|XP_005536850.1|  hypothetical protein, conserved                  73.6    1e-10   
gb|KGB40518.1|  Macrophage erythroblast attacher                      72.4    2e-10   
gb|KFD67336.1|  hypothetical protein M514_20372                       74.3    2e-10   
ref|XP_005702539.1|  hypothetical protein isoform 1                   70.9    2e-10   
emb|CDI97052.1|  erythroblast macrophage protein EMP                  72.8    2e-10   
gb|EFX88674.1|  hypothetical protein DAPPUDRAFT_191245                72.4    2e-10   
gb|EUB64150.1|  Macrophage erythroblast attacher                      72.8    2e-10   
gb|EPY86088.1|  macrophage erythroblast attacher isoform 2            72.8    3e-10   
ref|XP_001695737.1|  hypothetical protein CHLREDRAFT_119201           72.0    3e-10   
emb|CCD75613.1|  putative erythroblast macrophage protein emp         72.0    3e-10   
gb|ABV60404.1|  macrophage erythroblast attacher protein              70.5    6e-10   
ref|XP_010992225.1|  PREDICTED: macrophage erythroblast attacher      71.2    6e-10   
ref|XP_003743566.1|  PREDICTED: macrophage erythroblast attacher-...  71.2    6e-10   
ref|XP_002401000.1|  E3 ubiquitin ligase, putative                    70.9    7e-10   
ref|XP_001623813.1|  predicted protein                                70.9    8e-10   
ref|XP_007369879.1|  hypothetical protein DICSQDRAFT_140404           70.9    8e-10   
ref|XP_002901891.1|  conserved hypothetical protein                   70.5    1e-09   
emb|CDY07503.1|  BnaC06g15610D                                        66.2    2e-09   
emb|CDO77084.1|  hypothetical protein BN946_scf184473.g28             70.1    2e-09   
ref|XP_004996971.1|  hypothetical protein PTSG_02480                  69.3    2e-09   
gb|EJU03737.1|  macrophage erythroblast attacher isoform 1            69.3    3e-09   
gb|KDN49232.1|  hypothetical protein K437DRAFT_267483                 70.1    3e-09   
ref|XP_008891539.1|  hypothetical protein, variant 3                  68.6    3e-09   
gb|ETO79023.1|  hypothetical protein, variant 3                       68.6    3e-09   
gb|ETO79020.1|  hypothetical protein F444_06173                       68.6    6e-09   
ref|XP_008891538.1|  hypothetical protein PPTG_02249                  68.6    6e-09   
ref|XP_009519539.1|  hypothetical protein PHYSODRAFT_353936           67.4    9e-09   
gb|EWM29139.1|  macrophage erythroblast attacher                      66.6    9e-09   
ref|XP_005702538.1|  hypothetical protein isoform 2                   65.5    1e-08   
dbj|GAA55722.1|  macrophage erythroblast attacher                     65.9    2e-08   
ref|XP_004922110.1|  PREDICTED: macrophage erythroblast attacher-...  66.2    3e-08   
ref|XP_004339250.1|  hypothetical protein ACA1_059440                 65.9    4e-08   
gb|KFB52654.1|  AGAP004332-PA-like protein                            65.5    4e-08   
ref|XP_009162889.1|  hypothetical protein T265_12616                  65.9    4e-08   
dbj|BAD92144.1|  Hypothetical protein FLJ43512 variant                63.5    5e-08   
ref|XP_001993644.1|  GH20844                                          65.1    6e-08   
gb|ETE63135.1|  Macrophage erythroblast attacher                      64.7    7e-08   
ref|XP_003376666.1|  macrophage erythroblast attacher                 64.7    9e-08   
gb|KFQ11567.1|  Macrophage erythroblast attacher                      63.2    9e-08   
ref|XP_004772373.1|  PREDICTED: macrophage erythroblast attacher ...  64.7    1e-07   
ref|XP_009949690.1|  PREDICTED: macrophage erythroblast attacher-...  63.5    1e-07   
ref|XP_313610.2|  AGAP004332-PA                                       63.9    1e-07   
gb|EJW74342.1|  hypothetical protein WUBG_14749                       60.5    1e-07   
gb|ETN63502.1|  erythroblast macrophage protein emp                   63.5    2e-07   
ref|XP_006713914.1|  PREDICTED: macrophage erythroblast attacher ...  63.5    2e-07   
ref|XP_006122965.1|  PREDICTED: macrophage erythroblast attacher ...  63.5    2e-07   
ref|XP_008992351.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  63.5    2e-07   
ref|XP_006713913.1|  PREDICTED: macrophage erythroblast attacher ...  63.5    2e-07   
tpg|DAA28405.1|  TPA: macrophage erythroblast attacher                63.2    2e-07   
ref|XP_007953960.1|  PREDICTED: LOW QUALITY PROTEIN: macrophage e...  63.2    2e-07   
ref|XP_006713912.1|  PREDICTED: macrophage erythroblast attacher ...  63.2    2e-07   
gb|KHN75094.1|  Macrophage erythroblast attacher                      63.2    2e-07   
ref|XP_002073413.1|  GK13163                                          62.8    3e-07   
ref|XP_001955445.1|  GF18769                                          62.8    3e-07   
gb|EHJ67005.1|  hypothetical protein KGM_11833                        62.8    4e-07   
emb|CBQ69352.1|  conserved hypothetical protein                       62.8    4e-07   
ref|NP_733044.1|  CG31357                                             62.0    5e-07   



>ref|XP_006361400.1| PREDICTED: macrophage erythroblast attacher-like [Solanum tuberosum]
Length=413

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  319  FCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  378

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAKKNDGRITCPRT  TCNYT+LVKAYIS
Sbjct  379  TKALEEMAKKNDGRITCPRTGLTCNYTELVKAYIS  413


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF++KQWDYL+DQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  270  TTYKVLFESKQWDYLIDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  322



>ref|XP_009767482.1| PREDICTED: macrophage erythroblast attacher [Nicotiana sylvestris]
Length=425

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  331  FCYEDDCTKEDPLSQESFRKLATPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  390

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAK+NDGRITCPRT FTCNYT LVKAYIS
Sbjct  391  TKALEEMAKRNDGRITCPRTGFTCNYTQLVKAYIS  425


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            + LF+ KQWDYL+DQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  285  KALFEPKQWDYLIDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  334



>ref|XP_009601755.1| PREDICTED: macrophage erythroblast attacher [Nicotiana tomentosiformis]
Length=425

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  331  FCYEDDCTKEDPLSQESFRKLATPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  390

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAK+NDGRITCPRT FTCNYT L+KAYIS
Sbjct  391  TKALEEMAKRNDGRITCPRTGFTCNYTQLIKAYIS  425


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            + LF+ KQWDYL+DQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  285  KALFEPKQWDYLIDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  334



>ref|XP_010534666.1| PREDICTED: macrophage erythroblast attacher-like [Tarenaya hassleriana]
Length=145

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  661  IIYMFVLTKYRLCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENP  840
            I   F LT +R CYE+DCTKEDPLSQESFR LA PLPYSKQHHSKLVCYI++ELMDTENP
Sbjct  40   IGLRFTLTWFRFCYEEDCTKEDPLSQESFRNLALPLPYSKQHHSKLVCYISRELMDTENP  99

Query  841  PLVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            P VLPNGYVYSTKAL++MA+KN G+ITCPRT + CNY+DLVKA+IS
Sbjct  100  PQVLPNGYVYSTKALKEMAEKNGGKITCPRTGYVCNYSDLVKAFIS  145



>emb|CDP00007.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  333  FCYEDDCTKEDPLSQESFRKLALPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  392

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAKKNDGRITCPRT   CNYT+++KAYIS
Sbjct  393  TKALEEMAKKNDGRITCPRTGLVCNYTEVIKAYIS  427


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  287  KVLFEAKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPFCYE  336



>ref|XP_004236773.1| PREDICTED: macrophage erythroblast attacher [Solanum lycopersicum]
Length=427

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLS ESFRKLA PLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  333  FCYEDDCTKEDPLSHESFRKLATPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  392

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+M+KKNDGRITCPRT  TCNYT+LVKAYIS
Sbjct  393  TKALEEMSKKNDGRITCPRTGLTCNYTELVKAYIS  427


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLFD+KQWDYL+DQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  284  TTYKVLFDSKQWDYLIDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  336



>ref|XP_006436159.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 gb|ESR49399.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 gb|KDO67854.1| hypothetical protein CISIN_1g014891mg [Citrus sinensis]
Length=263

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  170  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  229

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  230  KALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS  263


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  120  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  172



>gb|KDO67852.1| hypothetical protein CISIN_1g014891mg [Citrus sinensis]
Length=351

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  258  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  317

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  318  KALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS  351


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  208  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  260



>ref|XP_006436161.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 ref|XP_006485978.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Citrus 
sinensis]
 gb|ESR49401.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
Length=351

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  258  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  317

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  318  KALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS  351


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  208  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  260



>ref|XP_008233402.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Prunus 
mume]
 ref|XP_008233403.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Prunus 
mume]
Length=412

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLAQPLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS+
Sbjct  319  CYDDDCTKEDPLSQEGFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSS  378

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT   CNYTDLVKAYIS
Sbjct  379  KALEEMARKNDGKITCPRTGLVCNYTDLVKAYIS  412


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  272  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  321



>ref|XP_007218090.1| hypothetical protein PRUPE_ppa006477mg [Prunus persica]
 gb|EMJ19289.1| hypothetical protein PRUPE_ppa006477mg [Prunus persica]
Length=410

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLAQPLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS+
Sbjct  317  CYDDDCTKEDPLSQEGFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSS  376

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT   CNYTDLVKAYIS
Sbjct  377  KALEEMARKNDGKITCPRTGLVCNYTDLVKAYIS  410


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  270  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  319



>gb|KDO67853.1| hypothetical protein CISIN_1g014891mg [Citrus sinensis]
Length=416

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  323  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  382

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  383  KALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS  416


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  273  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  325



>ref|XP_006436162.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 ref|XP_006485977.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Citrus 
sinensis]
 gb|ESR49402.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
Length=416

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  323  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  382

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  383  KALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS  416


 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  273  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  325



>ref|XP_011076892.1| PREDICTED: macrophage erythroblast attacher [Sesamum indicum]
Length=409

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQE FRKLAQPLPYSKQHHSKLVCYI+KELMDTENPPLVLPNGYVYS
Sbjct  315  FCYEDDCTKEDPLSQEGFRKLAQPLPYSKQHHSKLVCYISKELMDTENPPLVLPNGYVYS  374

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALEDMAK+N G+ITCPRT   C+YTD+VKA+IS
Sbjct  375  TKALEDMAKQNHGKITCPRTGLVCDYTDVVKAFIS  409


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  269  KVLFEAKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPFCYE  318



>ref|XP_008369829.1| PREDICTED: macrophage erythroblast attacher-like, partial [Malus 
domestica]
Length=344

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  251  CYDDDCTKEDPLSQEGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  310

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT   CN+TDLVKAYIS
Sbjct  311  KALEEMARKNDGKITCPRTGLVCNFTDLVKAYIS  344


 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  204  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  253



>ref|XP_011018776.1| PREDICTED: macrophage erythroblast attacher [Populus euphratica]
Length=412

 Score =   184 bits (467),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  319  CYEDDCTKEDPLSQESFRKLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  378

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAK+NDG+ITCPRT   CNY+++VKAYIS
Sbjct  379  KALEEMAKRNDGKITCPRTGLVCNYSEVVKAYIS  412


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +V F+ KQWDYLV+QFKQEFC+LYGMTLEPLLNI+LQAGLSALKTPY Y+
Sbjct  272  KVFFEPKQWDYLVEQFKQEFCRLYGMTLEPLLNIFLQAGLSALKTPYCYE  321



>ref|XP_008384314.1| PREDICTED: macrophage erythroblast attacher [Malus domestica]
Length=415

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNG+VYS+
Sbjct  322  CYDDDCTKEDPLSQEGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGHVYSS  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT F CNYTDLVKAYIS
Sbjct  382  KALEEMARKNDGKITCPRTGFICNYTDLVKAYIS  415


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  275  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  324



>ref|XP_008354097.1| PREDICTED: macrophage erythroblast attacher-like [Malus domestica]
Length=415

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  322  CYDDDCTKEDPLSQEGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT   CN+TDLVKAYIS
Sbjct  382  KALEEMARKNDGKITCPRTGLVCNFTDLVKAYIS  415


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  275  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  324



>gb|KDP46128.1| hypothetical protein JCGZ_06639 [Jatropha curcas]
Length=412

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  319  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  378

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRTS  CNY+++VKAYIS
Sbjct  379  KALEEMAKKNNGKITCPRTSDVCNYSEVVKAYIS  412


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  272  KVLFEPKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCYE  321



>ref|XP_010259978.1| PREDICTED: macrophage erythroblast attacher [Nelumbo nucifera]
Length=407

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDCTKEDPLSQESFRKLA  LP+SKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  313  FCYEDDCTKEDPLSQESFRKLASSLPFSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  372

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAKKN+G++TCPRT   CNY++LVKA+IS
Sbjct  373  TKALEEMAKKNNGKVTCPRTGLVCNYSELVKAFIS  407


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QWDYLV+QFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  267  KVLFEPRQWDYLVEQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  316



>ref|XP_004163068.1| PREDICTED: macrophage erythroblast attacher-like [Cucumis sativus]
Length=116

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYE+DCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS 
Sbjct  23   CYENDCTKEDPLSQESFRKLADPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSA  82

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE MAK+N G+ITCPRT   CNY++LVKAYIS
Sbjct  83   KALERMAKENGGKITCPRTGLVCNYSELVKAYIS  116



>ref|XP_002311128.1| hypothetical protein POPTR_0008s04700g [Populus trichocarpa]
 gb|EEE88495.1| hypothetical protein POPTR_0008s04700g [Populus trichocarpa]
Length=412

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  319  CYEDDCTKEDPLSQESFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  378

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAK+NDG+ITCPRT   CNY+++VKA+IS
Sbjct  379  KALEEMAKRNDGKITCPRTGLVCNYSEVVKAFIS  412


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +V F+ KQWDYLV+QFKQEFC+LYGMTLEPLLNI+LQAGLSALKTPY Y+
Sbjct  272  KVFFEPKQWDYLVEQFKQEFCRLYGMTLEPLLNIFLQAGLSALKTPYCYE  321



>emb|CAN63110.1| hypothetical protein VITISV_043009 [Vitis vinifera]
Length=163

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQ+ FRKLA PLPYSKQHHSKLVCYITKELMDTENPP+VLPNGYVYST
Sbjct  70   CYQDDCTKEDPLSQDGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPMVLPNGYVYST  129

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN G+ITCPRT F CN + LVKAYIS
Sbjct  130  KALEEMAKKNGGQITCPRTGFICNSSALVKAYIS  163


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y 
Sbjct  23   KVLFEPKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCYQ  72



>ref|XP_009357623.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357624.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Pyrus 
x bretschneideri]
Length=415

 Score =   182 bits (463),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQE FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS+
Sbjct  322  CYDDDCTKEDPLSQEGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSS  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MA+KNDG+ITCPRT   CNYTDLVKAYIS
Sbjct  382  KALEEMARKNDGKITCPRTGLICNYTDLVKAYIS  415


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY YD
Sbjct  275  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYD  324



>ref|XP_004307443.1| PREDICTED: macrophage erythroblast attacher-like [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   182 bits (462),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  325  CYEDDCTKEDPLSQEGFRKLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  384

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKK +G+ITCPRT   CNYTDLVKAYIS
Sbjct  385  KALEEMAKKYNGKITCPRTGLVCNYTDLVKAYIS  418


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  278  KVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  327



>ref|XP_008445812.1| PREDICTED: macrophage erythroblast attacher [Cucumis melo]
Length=415

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS 
Sbjct  322  CYEDDCTKEDPLSQESFRKLADPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSA  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE MAK+N G+ITCPRT F CNY++L+KAYIS
Sbjct  382  KALERMAKENSGKITCPRTGFVCNYSELMKAYIS  415


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWD+LVD F+QEFCK+YGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  275  KVLFEPKQWDHLVDVFRQEFCKIYGMTLEPLLNIYLQAGLSALKTPYCYE  324



>gb|KHF97436.1| Macrophage erythroblast attacher [Gossypium arboreum]
Length=422

 Score =   181 bits (459),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            C+EDDCTKEDPLSQE+FRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  329  CFEDDCTKEDPLSQENFRKLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  388

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KAL++MA+KN+G+ITCPRT   CNY+DLVKAYIS
Sbjct  389  KALKEMAEKNNGKITCPRTGLVCNYSDLVKAYIS  422


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+ KQWD+LVDQFKQEF KL+GMTLEPLLNIYLQAGLSALKTPY ++
Sbjct  279  TKYKVLFEPKQWDFLVDQFKQEFYKLHGMTLEPLLNIYLQAGLSALKTPYCFE  331



>ref|XP_010032253.1| PREDICTED: macrophage erythroblast attacher [Eucalyptus grandis]
Length=413

 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C ED CTKEDPLSQESFRKLA PLP+SKQ HSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  319  FCNEDGCTKEDPLSQESFRKLAMPLPFSKQEHSKLVCYITKELMDTENPPLVLPNGYVYS  378

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAKKN+G+ITCPRT+F C+Y+DLVKAYIS
Sbjct  379  TKALEEMAKKNNGKITCPRTNFGCDYSDLVKAYIS  413


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            +VLF++KQWD+LVDQF+QEFC+LYGMT EPLL+IYLQAGLSALKTP+
Sbjct  273  KVLFESKQWDFLVDQFRQEFCRLYGMTFEPLLSIYLQAGLSALKTPF  319



>gb|AFK44090.1| unknown [Lotus japonicus]
Length=163

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VL NGYVYST
Sbjct  70   CYEDDCTKEDPLSQEAFRTLALPLPYSKQHHSKLVCYITKELMDTENPPQVLANGYVYST  129

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+GRI CPR+   CNY DL+KAYIS
Sbjct  130  KALEEMAKKNNGRIICPRSGVECNYGDLMKAYIS  163


 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  23   KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  72



>gb|KHG13790.1| Macrophage erythroblast attacher [Gossypium arboreum]
Length=421

 Score =   179 bits (454),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQ+SFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  328  CYEDDCTKEDPLSQDSFRKLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  387

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KAL++MA+KN+G+ITCPRT   C+Y+DLVKAYIS
Sbjct  388  KALKEMAEKNNGKITCPRTGLVCSYSDLVKAYIS  421


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            QVLF+ KQWD+LVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  281  QVLFEPKQWDFLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCYE  330



>gb|KHN27082.1| Macrophage erythroblast attacher [Glycine soja]
Length=346

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  253  CYEDDCTKEDPLSQEAFRTLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  312

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G I CPRT   C+YT+LVKAYIS
Sbjct  313  KALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS  346


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  206  KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  255



>ref|XP_002281688.1| PREDICTED: macrophage erythroblast attacher [Vitis vinifera]
 emb|CBI25320.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   179 bits (453),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY+DDCTKEDPLSQ+ FRKLA PLPYSKQHHSKLVCYITKELMDTENPP+VLPNGYVYST
Sbjct  319  CYQDDCTKEDPLSQDGFRKLALPLPYSKQHHSKLVCYITKELMDTENPPMVLPNGYVYST  378

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN G+ITCPRT F CN + LVKAYIS
Sbjct  379  KALEEMAKKNGGQITCPRTGFICNSSALVKAYIS  412


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPY  444
            +VLF+ KQWDYLVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y
Sbjct  272  KVLFEPKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCY  320



>ref|XP_002525069.1| erythroblast macrophage protein emp, putative [Ricinus communis]
 gb|EEF37316.1| erythroblast macrophage protein emp, putative [Ricinus communis]
Length=414

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS 
Sbjct  321  CYEDDCTKEDPLSQESFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSA  380

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G+ITCPRT F  NY+++VKA+IS
Sbjct  381  KALEEMAKKNNGKITCPRTGFVYNYSEVVKAFIS  414


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFC+LYGMTLEPLLNIYL AGLSALKTPY Y+
Sbjct  274  KVLFEAKQWDYLVDQFKQEFCRLYGMTLEPLLNIYLHAGLSALKTPYCYE  323



>gb|KEH44533.1| macrophage erythroblast attacher-like protein [Medicago truncatula]
Length=415

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  322  CYEDDCTKEDPLSQEAFRTLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+GRI CPRT   C+YT+LVKAYIS
Sbjct  382  KALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS  415


 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+ KQWDYLVD FKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  272  TKYKVLFEPKQWDYLVDHFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  324



>gb|KCW51662.1| hypothetical protein EUGRSUZ_J01144 [Eucalyptus grandis]
Length=480

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C ED CTKEDPLSQESFRKLA PLP+SKQ HSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  386  FCNEDGCTKEDPLSQESFRKLAMPLPFSKQEHSKLVCYITKELMDTENPPLVLPNGYVYS  445

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MAKKN+G+ITCPRT+F C+Y+DLVKAYIS
Sbjct  446  TKALEEMAKKNNGKITCPRTNFGCDYSDLVKAYIS  480


 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            +VLF++KQWD+LVDQF+QEFC+LYGMT EPLL+IYLQAGLSALKTP+
Sbjct  340  KVLFESKQWDFLVDQFRQEFCRLYGMTFEPLLSIYLQAGLSALKTPF  386



>ref|XP_007009626.1| LisH/CRA/RING-U-box domains-containing protein isoform 3 [Theobroma 
cacao]
 gb|EOY18436.1| LisH/CRA/RING-U-box domains-containing protein isoform 3 [Theobroma 
cacao]
Length=415

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQ+SFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  322  CYEDDCTKEDPLSQDSFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  381

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KAL++MA+KN+G ITCPRT   CNY++LVKAYIS
Sbjct  382  KALKEMAEKNNGTITCPRTGLVCNYSELVKAYIS  415


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWD+LVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  275  KVLFEPKQWDFLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCYE  324



>gb|KHN37306.1| Macrophage erythroblast attacher [Glycine soja]
Length=409

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  316  CYEDDCTKEDPLSQEAFRTLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  375

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G I CPRT   C+YT+LVKAYIS
Sbjct  376  KALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS  409


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  269  KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  318



>ref|XP_003536784.1| PREDICTED: macrophage erythroblast attacher-like [Glycine max]
Length=414

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  321  CYEDDCTKEDPLSQEAFRTLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  380

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+G I CPRT   C+YT+LVKAYIS
Sbjct  381  KALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS  414


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  274  KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  323



>ref|XP_007009624.1| LisH/CRA/RING-U-box domains-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY18434.1| LisH/CRA/RING-U-box domains-containing protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQ+SFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  328  CYEDDCTKEDPLSQDSFRKLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  387

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KAL++MA+KN+G ITCPRT   CNY++LVKAYIS
Sbjct  388  KALKEMAEKNNGTITCPRTGLVCNYSELVKAYIS  421


 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWD+LVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  281  KVLFEPKQWDFLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYCYE  330



>ref|XP_004143593.1| PREDICTED: macrophage erythroblast attacher-like [Cucumis sativus]
 gb|KGN50490.1| hypothetical protein Csa_5G177100 [Cucumis sativus]
Length=469

 Score =   178 bits (452),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYE+DCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYS 
Sbjct  376  CYENDCTKEDPLSQESFRKLADPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSA  435

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE MAK+N G+ITCPRT   CNY++LVKAYIS
Sbjct  436  KALERMAKENGGKITCPRTGLVCNYSELVKAYIS  469


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWD+LVD F+QEFCK+YGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  329  KVLFEPKQWDHLVDVFRQEFCKIYGMTLEPLLNIYLQAGLSALKTPYCYE  378



>ref|XP_010931926.1| PREDICTED: macrophage erythroblast attacher-like [Elaeis guineensis]
Length=422

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E+ CTKEDPLSQE FRKLA PLP+SKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  328  FCFEEGCTKEDPLSQEGFRKLAAPLPFSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  387

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KNDGR+TCPRT  T N+++LVKAYIS
Sbjct  388  TKALEEMASKNDGRVTCPRTGETFNFSELVKAYIS  422


 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWDYLV+QFKQEFC+L+GMTLEPLLNIYLQAGLSALKTP+ ++
Sbjct  282  KVLFEPMQWDYLVEQFKQEFCRLFGMTLEPLLNIYLQAGLSALKTPFCFE  331



>ref|XP_003556550.2| PREDICTED: uncharacterized protein LOC100805248 [Glycine max]
Length=871

 Score =   181 bits (459),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  778  CYEDDCTKEDPLSQEAFRTLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  837

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+GRI CPRT   C+YT+LVKAYIS
Sbjct  838  KALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS  871


 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  731  KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  780



>ref|XP_010534449.1| PREDICTED: macrophage erythroblast attacher [Tarenaya hassleriana]
Length=420

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYE+DCTKEDPLSQESFR LA PLPYSKQHHSKLVCYI++ELMDTENPP VLPNGYVYS
Sbjct  326  FCYEEDCTKEDPLSQESFRNLALPLPYSKQHHSKLVCYISRELMDTENPPQVLPNGYVYS  385

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL++MA+KN G+ITCPRT + CNY+DLVKA+IS
Sbjct  386  TKALKEMAEKNGGKITCPRTGYVCNYSDLVKAFIS  420


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            LF+ KQWD+LV QFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP+ Y+
Sbjct  282  LFEPKQWDFLVLQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPFCYE  329



>ref|XP_004497384.1| PREDICTED: uncharacterized protein LOC101492204 [Cicer arietinum]
Length=876

 Score =   180 bits (457),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYI+KELMDTENPP VLPNGYVYST
Sbjct  783  CYEDDCTKEDPLSQEAFRTLALPLPYSKQHHSKLVCYISKELMDTENPPQVLPNGYVYST  842

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKNDGRI CPRT   C+YT+LVKAYIS
Sbjct  843  KALEEMAKKNDGRIICPRTGLNCSYTELVKAYIS  876


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  736  KVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  785



>gb|EMS57201.1| Macrophage erythroblast attacher [Triticum urartu]
Length=312

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +1

Query  679  LTKYRLCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPN  858
            LT  R C+E +C KEDPLS + FRKLA+PLP+SKQHHSKLVC+ITKELMDTENPPLVLPN
Sbjct  213  LTLQRFCFEGNCPKEDPLSLDGFRKLAEPLPFSKQHHSKLVCHITKELMDTENPPLVLPN  272

Query  859  GYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            GYVYSTKAL++MAKKN G+I CPRT   CNYTDLVKAYIS
Sbjct  273  GYVYSTKALDEMAKKNGGKIICPRTGEECNYTDLVKAYIS  312



>ref|XP_008793648.1| PREDICTED: macrophage erythroblast attacher [Phoenix dactylifera]
Length=426

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E+ CTKEDPLSQE FRKLA PLP+SKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  332  FCFEEGCTKEDPLSQEGFRKLAAPLPFSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  391

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KNDGR+TCPRT  T N ++LVKAYIS
Sbjct  392  TKALEEMASKNDGRVTCPRTGETFNISELVKAYIS  426


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWDYLV+QFKQEFC+L+GMTLEPLLNIYLQAGLSALKTP+ ++
Sbjct  286  KVLFEPMQWDYLVEQFKQEFCRLFGMTLEPLLNIYLQAGLSALKTPFCFE  335



>gb|KFK34753.1| hypothetical protein AALP_AA5G188800 [Arabis alpina]
Length=419

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  327  FEEGCTKEDPLSQESFRKLALPLPYSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTK  386

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN+G++TCPRT   CNYTDLVKAYIS
Sbjct  387  ALKEMAEKNEGKVTCPRTGLVCNYTDLVKAYIS  419


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            LF+ +QWD LV QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  281  LFELRQWDVLVHQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  328



>dbj|BAD94564.1| hypothetical protein [Arabidopsis thaliana]
Length=163

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  703  EDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKA  882
            E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTKA
Sbjct  72   EEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTKA  131

Query  883  LEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            L++MA+KN G+ITCPRT   CNYT+LVKAYIS
Sbjct  132  LKEMAEKNGGKITCPRTGLVCNYTELVKAYIS  163


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            +VLF+ +QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY
Sbjct  23   KVLFELRQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPY  69



>ref|XP_003592786.1| Macrophage erythroblast attacher [Medicago truncatula]
Length=873

 Score =   179 bits (455),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  780  CYEDDCTKEDPLSQEAFRTLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  839

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+GRI CPRT   C+YT+LVKAYIS
Sbjct  840  KALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS  873


 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+ KQWDYLVD FKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  730  TKYKVLFEPKQWDYLVDHFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  782



>ref|XP_009411983.1| PREDICTED: macrophage erythroblast attacher-like [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   174 bits (442),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LCY++ C+KEDPLSQE FRKLA+PLP+SK HHSKLVCYITKELMD ENPPLVLPNGYVYS
Sbjct  336  LCYKESCSKEDPLSQEGFRKLAEPLPFSKLHHSKLVCYITKELMDHENPPLVLPNGYVYS  395

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KNDG+ITCPRT   CN+T+LVKAYIS
Sbjct  396  TKALEEMANKNDGKITCPRTGEVCNFTELVKAYIS  430


 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPY  444
            T  +VLF+  QWDYLV+QFKQEFC+L+GMT EPLLN+YLQAGL+ALKTP  Y
Sbjct  287  TTYKVLFEPTQWDYLVEQFKQEFCRLFGMTNEPLLNVYLQAGLTALKTPLCY  338



>ref|XP_010921967.1| PREDICTED: macrophage erythroblast attacher-like [Elaeis guineensis]
Length=414

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E+ CTKEDPLS ESFRKLA PLP+SKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  320  FCFEEGCTKEDPLSHESFRKLAAPLPFSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  379

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KNDG++TCPRT  T N+++LVKAYIS
Sbjct  380  TKALEEMATKNDGKVTCPRTGETFNFSELVKAYIS  414


 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +V F+  QW YLV+QF+QEFC+L+GMTLEPLLNIYLQAGLSALKTP+ ++
Sbjct  274  KVFFEPMQWVYLVEQFRQEFCRLFGMTLEPLLNIYLQAGLSALKTPFCFE  323



>ref|XP_007142677.1| hypothetical protein PHAVU_007G007400g [Phaseolus vulgaris]
 gb|ESW14671.1| hypothetical protein PHAVU_007G007400g [Phaseolus vulgaris]
Length=410

 Score =   174 bits (440),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  317  CYEDDCTKEDPLSQEAFRTLALPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  376

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            KALE+MAKKN+GRI CPRT    N T+LVKAYIS
Sbjct  377  KALEEMAKKNNGRIICPRTGLVYNDTELVKAYIS  410


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+AKQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY Y+
Sbjct  270  KVLFEAKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYE  319



>ref|XP_006851961.1| hypothetical protein AMTR_s00041p00191400 [Amborella trichopoda]
 gb|ERN13428.1| hypothetical protein AMTR_s00041p00191400 [Amborella trichopoda]
Length=405

 Score =   173 bits (439),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYE+DCTKEDPLSQESFRKLA  LP+SKQHHSKLVCYI+KELMD +NPP VLPNGYVYST
Sbjct  312  CYEEDCTKEDPLSQESFRKLASSLPFSKQHHSKLVCYISKELMDVDNPPFVLPNGYVYST  371

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            KA+ DMAKKN G+ITCPRT   CN+TDLVKA+I
Sbjct  372  KAMADMAKKNGGKITCPRTGLVCNFTDLVKAFI  404


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLFDAK+WD LV+QFKQEFC+LYGM+LEPLLNIYLQAGLS LKTPY Y+
Sbjct  265  KVLFDAKRWDCLVEQFKQEFCRLYGMSLEPLLNIYLQAGLSVLKTPYCYE  314



>ref|XP_006291207.1| hypothetical protein CARUB_v10017336mg [Capsella rubella]
 gb|EOA24105.1| hypothetical protein CARUB_v10017336mg [Capsella rubella]
Length=417

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  325  FEEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTK  384

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN GRITCPRT F C+YT+LVKAYIS
Sbjct  385  ALKEMAEKNGGRITCPRTGFACDYTELVKAYIS  417


 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  277  KVLFELRQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  326



>ref|XP_009393357.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=423

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LCY++ C+KEDPLSQE FRKLA+PLP+SK HHSKLVCYITKELMD ENPPLVLPNGYVYS
Sbjct  329  LCYKEACSKEDPLSQEGFRKLAEPLPFSKLHHSKLVCYITKELMDHENPPLVLPNGYVYS  388

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KN+G+ITCPRT   CN+TDL+KAYIS
Sbjct  389  TKALEEMASKNEGKITCPRTGEVCNFTDLMKAYIS  423


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPY  444
            +VLF+  QWD LV+QFKQEFC+L+GMT EPLLNIYLQAGL+ALKTP  Y
Sbjct  283  KVLFEPTQWDCLVEQFKQEFCRLFGMTNEPLLNIYLQAGLTALKTPLCY  331



>ref|XP_009393358.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LCY++ C+KEDPLSQE FRKLA+PLP+SK HHSKLVCYITKELMD ENPPLVLPNGYVYS
Sbjct  326  LCYKEACSKEDPLSQEGFRKLAEPLPFSKLHHSKLVCYITKELMDHENPPLVLPNGYVYS  385

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KN+G+ITCPRT   CN+TDL+KAYIS
Sbjct  386  TKALEEMASKNEGKITCPRTGEVCNFTDLMKAYIS  420


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPY  444
            +VLF+  QWD LV+QFKQEFC+L+GMT EPLLNIYLQAGL+ALKTP  Y
Sbjct  280  KVLFEPTQWDCLVEQFKQEFCRLFGMTNEPLLNIYLQAGLTALKTPLCY  328



>ref|XP_010516063.1| PREDICTED: macrophage erythroblast attacher-like [Camelina sativa]
Length=417

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  325  FEEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTK  384

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN GRITCPRT F C++T+LVKAYIS
Sbjct  385  ALKEMAEKNGGRITCPRTGFACDFTELVKAYIS  417


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  277  KVLFELRQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  326



>ref|XP_010669743.1| PREDICTED: macrophage erythroblast attacher [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   171 bits (433),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYEDDC K+DPLSQESFRKLA  LP+SKQ +SKLVCYITKELMDTENPP+VLPNGYVYS
Sbjct  322  FCYEDDCPKDDPLSQESFRKLASSLPFSKQQYSKLVCYITKELMDTENPPMVLPNGYVYS  381

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA++N+G+ITCPRT   CNY+DL KAYIS
Sbjct  382  TKALEEMARRNNGKITCPRTGVVCNYSDLAKAYIS  416


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ KQWD+LVDQFKQEF KLYGMTLEPLLNIY+QAGLSALKTP+ Y+
Sbjct  276  KVLFEPKQWDHLVDQFKQEFYKLYGMTLEPLLNIYMQAGLSALKTPFCYE  325



>ref|XP_010427253.1| PREDICTED: macrophage erythroblast attacher-like [Camelina sativa]
Length=417

 Score =   171 bits (432),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  325  FEEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTK  384

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN G+ITCPRT F C+YT+LVKAYIS
Sbjct  385  ALKEMAEKNGGKITCPRTGFACDYTELVKAYIS  417


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  277  KVLFELRQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  326



>dbj|BAK01850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E +C KEDPLS + FRKLA+PLP+SKQHHSKLVC+ITKELMDTENPPLVLPNGYVYS
Sbjct  314  FCFEGNCPKEDPLSLDGFRKLAEPLPFSKQHHSKLVCHITKELMDTENPPLVLPNGYVYS  373

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL++MAKKN G+ITCPRT   CNYT+LVKAYIS
Sbjct  374  TKALDEMAKKNGGKITCPRTGEVCNYTELVKAYIS  408


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWD+LVDQFKQEF KLYGMTLEPLLNIYLQAGL+ALKTP+ ++
Sbjct  268  KVLFEQNQWDFLVDQFKQEFYKLYGMTLEPLLNIYLQAGLTALKTPFCFE  317



>ref|NP_191067.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana]
 emb|CAB82702.1| putative protein [Arabidopsis thaliana]
 gb|ABH04583.1| At3g55070 [Arabidopsis thaliana]
 gb|AEE79335.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana]
Length=418

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  703  EDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKA  882
            E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTKA
Sbjct  327  EEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTKA  386

Query  883  LEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            L++MA+KN G+ITCPRT   CNYT+LVKAYIS
Sbjct  387  LKEMAEKNGGKITCPRTGLVCNYTELVKAYIS  418


 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY  +
Sbjct  278  KVLFELRQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGLE  327



>ref|XP_002876284.1| hypothetical protein ARALYDRAFT_485927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52543.1| hypothetical protein ARALYDRAFT_485927 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  326  FEEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTK  385

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN G ITCPRT   CNYT+LVKAYIS
Sbjct  386  ALKEMAEKNGGTITCPRTGLVCNYTELVKAYIS  418


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+ +QW+ LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  278  KVLFEPQQWNILVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  327



>emb|CDX73410.1| BnaC08g25930D [Brassica napus]
Length=415

 Score =   168 bits (425),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPPLV PNGYVYSTK
Sbjct  323  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPLVFPNGYVYSTK  382

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA KN G + CPRT   CNYTDLVKAYIS
Sbjct  383  ALKEMADKNGGEVKCPRTGLVCNYTDLVKAYIS  415


 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+  QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  272  TKYKVLFELGQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  324



>emb|CDY40198.1| BnaA09g34800D [Brassica napus]
Length=415

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPPLV PNGYVYSTK
Sbjct  323  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPLVFPNGYVYSTK  382

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA KN G + CPRT   CNYTDLVKAYIS
Sbjct  383  ALKEMADKNKGEVKCPRTGLVCNYTDLVKAYIS  415


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+  QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  272  TKYKVLFELGQWDLLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  324



>emb|CDY02905.1| BnaC04g25810D [Brassica napus]
Length=414

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  322  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPQVLPNGYVYSTK  381

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA KN G I CPRT F CN+TDLVKAYIS
Sbjct  382  ALKEMADKNKGEIKCPRTGFVCNHTDLVKAYIS  414


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            + LF+ +QWD LV QFKQEFCKLYGMT+EPLLNIYLQAGL+ALKTPY ++
Sbjct  274  KALFEPQQWDVLVHQFKQEFCKLYGMTMEPLLNIYLQAGLTALKTPYSFE  323



>ref|NP_001054719.1| Os05g0160100 [Oryza sativa Japonica Group]
 gb|AAT93911.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV43923.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16633.1| Os05g0160100 [Oryza sativa Japonica Group]
 gb|EAY96642.1| hypothetical protein OsI_18556 [Oryza sativa Indica Group]
 dbj|BAG93516.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62417.1| hypothetical protein OsJ_17208 [Oryza sativa Japonica Group]
Length=406

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C++ +C KEDPLS   FRKLA+PLP+SKQHHSKLVCYITKELMDTENPPLV PNGYVYS
Sbjct  312  FCFDGNCPKEDPLSLPGFRKLAEPLPFSKQHHSKLVCYITKELMDTENPPLVFPNGYVYS  371

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL++MAKKN G++TCPRT   CNYTDLVKAYIS
Sbjct  372  TKALDEMAKKNGGKVTCPRTGDICNYTDLVKAYIS  406


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWD LVDQFKQEFCKLYGMTLEPLLNIY+QAGL+ALKTP+ +D
Sbjct  266  KVLFEQNQWDSLVDQFKQEFCKLYGMTLEPLLNIYMQAGLTALKTPFCFD  315



>ref|XP_009139201.1| PREDICTED: macrophage erythroblast attacher-like [Brassica rapa]
 emb|CDX76123.1| BnaA04g03870D [Brassica napus]
Length=414

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPP VLPNGYVYSTK
Sbjct  322  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPQVLPNGYVYSTK  381

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA KN G I CPRT F CN+TDLVKAYIS
Sbjct  382  ALKEMADKNKGEIKCPRTGFVCNHTDLVKAYIS  414


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            + LF+ +QWD LV QFKQEFCKLYGMT+EPLLNIYLQAGL+ALKTPY ++
Sbjct  274  KALFEPQQWDVLVHQFKQEFCKLYGMTMEPLLNIYLQAGLTALKTPYSFE  323



>ref|XP_008812008.1| PREDICTED: macrophage erythroblast attacher-like [Phoenix dactylifera]
Length=344

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E+ CTKEDPLS E FRKLA PLP+SKQHHSKLVCYITKELMDTENPPLVLPNGYVYS
Sbjct  250  FCFEEGCTKEDPLSHEGFRKLAAPLPFSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  309

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKALE+MA KNDG++TCPRT    N+ +LVK YIS
Sbjct  310  TKALEEMASKNDGKVTCPRTGEAFNFCELVKVYIS  344


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QW YLV+QFKQEFC+L+GMTLEPLLNIYLQAGLSALKTP+ ++
Sbjct  204  KVLFEPMQWVYLVEQFKQEFCRLFGMTLEPLLNIYLQAGLSALKTPFCFE  253



>ref|XP_006403495.1| hypothetical protein EUTSA_v10010415mg [Eutrema salsugineum]
 gb|ESQ44948.1| hypothetical protein EUTSA_v10010415mg [Eutrema salsugineum]
Length=417

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA+PLPYSKQ HSKLVCYI+KE MDT+NPP VLPNGYVYSTK
Sbjct  325  FEEGCTKEDPLSQESFRKLARPLPYSKQDHSKLVCYISKEPMDTDNPPQVLPNGYVYSTK  384

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MA+KN G ITCPRT F CNYTDLVKAY+S
Sbjct  385  ALKEMAEKNGGNITCPRTGFVCNYTDLVKAYVS  417


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  ++LF+ +QWD LV QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  274  TKYKILFEIRQWDVLVHQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  326



>ref|XP_003568863.1| PREDICTED: macrophage erythroblast attacher [Brachypodium distachyon]
Length=406

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C+E +C KEDPLS + FRKLA+PLP+SKQHHSKLVC+ITKELMDTENPPLVLPNGYVYS
Sbjct  312  FCFEGNCPKEDPLSLDGFRKLAEPLPFSKQHHSKLVCHITKELMDTENPPLVLPNGYVYS  371

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL++MAKKN+G+ITCPRT    NYT+LVKAYIS
Sbjct  372  TKALDEMAKKNEGKITCPRTGEVYNYTELVKAYIS  406


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWD LVDQFKQEF KLYGMTLEPLLNIYLQAGL+ALKTP+ ++
Sbjct  266  KVLFELNQWDSLVDQFKQEFYKLYGMTLEPLLNIYLQAGLTALKTPFCFE  315



>ref|XP_009116209.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Brassica 
rapa]
Length=415

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPPLV PNGYVYSTK
Sbjct  323  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPLVFPNGYVYSTK  382

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL+ +A KN G + CPRT   CNYTDLVKAYIS
Sbjct  383  ALKKIADKNRGEVKCPRTGLVCNYTDLVKAYIS  415


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+  QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  272  TKYKVLFELGQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  324



>ref|XP_009116208.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Brassica 
rapa]
Length=421

 Score =   165 bits (417),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            +E+ CTKEDPLSQESFRKLA PLPYSKQ HSKLVCYI+KELMDTENPPLV PNGYVYSTK
Sbjct  329  FEEGCTKEDPLSQESFRKLALPLPYSKQEHSKLVCYISKELMDTENPPLVFPNGYVYSTK  388

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL+ +A KN G + CPRT   CNYTDLVKAYIS
Sbjct  389  ALKKIADKNRGEVKCPRTGLVCNYTDLVKAYIS  421


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  +VLF+  QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTPY ++
Sbjct  278  TKYKVLFELGQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGFE  330



>gb|EMT07376.1| hypothetical protein F775_28620 [Aegilops tauschii]
Length=305

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            Y+ +C KEDPLS + FRKLA+PLP+SKQHHSKLVC+ITKELMDTENPPLVLPNGYVYSTK
Sbjct  213  YKGNCPKEDPLSLDGFRKLAEPLPFSKQHHSKLVCHITKELMDTENPPLVLPNGYVYSTK  272

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            AL++MAKKN G+I CPRT   CNYT+LVKAYIS
Sbjct  273  ALDEMAKKNGGKIICPRTGEECNYTELVKAYIS  305



>gb|EYU33168.1| hypothetical protein MIMGU_mgv1a007495mg [Erythranthe guttata]
Length=405

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY++ CT EDPLSQE FRKLA PLP+SKQHHSKLVCYI+KELMD +NPPLVLPNGYVYST
Sbjct  312  CYKNACTNEDPLSQEGFRKLAMPLPFSKQHHSKLVCYISKELMDCDNPPLVLPNGYVYST  371

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +AL++MAK+N+G+I+CPRT   C Y D+VKA+IS
Sbjct  372  RALQEMAKQNNGKISCPRTGLVCEYKDVVKAFIS  405


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPY  444
            +VLF+ +QWDYLVDQFKQEF KLYGMTLEPLL+IYLQAGL ALKTPY Y
Sbjct  265  KVLFEERQWDYLVDQFKQEFYKLYGMTLEPLLHIYLQAGLCALKTPYCY  313



>ref|XP_006655016.1| PREDICTED: macrophage erythroblast attacher-like [Oryza brachyantha]
Length=397

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  664  IYM---FVLTKYRLCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTE  834
            IYM       K   C + +C KEDPLS   FRKLA+PLP+SKQHHSKLVCYITKELMDTE
Sbjct  290  IYMQAGLTALKTPFCLDGNCPKEDPLSLPGFRKLAEPLPFSKQHHSKLVCYITKELMDTE  349

Query  835  NPPLVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            NPPLV PNGYVYSTKAL++MAKKN G++TCPRT   CN+ DLVKAYIS
Sbjct  350  NPPLVFPNGYVYSTKALDEMAKKNGGKVTCPRTGDVCNFADLVKAYIS  397


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLF+  QWD LVDQFKQEFCKLYGMTLEPLLNIY+QAGL+ALKTP+  D
Sbjct  257  KVLFEQNQWDCLVDQFKQEFCKLYGMTLEPLLNIYMQAGLTALKTPFCLD  306



>gb|ABR16457.1| unknown [Picea sitchensis]
Length=406

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  685  KYRLCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGY  864
            K + CYE++CTKEDPLSQESF+KLA  LP+SK  HSKLVCYI+KELMD +NPPLVLPNGY
Sbjct  309  KTQFCYEENCTKEDPLSQESFQKLASDLPFSKHIHSKLVCYISKELMDADNPPLVLPNGY  368

Query  865  VYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            VYSTKAL++MAKKN+G++ CPRT   C++TDL KA+IS
Sbjct  369  VYSTKALDEMAKKNNGKVICPRTGIVCDFTDLSKAFIS  406


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYDYFFGLSN--T  471
            +VLFDAKQWD LV QFK+EFCKLYGMT+EPLLNIYLQAGLSALKT + Y+      +  +
Sbjct  266  KVLFDAKQWDNLVQQFKEEFCKLYGMTIEPLLNIYLQAGLSALKTQFCYEENCTKEDPLS  325

Query  472  VYSFQSASSELSF  510
              SFQ  +S+L F
Sbjct  326  QESFQKLASDLPF  338



>ref|XP_004977102.1| PREDICTED: macrophage erythroblast attacher-like [Setaria italica]
Length=404

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LC E  C KEDPLS E FRKLA+PLP+SKQHHSKLVCYITKELMDTENPP VLPNGYVYS
Sbjct  310  LCSEGSCPKEDPLSLEGFRKLAEPLPFSKQHHSKLVCYITKELMDTENPPRVLPNGYVYS  369

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++MAKKNDG+ITCPRT   C++++ V+A+IS
Sbjct  370  EKALQEMAKKNDGKITCPRTGDVCDFSECVRAFIS  404


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            ++LF+  +WD+LVD FKQ+FCKLYGMTLEPLLNIYLQAGL+ALKTP
Sbjct  264  KILFEKDRWDFLVDMFKQDFCKLYGMTLEPLLNIYLQAGLTALKTP  309



>gb|EPS71206.1| hypothetical protein M569_03553, partial [Genlisea aurea]
Length=411

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
              YE +CTKEDPLSQE FR+L+ PLP+SKQHHSKLVCYI+K +MD+ENPPLVLPNGYVYS
Sbjct  317  FSYEANCTKEDPLSQEGFRELSNPLPFSKQHHSKLVCYISKAVMDSENPPLVLPNGYVYS  376

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +KALE+MAK+N+ +ITCPRT  T  +++LV+AYIS
Sbjct  377  SKALEEMAKRNENKITCPRTGSTYQFSELVRAYIS  411


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +VLFDAKQWD+LV+QFKQEFC+LYGMT+EPLLNIYLQAGLSALKTP+ Y+
Sbjct  271  KVLFDAKQWDFLVEQFKQEFCRLYGMTVEPLLNIYLQAGLSALKTPFSYE  320



>ref|XP_002439337.1| hypothetical protein SORBIDRAFT_09g004620 [Sorghum bicolor]
 gb|EES17767.1| hypothetical protein SORBIDRAFT_09g004620 [Sorghum bicolor]
Length=405

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C E  C +EDPLS E FRKLA+PLP+SKQHHSKLVCYITKELMDTENPP VLPNGYVYS
Sbjct  311  FCTEGSCPREDPLSLEGFRKLAEPLPFSKQHHSKLVCYITKELMDTENPPRVLPNGYVYS  370

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++M+KKNDG+ITCPRT   C++++ V+A+IS
Sbjct  371  EKALQEMSKKNDGKITCPRTGDVCDFSECVRAFIS  405


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            ++LF+ ++WDYLVD FKQ+FCKLYGMTLEPLLNIYLQAGL+ALKTP+
Sbjct  265  KILFEQERWDYLVDIFKQDFCKLYGMTLEPLLNIYLQAGLTALKTPF  311



>ref|NP_001145704.1| uncharacterized protein LOC100279208 [Zea mays]
 gb|ACL52422.1| unknown [Zea mays]
 gb|AFW77224.1| putative lisH domain and CRA domain protein [Zea mays]
Length=163

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C E  C KEDPLS E FRKLA+PLP+SKQHHSKLVCYITKELMDTENPP VLPNGYVYS
Sbjct  69   FCSEGSCPKEDPLSLEGFRKLAEPLPFSKQHHSKLVCYITKELMDTENPPQVLPNGYVYS  128

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++M+KKNDG+ITCPRT    + ++ V+A+IS
Sbjct  129  EKALQEMSKKNDGKITCPRTGDVYDVSECVRAFIS  163


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            ++LF+  +WDYLVD FKQ+FCKLYGMTLEPLLNIYLQAGL+ALKTP+
Sbjct  23   KILFEQDRWDYLVDIFKQDFCKLYGMTLEPLLNIYLQAGLTALKTPF  69



>ref|XP_001768337.1| predicted protein [Physcomitrella patens]
 gb|EDQ66951.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYE+ CTKEDPLSQE+ RKLA PLP++K  HSKLVCYITKE M+  NPPLVLPNGYVYS
Sbjct  324  FCYEEGCTKEDPLSQETIRKLADPLPFAKHIHSKLVCYITKEPMNENNPPLVLPNGYVYS  383

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKA+  MA +N G+ITCPRTS  CN+++L KAYIS
Sbjct  384  TKAMVQMAMENQGKITCPRTSVVCNFSELAKAYIS  418


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            ++LFD +QW  L  QFKQEFCKLYGMT EPLLNI+LQAGLSALKTP+ Y+
Sbjct  278  KILFDTQQWYNLTQQFKQEFCKLYGMTHEPLLNIHLQAGLSALKTPFCYE  327



>ref|XP_008647704.1| PREDICTED: uncharacterized protein LOC100279208 isoform X1 [Zea 
mays]
 gb|ACG35753.1| macrophage erythroblast attacher [Zea mays]
 gb|ACN28906.1| unknown [Zea mays]
 gb|AFW77226.1| putative lisH domain and CRA domain protein [Zea mays]
Length=404

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             C E  C KEDPLS E FRKLA+PLP+SKQHHSKLVCYITKELMDTENPP VLPNGYVYS
Sbjct  310  FCSEGSCPKEDPLSLEGFRKLAEPLPFSKQHHSKLVCYITKELMDTENPPQVLPNGYVYS  369

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++M+KKNDG+ITCPRT    + ++ V+A+IS
Sbjct  370  EKALQEMSKKNDGKITCPRTGDVYDVSECVRAFIS  404


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPY  438
            ++LF+  +WDYLVD FKQ+FCKLYGMTLEPLLNIYLQAGL+ALKTP+
Sbjct  264  KILFEQDRWDYLVDIFKQDFCKLYGMTLEPLLNIYLQAGLTALKTPF  310



>ref|XP_001780731.1| predicted protein [Physcomitrella patens]
 gb|EDQ54440.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYE+ CTKEDPLSQE  RKLA PLP++K  HSKLVCYITKE M+  NPPLVLPNGYVYS
Sbjct  320  FCYEEGCTKEDPLSQEIIRKLADPLPFAKHIHSKLVCYITKEPMNDNNPPLVLPNGYVYS  379

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKA+E MA +N G+I CPRT    N+++L KAYIS
Sbjct  380  TKAMEQMAMRNQGKIVCPRTGAVYNFSELAKAYIS  414


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            ++LFD +QWD L  +FKQEF KLYGMT EPLLNI+LQAGLSALKTP+ Y+
Sbjct  274  KILFDTQQWDNLTQEFKQEFYKLYGMTHEPLLNIHLQAGLSALKTPFCYE  323



>ref|XP_002970402.1| hypothetical protein SELMODRAFT_93124 [Selaginella moellendorffii]
 gb|EFJ28532.1| hypothetical protein SELMODRAFT_93124 [Selaginella moellendorffii]
Length=410

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYE+ CTKEDPLSQE+ RKLA+PLPY+K  HSKLVCYITKELMD +NPPLVLPNGYVYS
Sbjct  317  FCYEESCTKEDPLSQENIRKLAEPLPYAKHIHSKLVCYITKELMDEDNPPLVLPNGYVYS  376

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++M +  +G+ITCP+T + C+ +++ KAYIS
Sbjct  377  KKALDEMIRA-EGKITCPKTGYVCSMSEVHKAYIS  410


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +  F+  QWD LV+QFKQEF KLYGMT EPLL++++QAGLSALKTP+ Y+
Sbjct  271  KAFFEDSQWDSLVEQFKQEFYKLYGMTNEPLLHLHMQAGLSALKTPFCYE  320



>ref|XP_002968172.1| hypothetical protein SELMODRAFT_89330 [Selaginella moellendorffii]
 gb|EFJ30426.1| hypothetical protein SELMODRAFT_89330 [Selaginella moellendorffii]
Length=410

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
             CYE+ CTKEDPLSQE+ RKLA+PLPY+K  HSKLVCYITKELMD +NPPLVLPNGYVYS
Sbjct  317  FCYEESCTKEDPLSQENIRKLAEPLPYAKHIHSKLVCYITKELMDEDNPPLVLPNGYVYS  376

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++M +  +G+ITCP+T + C+ +++ KAYIS
Sbjct  377  KKALDEMIRA-EGKITCPKTGYVCSMSEVHKAYIS  410


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            +  F+  QWD LV+QFKQEF KLYGMT EPLL++++QAGLSALKTP+ Y+
Sbjct  271  KAFFEDSQWDSLVEQFKQEFYKLYGMTNEPLLHLHMQAGLSALKTPFCYE  320



>ref|XP_006436158.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 gb|ESR49398.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
Length=238

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  169  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  228

Query  877  KA  882
            K 
Sbjct  229  KV  230


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  119  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  171



>ref|XP_006436160.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
 gb|ESR49400.1| hypothetical protein CICLE_v10031660mg [Citrus clementina]
Length=327

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CYEDDCTKEDPLSQESFRKLA PLPYSKQHHSKLVCYITKELMDTENPP VLPNGYVYST
Sbjct  258  CYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYST  317

Query  877  KA  882
            K 
Sbjct  318  KV  319


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPY Y+
Sbjct  208  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYE  260



>ref|XP_002991550.1| hypothetical protein SELMODRAFT_133748 [Selaginella moellendorffii]
 gb|EFJ07304.1| hypothetical protein SELMODRAFT_133748 [Selaginella moellendorffii]
Length=394

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LCYE+ C K+DP S E+ RKLA+PLP+ K   S+L+CYITKELMD +NPP+VLPNGYVYS
Sbjct  300  LCYEETCLKDDPFSHEAIRKLAEPLPFMKHVRSRLICYITKELMDEDNPPMVLPNGYVYS  359

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL+ M+ +N+G +TCPRT+         +A++S
Sbjct  360  TKALQTMSDQNNGLVTCPRTNEVFALATATRAFVS  394


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            LFD  QW+ L+  FK EFCK++GMT   LL+IY+QAGLSALKTP  Y+
Sbjct  256  LFDDNQWEKLIQLFKDEFCKMHGMTSPSLLHIYIQAGLSALKTPLCYE  303



>ref|XP_002971744.1| hypothetical protein SELMODRAFT_147945 [Selaginella moellendorffii]
 gb|EFJ27493.1| hypothetical protein SELMODRAFT_147945 [Selaginella moellendorffii]
Length=398

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            LCYE+ C K+DP S E+ RKLA+PLP+ K   S+L+CYITKELMD +NPP+VLPNGYVYS
Sbjct  304  LCYEETCLKDDPFSHEAIRKLAEPLPFMKHVRSRLICYITKELMDEDNPPMVLPNGYVYS  363

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            TKAL+ M+ +N+G +TCPRT+         +A++S
Sbjct  364  TKALQTMSDQNNGLVTCPRTNEVFALATATRAFVS  398


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
             + + LFD  QW+ L+  FK EFCK++GMT   LL+IY+QAGLSALKTP  Y+
Sbjct  255  VFYKTLFDDNQWEKLIQLFKDEFCKMHGMTSPSLLHIYIQAGLSALKTPLCYE  307



>ref|XP_005847260.1| hypothetical protein CHLNCDRAFT_57944 [Chlorella variabilis]
 gb|EFN55158.1| hypothetical protein CHLNCDRAFT_57944 [Chlorella variabilis]
Length=381

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            L   D C +EDPL   +FR LA+ LP++K  HSKL+C ++  LM+  NPP  LPNGYVYS
Sbjct  287  LSLADSCCREDPLHLPAFRALAEGLPFAKHVHSKLICALSHTLMNEHNPPAALPNGYVYS  346

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             KAL++MA  + GR+TCPRT F+C+ + L + Y+S
Sbjct  347  QKALQEMAAAHGGRVTCPRTGFSCDVSQLRRVYVS  381



>ref|XP_005651863.1| hypothetical protein COCSUDRAFT_34765 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27319.1| hypothetical protein COCSUDRAFT_34765 [Coccomyxa subellipsoidea 
C-169]
Length=379

 Score =   115 bits (287),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  700  YEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTK  879
            Y    +KEDPLS E F+KLA  +P+SK  HSKLVC IT+E+M+  NPP+VLPNG VYS K
Sbjct  287  YAVKSSKEDPLSMEKFQKLADGMPWSKHVHSKLVCAITREIMNEHNPPMVLPNGAVYSEK  346

Query  880  ALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            A++ +A +N    TCP+T  +C+ +DL +AYIS
Sbjct  347  AVQQVASRNHNIFTCPKTGVSCDVSDLRRAYIS  379



>ref|XP_007384346.1| hypothetical protein PUNSTDRAFT_52824 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN08394.1| hypothetical protein PUNSTDRAFT_52824 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=395

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  697  CYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            CY++     D P+   +  +LA+ +P S   +S +VC IT ++MD +N P+ LPNGYVYS
Sbjct  301  CYDEHMKSVDCPVCDPALGQLAKEVPASHHVNSSIVCSITGKIMDEDNMPMALPNGYVYS  360

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             +AL++MA KNDG++TCPRT +TC+++DL K +IS
Sbjct  361  KEALQEMAAKNDGQVTCPRTGYTCDFSDLRKVFIS  395



>ref|XP_007009625.1| LisH/CRA/RING-U-box domains-containing protein isoform 2 [Theobroma 
cacao]
 gb|EOY18435.1| LisH/CRA/RING-U-box domains-containing protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 2/62 (3%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYDYFFGLSNTVY  477
            +VLF+ KQWD+LVDQFKQEFC+LYGMTLEPLLNIYLQAGLSALKTPYPY     L  T Y
Sbjct  281  KVLFEPKQWDFLVDQFKQEFCRLYGMTLEPLLNIYLQAGLSALKTPYPYRDCHSL--TAY  338

Query  478  SF  483
             F
Sbjct  339  GF  340



>ref|XP_004362066.1| lissencephaly type-1-like motif-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG24215.1| lissencephaly type-1-like motif-containing protein [Dictyostelium 
fasciculatum]
Length=425

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+  + F+KLA+PLP S Q HS L+C I+ E+MD  NPPLVLPNG +Y   AL+ MA+ N
Sbjct  342  PVCDKDFKKLAKPLPISLQSHSSLICRISGEVMDEHNPPLVLPNGQLYCKNALDAMAEAN  401

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            +G +TCP+T  + +Y+ L KA+IS
Sbjct  402  EGVVTCPKTGKSFDYSQLRKAFIS  425



>ref|XP_007869411.1| hypothetical protein GLOTRDRAFT_112215 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ52235.1| hypothetical protein GLOTRDRAFT_112215 [Gloeophyllum trabeum 
ATCC 11539]
Length=401

 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query  697  CYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            CY+      D P+   +  +LA+ +P+S   +S +VC+IT ++MD +N P+  PNGYVYS
Sbjct  307  CYDPASKNADCPVCDPALGQLAKEVPFSHHVNSTIVCHITGKVMDEDNAPMAFPNGYVYS  366

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             +ALEDMA KNDG +TCPRT+ +C ++ L + YIS
Sbjct  367  REALEDMAAKNDGIVTCPRTNHSCEFSALRRVYIS  401



>gb|KEH44532.1| macrophage erythroblast attacher-like protein [Medicago truncatula]
Length=322

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYP  441
            T  +VLF+ KQWDYLVD FKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYP
Sbjct  272  TKYKVLFEPKQWDYLVDHFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYP  322



>ref|XP_009549968.1| hypothetical protein HETIRDRAFT_157383 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77955.1| hypothetical protein HETIRDRAFT_157383 [Heterobasidion irregulare 
TC 32-1]
Length=393

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  685  KYRLCYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNG  861
            K   CY+      D P+   SFR+LA+ +P+S   +S +VC ++  +MD  NPP+  PNG
Sbjct  295  KLSACYDPGTQNRDCPVCDASFRELAKEVPFSHHVNSTIVCRLSGRIMDENNPPMAFPNG  354

Query  862  YVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            YVYS +ALE+MA KN+G +TCPR+   C Y+ L K ++S
Sbjct  355  YVYSREALEEMAIKNEGIVTCPRSGEQCEYSKLKKVFVS  393



>gb|KDQ58612.1| hypothetical protein JAAARDRAFT_34441 [Jaapia argillacea MUCL 
33604]
Length=398

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC   DP    S  +LAQ +P+S   +S +VC IT ++MD +N P+  PNGYVYS +ALE
Sbjct  313  DCPVCDP----SLGQLAQEVPFSHHLNSTIVCSITGKIMDADNMPMAFPNGYVYSREALE  368

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            DMA KN+G +TCPRT  +C+++ L K +IS
Sbjct  369  DMAAKNEGIVTCPRTGTSCDFSALRKVFIS  398



>gb|KDO67856.1| hypothetical protein CISIN_1g014891mg [Citrus sinensis]
Length=336

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYDYF  453
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPYPY   
Sbjct  273  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYPYSVI  327



>dbj|GAM20646.1| hypothetical protein SAMD00019534_038210, partial [Acytostelium 
subglobosum LB1]
Length=399

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            PL    F +LA+PLP S Q HS L+C IT ELM  +NPP+VLPNG VY   A+ +MA  +
Sbjct  316  PLCDADFSRLAEPLPVSLQSHSSLICRITGELMTDDNPPMVLPNGNVYCRNAMVEMAAHD  375

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            D  ITCPR+    NY +L +AYI+
Sbjct  376  DNIITCPRSGAKFNYAELRRAYIA  399



>emb|CCL99210.1| predicted protein [Fibroporia radiculosa]
Length=396

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+   +  +LA+ +P+S   +S +VC I+ ++MD +N PLV PNG VYS +ALEDMA +N
Sbjct  313  PVCDSNLGRLAEEVPFSHHVNSTIVCRISGKIMDEDNMPLVFPNGQVYSKEALEDMAARN  372

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            DG + CPRT   CN++DL K +IS
Sbjct  373  DGTVRCPRTGEKCNFSDLRKVFIS  396



>ref|XP_007302044.1| hypothetical protein STEHIDRAFT_119889 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89151.1| hypothetical protein STEHIDRAFT_119889 [Stereum hirsutum FP-91666 
SS1]
Length=398

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = +1

Query  685  KYRLCYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNG  861
            K   CY+      D P+  ESF +LA+ +P+S   +S +VC I+ ++M+ +N P+V P G
Sbjct  300  KLSACYDHSTKNPDCPVCDESFGELAKEVPFSHHVNSTIVCSISGKIMNEDNQPMVFPGG  359

Query  862  YVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            YVYS +ALE+MA KNDG +TCPR+   C ++ L K ++S
Sbjct  360  YVYSREALEEMAAKNDGIVTCPRSGEQCEFSKLKKVFVS  398



>gb|KFM27605.1| Macrophage erythroblast attacher [Auxenochlorella protothecoides]
Length=374

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +1

Query  715  TKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDM  894
            ++ DPL   ++  LA+ LP +K  HS L+C I+   MD  NPPLV+ NG+VY   AL   
Sbjct  287  SRADPLHLATYAGLAEGLPRAKHSHSHLICAISHVPMDEHNPPLVMKNGHVYGQAALRAQ  346

Query  895  AKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            A ++DG +TCP T + C Y++L +AYIS
Sbjct  347  ADRDDGVVTCPVTGYRCEYSELKRAYIS  374



>ref|NP_001078291.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE79336.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana]
Length=323

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            +VLF+ +QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSALKTP
Sbjct  278  KVLFELRQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTP  323



>gb|KDQ31896.1| hypothetical protein PLEOSDRAFT_1091869 [Pleurotus ostreatus 
PC15]
Length=403

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            KLA  +P+S   +S +VC IT  +MD +N P+  PNGYVYS + LEDMA KN G +TCPR
Sbjct  328  KLAAEVPFSHHVNSTIVCAITGRIMDADNMPMAFPNGYVYSREVLEDMAAKNRGMVTCPR  387

Query  931  TSFTCNYTDLVKAYIS  978
            T  TC +  L K YIS
Sbjct  388  TGETCQFAALRKVYIS  403



>ref|XP_005090204.1| PREDICTED: macrophage erythroblast attacher-like [Aplysia californica]
Length=392

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY+D+ +  +P   +      +LAQPLP+S   +SKLVC IT   ++  NPP++LPNG +
Sbjct  296  CYKDEMSMRNPDCPVCSTHMNELAQPLPFSHCANSKLVCSITGFALNEHNPPMMLPNGRI  355

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y  KALE+MA  NDGR+ CPRT    +  DL K ++
Sbjct  356  YGMKALENMAGDNDGRVVCPRTQEIFHVDDLEKVFV  391



>ref|XP_007313967.1| hypothetical protein SERLADRAFT_457895 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN92895.1| hypothetical protein SERLA73DRAFT_190495 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO29725.1| hypothetical protein SERLADRAFT_457895 [Serpula lacrymans var. 
lacrymans S7.9]
Length=397

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +1

Query  697  CYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            CY      + P+       L++ +P+S   +S +VC ++ ++MD +N P+  PNGYVYS 
Sbjct  304  CYHSTKNIDCPVCDADIGLLSKEVPFSHHLNSTIVCRLSGKIMDEDNMPMAFPNGYVYSR  363

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +ALEDMA KN+G++TCPR+  TC ++ L K +IS
Sbjct  364  EALEDMAAKNNGQVTCPRSELTCEFSALKKVFIS  397



>gb|EXX64645.1| glucose-induced degradation complex subunit FYV10 [Rhizophagus 
irregularis DAOM 197198w]
Length=309

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LAQ LP S   +S +VC ++ E++D +NPP+ LPNGYVYS KALE+M+ KN+G+I CPRT
Sbjct  235  LAQNLPLSHHVNSTIVCRLSGEIIDEDNPPMSLPNGYVYSLKALEEMSSKNNGQIKCPRT  294

Query  934  SFTCNYTDLVKAYIS  978
                ++ DL K +IS
Sbjct  295  EKVYDFKDLKKVFIS  309


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            L+D  +WD L+ QF+ +   L  +T +PLL + LQAGLSALKTP
Sbjct  169  LYDKSRWDALIAQFRADNFALNSLTSQPLLTVTLQAGLSALKTP  212



>gb|EXX64646.1| glucose-induced degradation complex subunit FYV10 [Rhizophagus 
irregularis DAOM 197198w]
Length=329

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LAQ LP S   +S +VC ++ E++D +NPP+ LPNGYVYS KALE+M+ KN+G+I CPRT
Sbjct  255  LAQNLPLSHHVNSTIVCRLSGEIIDEDNPPMSLPNGYVYSLKALEEMSSKNNGQIKCPRT  314

Query  934  SFTCNYTDLVKAYIS  978
                ++ DL K +IS
Sbjct  315  EKVYDFKDLKKVFIS  329


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            L+D  +WD L+ QF+ +   L  +T +PLL + LQAGLSALKTP
Sbjct  189  LYDKSRWDALIAQFRADNFALNSLTSQPLLTVTLQAGLSALKTP  232



>gb|KDO67855.1| hypothetical protein CISIN_1g014891mg [Citrus sinensis]
Length=321

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  289  TYLQVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            T  + LF+ KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TP
Sbjct  273  TTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTP  321



>ref|XP_007271545.1| hypothetical protein FOMMEDRAFT_129613 [Fomitiporia mediterranea 
MF3/22]
 gb|EJC98292.1| hypothetical protein FOMMEDRAFT_129613 [Fomitiporia mediterranea 
MF3/22]
Length=398

 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LA+ +P+S   +S +VC+++ +++D +NPP+  PNGYVYS  ALE+MA ++DG +TCPRT
Sbjct  324  LAKEVPWSHHVNSTIVCFLSGKIVDGDNPPMAFPNGYVYSRNALEEMASRHDGVVTCPRT  383

Query  934  SFTCNYTDLVKAYIS  978
               C + +L K +IS
Sbjct  384  GQVCQFNELRKVFIS  398



>gb|EXX64647.1| glucose-induced degradation complex subunit FYV10 [Rhizophagus 
irregularis DAOM 197198w]
Length=398

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LAQ LP S   +S +VC ++ E++D +NPP+ LPNGYVYS KALE+M+ KN+G+I CPRT
Sbjct  324  LAQNLPLSHHVNSTIVCRLSGEIIDEDNPPMSLPNGYVYSLKALEEMSSKNNGQIKCPRT  383

Query  934  SFTCNYTDLVKAYIS  978
                ++ DL K +IS
Sbjct  384  EKVYDFKDLKKVFIS  398


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            L+D  +WD L+ QF+ +   L  +T +PLL + LQAGLSALKTP
Sbjct  258  LYDKSRWDALIAQFRADNFALNSLTSQPLLTVTLQAGLSALKTP  301



>gb|ESA15728.1| hypothetical protein GLOINDRAFT_162711 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64644.1| glucose-induced degradation complex subunit FYV10 [Rhizophagus 
irregularis DAOM 197198w]
Length=396

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LAQ LP S   +S +VC ++ E++D +NPP+ LPNGYVYS KALE+M+ KN+G+I CPRT
Sbjct  322  LAQNLPLSHHVNSTIVCRLSGEIIDEDNPPMSLPNGYVYSLKALEEMSSKNNGQIKCPRT  381

Query  934  SFTCNYTDLVKAYIS  978
                ++ DL K +IS
Sbjct  382  EKVYDFKDLKKVFIS  396


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            L+D  +WD L+ QF+ +   L  +T +PLL + LQAGLSALKTP
Sbjct  256  LYDKSRWDALIAQFRADNFALNSLTSQPLLTVTLQAGLSALKTP  299



>ref|XP_010504349.1| PREDICTED: macrophage erythroblast attacher-like [Camelina sativa]
Length=322

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            +VLF+ +QWD LV+QFKQEFCKLYGMT+EPLLNIYLQAGLSALKTP
Sbjct  277  KVLFELRQWDVLVNQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTP  322



>ref|XP_010101504.1| hypothetical protein L484_017254 [Morus notabilis]
 gb|EXB88501.1| hypothetical protein L484_017254 [Morus notabilis]
Length=79

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 48/79 (61%), Gaps = 27/79 (34%)
 Frame = +1

Query  823  MDTENPPLVLPNGYVYSTK---------------------------ALEDMAKKNDGRIT  921
            MDTENPP VLPNGYVYS+K                           ALE+MAKKN+G+IT
Sbjct  1    MDTENPPQVLPNGYVYSSKVRFGVDQYWMSKILVYYFDLNLCSLWQALEEMAKKNNGKIT  60

Query  922  CPRTSFTCNYTDLVKAYIS  978
            CPRT F CNY DLVKAYIS
Sbjct  61   CPRTGFVCNYKDLVKAYIS  79



>ref|XP_010779450.1| PREDICTED: macrophage erythroblast attacher-like [Notothenia 
coriiceps]
Length=110

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 68/108 (63%), Gaps = 5/108 (5%)
 Frame = +1

Query  661  IIYMFVLTKYRLCYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDT  831
            +I++ +  +   CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+ 
Sbjct  4    LIFLNLNARSSQCYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNE  63

Query  832  ENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
             NPP++LPNGYVY   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  64   NNPPMMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  109



>ref|XP_001881100.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR08030.1| predicted protein [Laccaria bicolor S238N-H82]
Length=423

 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            +LA+ +P+S   +S +VC I+ ++MD +N P+  P+G+VYS +ALE+MA +NDG +TCPR
Sbjct  348  RLAEEVPFSHHANSTIVCRISGKIMDADNMPMAFPSGHVYSREALEEMAARNDGIVTCPR  407

Query  931  TSFTCNYTDLVKAYIS  978
            T  TC +T L K +IS
Sbjct  408  TGETCKFTALRKVFIS  423



>ref|XP_005829604.1| hypothetical protein GUITHDRAFT_111306 [Guillardia theta CCMP2712]
 gb|EKX42624.1| hypothetical protein GUITHDRAFT_111306 [Guillardia theta CCMP2712]
Length=384

 Score = 89.0 bits (219),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+      ++AQ LP +   HS LVC I+  +M+  NPP+ LPNG VYST+AL DMA  N
Sbjct  301  PVCHPVLAQIAQDLPIAHHMHSTLVCSISGAIMNEHNPPMALPNGNVYSTQALMDMAASN  360

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
             G++TCP++  T +++DL K YIS
Sbjct  361  MGQVTCPKSGDTYDFSDLRKVYIS  384



>ref|XP_007003204.1| hypothetical protein TREMEDRAFT_28694 [Tremella mesenterica DSM 
1558]
 gb|EIW70604.1| hypothetical protein TREMEDRAFT_28694 [Tremella mesenterica DSM 
1558]
Length=481

 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E+ + LA  +P S   +S +VC I+ E+MD++N P+  PNGYVYS  AL 
Sbjct  396  DC----PTCAENMKVLAAEVPLSHHMNSTIVCRISGEVMDSQNGPMAFPNGYVYSYNALA  451

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             MAK N G +TCPRT  TC +T L K YIS
Sbjct  452  AMAKNNFGIVTCPRTKETCQFTKLRKVYIS  481



>gb|KDR80093.1| hypothetical protein GALMADRAFT_222986 [Galerina marginata CBS 
339.88]
Length=406

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +1

Query  694  LCYEDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            +C  +  T   PL      KLA  +PYS   +S +VC I+ ++MD +N P+  P+G+VYS
Sbjct  315  VCDGESGTDSQPLG---LGKLAGEVPYSHHANSTIVCQISGKIMDEDNMPMAFPDGHVYS  371

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             +ALE+MA +N G +TCPRT  TC +++L K +IS
Sbjct  372  REALEEMAVRNGGIVTCPRTGKTCQFSELRKVFIS  406



>ref|XP_002741395.1| PREDICTED: macrophage erythroblast attacher-like [Saccoglossus 
kowalevskii]
Length=387

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  697  CYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYS  873
            CY DD    + P+  ++  +LA+PLP++    S+LVC+++ ++M+  NPP++LPNGYVY 
Sbjct  293  CYRDDSKNAECPVCNKNLNELAKPLPFAHCAQSRLVCFMSGQIMNEHNPPMMLPNGYVYG  352

Query  874  TKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
              +L  MA +NDG++TCPRT    +     K ++
Sbjct  353  QNSLRTMASENDGKVTCPRTKEAFDIDQAEKVFV  386



>ref|XP_006676318.1| hypothetical protein BATDEDRAFT_84764 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84048.1| hypothetical protein BATDEDRAFT_84764 [Batrachochytrium dendrobatidis 
JAM81]
Length=397

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  739  ESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRI  918
            ++F KLA+ LP S   +S +VC I+ ++MD +NPPLVLPNG VYST AL+D+A +NDG I
Sbjct  318  DTFGKLAEKLPCSHHVNSCVVCRISGKIMDADNPPLVLPNGQVYSTLALKDIASRNDGSI  377

Query  919  TCPRTSFTCNYTDLVKAYIS  978
             CP T  T + T+  KA+I+
Sbjct  378  LCPTTGATYHLTETRKAFIA  397


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  298  QVLFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTP  435
            ++LFD  QW  LV QFK +   L  +TL PLL++ LQAGL++LKTP
Sbjct  255  KLLFDESQWTNLVQQFKTDNYALNSLTLRPLLHMTLQAGLASLKTP  300



>ref|XP_006463289.1| hypothetical protein AGABI2DRAFT_207985 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45144.1| hypothetical protein AGABI2DRAFT_207985 [Agaricus bisporus var. 
bisporus H97]
Length=462

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            KLA+ +P+S   +S +VC IT ++MD +N P+  PNG VYS +A++DMA KN+  +TCPR
Sbjct  387  KLAEEVPFSHHFNSTIVCRITGKVMDGDNMPMAFPNGNVYSLEAMQDMAAKNNNFVTCPR  446

Query  931  TSFTCNYTDLVKAYIS  978
            T  TC +++L K +IS
Sbjct  447  TGTTCTFSELRKVFIS  462



>gb|KGB74540.1| hypothetical protein CNBG_0378 [Cryptococcus gattii R265]
Length=476

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E+ R LA  +P S   +S +VC I+ ++MD+EN PL  PNGYVYS+KAL 
Sbjct  391  DC----PTCDENMRVLAAEVPMSHHVNSTIVCRISGQVMDSENEPLAFPNGYVYSSKALA  446

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +MAK N   +TCPRT  +C +  L K YIS
Sbjct  447  EMAKNNFDVVTCPRTRESCAFGRLRKVYIS  476



>ref|XP_007332583.1| hypothetical protein AGABI1DRAFT_62820 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM76774.1| hypothetical protein AGABI1DRAFT_62820 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=462

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            KLA+ +P+S   +S +VC IT ++MD +N P+  PNG VYS +A++DMA KN+  +TCPR
Sbjct  387  KLAEEVPFSHHFNSTIVCRITGKVMDGDNMPMAFPNGNVYSLEAMQDMAAKNNNFVTCPR  446

Query  931  TSFTCNYTDLVKAYIS  978
            T  TC +++L K +IS
Sbjct  447  TGTTCTFSELRKVFIS  462



>gb|EFA81832.1| lissencephaly type-1-like motif-containing protein [Polysphondylium 
pallidum PN500]
Length=359

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +1

Query  703  EDDCTKED--PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYST  876
            ED+ TK    PL  E F+ LA+PLP S Q HS L+C IT E+MD +NPP+VLPNG VY  
Sbjct  266  EDEETKNINCPLCDEDFQSLAEPLPVSLQSHSSLICKITGEIMDEDNPPMVLPNGNVYCK  325

Query  877  KALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
             A+  MA + + +IT P++    +Y++L +A+IS
Sbjct  326  NAMLTMATEYNNQITDPKSGNKYDYSELRRAFIS  359



>ref|XP_566532.1| negative regulator of gluconeogenesis [Cryptococcus neoformans 
var. neoformans JEC21]
 ref|XP_778163.1| hypothetical protein CNBA1630 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL23516.1| hypothetical protein CNBA1630 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW40713.1| negative regulation of gluconeogenesis-related protein, putative 
[Cryptococcus neoformans var. neoformans JEC21]
Length=505

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E+ R LA  +P S   +S +VC I+ ++MD+EN PL  PNGYVYS+KAL 
Sbjct  420  DC----PTCDENMRVLASEVPMSHHVNSTIVCRISGQVMDSENEPLAFPNGYVYSSKALA  475

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +MAK N   +TCPRT  +C +  L K YIS
Sbjct  476  EMAKNNFDVVTCPRTRESCAFGRLRKVYIS  505



>gb|AFR92317.2| macrophage erythroblast attacher isoform 1 [Cryptococcus neoformans 
var. grubii H99]
Length=505

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E+ R LA  +P S   +S +VC I+  +MD+EN PL  PNGYVYS+KAL 
Sbjct  420  DC----PTCDENMRVLASEVPMSHHVNSTIVCRISGRVMDSENEPLAFPNGYVYSSKALA  475

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +MAK N   +TCPRT  +C +  L K YIS
Sbjct  476  EMAKNNFDVVTCPRTRESCAFGRLRKVYIS  505



>ref|XP_002469118.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED85630.1| predicted protein [Postia placenta Mad-698-R]
Length=318

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+   +  +LA+ +PYS   +S +VC ++ ++MD +N P+  PNGYVYS +ALE+MA ++
Sbjct  235  PVCDPNLGELAKEVPYSHHVNSTIVCRLSGKIMDADNMPMAFPNGYVYSKEALEEMALRD  294

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            DG +TCPRT   C +++L K +IS
Sbjct  295  DGYVTCPRTGDRCLFSELRKVFIS  318



>ref|XP_003192082.1| negative regulation of gluconeogenesis-related protein [Cryptococcus 
gattii WM276]
 gb|ADV20295.1| Negative regulation of gluconeogenesis-related protein, putative 
[Cryptococcus gattii WM276]
Length=505

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E+ R LA  +P S   +S +VC I+  +MD+EN PL  PNGYVYS+KAL 
Sbjct  420  DC----PTCDENMRVLAAEVPMSHHVNSTIVCRISGRVMDSENEPLAFPNGYVYSSKALA  475

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +MAK N   +TCPRT  +C +  L K YIS
Sbjct  476  EMAKNNFDVVTCPRTRESCAFGRLRKVYIS  505



>ref|XP_007847846.1| Macrophage erythroblast attacher [Moniliophthora roreri MCA 2997]
 gb|ESK92860.1| Macrophage erythroblast attacher [Moniliophthora roreri MCA 2997]
Length=406

 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            KLA+ +P +   +S +VC IT ++MD +N P+  PNGYVYS +A+E+MA KN G +TCPR
Sbjct  331  KLAEDVPLAHHANSTIVCQITGKIMDEDNMPMAFPNGYVYSREAMEEMAAKNGGTVTCPR  390

Query  931  TSFTCNYTDLVKAYIS  978
            T   C +  L K +IS
Sbjct  391  TGERCEFGKLRKVFIS  406



>ref|XP_002470255.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED84558.1| predicted protein [Postia placenta Mad-698-R]
Length=388

 Score = 86.7 bits (213),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+   +  +LA+ +PYS   +S +VC ++ ++MD +N P+  PNGYVYS +ALE+MA ++
Sbjct  305  PVCDPNLGELAKEVPYSHHVNSTIVCRMSGKIMDADNMPMAFPNGYVYSKEALEEMALRD  364

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            DG +TCPRT   C +++L K +IS
Sbjct  365  DGYVTCPRTGERCLFSELRKVFIS  388



>ref|XP_008303525.1| PREDICTED: macrophage erythroblast attacher-like, partial [Stegastes 
partitus]
Length=141

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  47   CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  106

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  107  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  140



>ref|XP_010897019.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Esox 
lucius]
Length=367

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +1

Query  667  YMFVLTKYRLCYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTEN  837
            +  ++ ++  CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  N
Sbjct  263  WKMLIQQFSQCYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENN  322

Query  838  PPLVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            PP++LPNGYVY   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  323  PPMMLPNGYVYGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  366



>emb|CDS03970.1| hypothetical protein LRAMOSA06925 [Absidia idahoensis var. thermophila]
Length=396

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  739  ESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRI  918
            ++  KLA+ LP+S   +S +VC I+ ++M+ +NPPL+LPNG VYS ++L DMA KNDG I
Sbjct  317  DTLGKLAESLPWSHHVNSTVVCRISGKIMNEDNPPLLLPNGRVYSYESLHDMAAKNDGLI  376

Query  919  TCPRTSFTCNYTDLVKAYIS  978
            TCPRT       D  K ++S
Sbjct  377  TCPRTGDVFQIEDTRKVFVS  396


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 14/108 (13%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYDYFFGLSNTVYSF  483
            L+D  +W+ L++QF+ +  KL  +T  PLL+I LQAGLSALKTP  Y++           
Sbjct  256  LYDPIRWNELIEQFRADNYKLCSLTSHPLLSITLQAGLSALKTPQCYNH-----------  304

Query  484  QSASSELSFPNQ*VLGFIA*NMPHGLWKSNANHMLTCSSITFL*RQDN  627
            +S +      +   LG +A ++P   W  + N  + C     +  +DN
Sbjct  305  ESRNVHCPVCDADTLGKLAESLP---WSHHVNSTVVCRISGKIMNEDN  349



>emb|CDH49414.1| protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=396

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  739  ESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRI  918
            ++  KLA+ LP+S   +S +VC I+ ++M+ +NPPL+LPNG VYS ++L DMA KNDG I
Sbjct  317  DTLGKLAETLPWSHHVNSTVVCRISGKIMNEDNPPLLLPNGRVYSYESLHDMAAKNDGVI  376

Query  919  TCPRTSFTCNYTDLVKAYIS  978
            TCPRT       D  K ++S
Sbjct  377  TCPRTGDVFRIEDTRKVFVS  396


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYDY  450
            L+D  +W+ L++QF+ +  KL  +T  PLL+I LQAGLSALKTP  Y++
Sbjct  256  LYDPIRWNELIEQFRADNYKLCSLTSHPLLSITLQAGLSALKTPQCYNH  304



>ref|XP_007392873.1| hypothetical protein PHACADRAFT_251198 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM57524.1| hypothetical protein PHACADRAFT_251198 [Phanerochaete carnosa 
HHB-10118-sp]
Length=399

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLP-NGYVYSTKALEDMAKKNDGRITCPR  930
            LA+ +P+S   +S +VC +  ++MD  N PL  P NG+VYS +ALEDMA  NDG +TCPR
Sbjct  324  LAKEVPFSHHVNSTIVCRLAGKIMDENNFPLAFPKNGHVYSKEALEDMAAINDGTVTCPR  383

Query  931  TSFTCNYTDLVKAYIS  978
            T  TC++T+L K +IS
Sbjct  384  TKETCHFTELRKVFIS  399



>gb|EPZ35350.1| CTLH/CRAto LisH motif domain-containing protein [Rozella allomycis 
CSF55]
Length=377

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+      K A  LP +   +S++VC I+  +MD  NPPL+LPNG VYSTKAL +MA  +
Sbjct  294  PVCNHEISKFASKLPCAHHINSRIVCRISGLVMDEHNPPLMLPNGKVYSTKALTEMANVS  353

Query  907  DGRITCPRTSFTCNYTDLVKAYI  975
            +G+ITCPRT     ++DL K Y+
Sbjct  354  EGKITCPRTGSVYQFSDLRKCYV  376



>gb|KDN47068.1| hypothetical protein RSAG8_03845, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=138

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +1

Query  739  ESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRI  918
            +    LA+ +P+S   +S +VC IT ++MD +NPPL LPNG VYS +ALE+ A KN+G++
Sbjct  59   DGLGVLAKEVPWSHHVNSVIVCRITGKIMDGDNPPLCLPNGQVYSQRALEEQAAKNNGQV  118

Query  919  TCPRTSFTCNYTDLVKAYIS  978
            TCP+T    ++    K +IS
Sbjct  119  TCPKTGDVFSFQQTKKMFIS  138



>ref|XP_005994962.1| PREDICTED: macrophage erythroblast attacher [Latimeria chalumnae]
Length=318

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  224  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  283

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  284  YGYNSL--LSIRQDEKVVCPRTKEVFNFSQAEKVYI  317



>ref|XP_005919513.1| PREDICTED: macrophage erythroblast attacher-like isoform X3 [Haplochromis 
burtoni]
Length=348

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  254  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  347



>ref|XP_002910556.1| macrophage erythroblast attacher isoform 1 [Coprinopsis cinerea 
okayama7#130]
 gb|EFI27062.1| macrophage erythroblast attacher isoform 1 [Coprinopsis cinerea 
okayama7#130]
Length=407

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  751  KLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPR  930
            KLA+ +P+S   +S +VC I+ ++MD  NPP+  PNG VYS +AL DMA+KNDG + CPR
Sbjct  333  KLAEEVPFSHHSNSTIVCRISGKIMDENNPPMAFPNGRVYSLEALTDMAEKNDGVVICPR  392

Query  931  TSFTCNYTDLVKAYI  975
            T     + +L K +I
Sbjct  393  TGDRALFRELKKVFI  407



>ref|XP_005726520.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005919512.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Haplochromis 
burtoni]
Length=355

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  261  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  354



>emb|CEI98702.1| Putative Macrophage erythroblast attacher isoform 1 [Rhizopus 
microsporus]
Length=209

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 2/100 (2%)
 Frame = +1

Query  685  KYRLCYEDDCTKED-PLSQES-FRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPN  858
            K + CYE +    + P+   S   KLA+ LP S   +S +VC I+ ++M+  NPP++LPN
Sbjct  110  KTQQCYEHENQNVNCPICDNSTLGKLAEKLPLSHHVNSTIVCRISGKIMNENNPPMLLPN  169

Query  859  GYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            G VYS  AL++MA KND ++ CPRT     + +L K +IS
Sbjct  170  GRVYSFNALKEMADKNDNKVICPRTGDVFKFKELKKVFIS  209



>ref|XP_003970622.1| PREDICTED: macrophage erythroblast attacher-like isoform 2 [Takifugu 
rubripes]
Length=355

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  261  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  354



>ref|XP_009863794.1| PREDICTED: macrophage erythroblast attacher [Apaloderma vittatum]
Length=132

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  38   CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  97

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  98   YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  131



>ref|XP_007896147.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Callorhinchus 
milii]
Length=348

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  254  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D +I CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKIICPRTKEVYNFSQAEKVYI  347



>ref|XP_008324781.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Cynoglossus 
semilaevis]
Length=348

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  254  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  347



>emb|CAF96979.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=372

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  278  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  337

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  338  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  371



>emb|CCO30427.1| Macrophage erythroblast attacher [Rhizoctonia solani AG-1 IB]
Length=397

 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LA+ +P+S   +S +VC IT ++MD +NPPL LPNG VYS KALE+ A KN+G++TCP+T
Sbjct  323  LAKEVPWSHHINSVIVCRITGKIMDGDNPPLCLPNGQVYSQKALEEQAAKNNGQVTCPKT  382

Query  934  SFTCNYTDLVKAYIS  978
                ++ +  K +IS
Sbjct  383  GDVFSFEETKKMFIS  397



>ref|XP_007896146.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Callorhinchus 
milii]
Length=380

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  286  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  345

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D +I CPRT    N++   K YI
Sbjct  346  YGYNSL--LSIRQDDKIICPRTKEVYNFSQAEKVYI  379



>ref|XP_008290979.1| PREDICTED: macrophage erythroblast attacher [Stegastes partitus]
Length=396

 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>ref|XP_007233092.1| PREDICTED: macrophage erythroblast attacher-like [Astyanax mexicanus]
Length=397

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  303  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  362

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  363  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  396



>ref|XP_003443485.1| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Oreochromis 
niloticus]
 ref|XP_004553658.1| PREDICTED: macrophage erythroblast attacher-like [Maylandia zebra]
 ref|XP_005726519.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005919511.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_006804596.1| PREDICTED: macrophage erythroblast attacher-like [Neolamprologus 
brichardi]
 ref|XP_010741235.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Larimichthys 
crocea]
 ref|XP_010741236.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Larimichthys 
crocea]
Length=396

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>ref|XP_008324780.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Cynoglossus 
semilaevis]
Length=378

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  284  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  343

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  344  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  377



>ref|XP_003970621.1| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Takifugu 
rubripes]
Length=396

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>ref|XP_010897011.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Esox 
lucius]
Length=396

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_007896145.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Callorhinchus 
milii]
Length=396

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D +I CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKIICPRTKEVYNFSQAEKVYI  395



>sp|Q7SXR3.2|MAEA_DANRE RecName: Full=Macrophage erythroblast attacher [Danio rerio]
Length=396

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|NP_955843.1| macrophage erythroblast attacher [Danio rerio]
 gb|AAH55388.1| Macrophage erythroblast attacher [Danio rerio]
Length=385

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  291  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  350

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  351  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  384



>ref|XP_008324779.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Cynoglossus 
semilaevis]
Length=396

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_007771440.1| hypothetical protein CONPUDRAFT_108277 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW78394.1| hypothetical protein CONPUDRAFT_108277 [Coniophora puteana RWD-64-598 
SS2]
Length=398

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LA+ +P+S   +S +VC I  ++MD +NPP+  PNG VYS  +LE+MA K +G++ CP T
Sbjct  324  LAKDVPFSHHTNSTIVCRINGKIMDEDNPPMAFPNGQVYSRDSLEEMASKKNGKVICPHT  383

Query  934  SFTCNYTDLVKAYIS  978
             +TC  + L K +IS
Sbjct  384  GYTCELSALKKVFIS  398



>ref|XP_003287656.1| hypothetical protein DICPUDRAFT_151775 [Dictyostelium purpureum]
 gb|EGC35819.1| hypothetical protein DICPUDRAFT_151775 [Dictyostelium purpureum]
Length=391

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            PL  E++RKLA  LP S Q HS LVC I+ E+M+ EN P+VLPNG VYS  +L +M +K 
Sbjct  309  PLCDEAWRKLAISLPVSLQSHSSLVCRISGEIMNDENYPMVLPNGNVYSKNSLVEMREK-  367

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
             G+I  PRT     + +L +A+IS
Sbjct  368  QGKIIDPRTGDEFKFDELKRAFIS  391



>ref|XP_009488266.1| PREDICTED: macrophage erythroblast attacher [Pelecanus crispus]
Length=157

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  63   CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  122

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  123  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  156



>ref|XP_003383314.1| PREDICTED: macrophage erythroblast attacher-like [Amphimedon 
queenslandica]
Length=396

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+  E F  LA  LPYS    S L+C I+ E M+  NPP++LPNGYVY  +AL  M++ N
Sbjct  313  PVCSELFNDLASVLPYSHSSQSYLICNISGEPMNEHNPPMMLPNGYVYGEQALLRMSESN  372

Query  907  DGRITCPRTSFTCNYTDLVKAYI  975
             G I CPRTS +  Y+ + K ++
Sbjct  373  GGMIKCPRTSESFQYSSIKKVFV  395



>ref|XP_007439291.1| PREDICTED: macrophage erythroblast attacher [Python bivittatus]
Length=348

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D R+ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSVRQDDRVICPRTKEVFNFSQAEKVYI  347



>ref|XP_004073063.1| PREDICTED: macrophage erythroblast attacher-like isoform 2 [Oryzias 
latipes]
Length=355

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  354



>ref|XP_009502805.1| PREDICTED: macrophage erythroblast attacher, partial [Phalacrocorax 
carbo]
 ref|XP_009969985.1| PREDICTED: macrophage erythroblast attacher, partial [Tyto alba]
Length=180

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  86   CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  145

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  146  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  179



>emb|CEJ05334.1| hypothetical protein RMCBS344292_19277 [Rhizopus microsporus]
Length=358

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  742  SFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRIT  921
            +  KLA+ LP S   +S +VC I+ ++M+ +NPP++LPNG VYS  AL++MA KND ++ 
Sbjct  280  TLGKLAEKLPLSHHVNSTIVCRISGKIMNEDNPPMLLPNGRVYSFNALKEMADKNDNKVI  339

Query  922  CPRTSFTCNYTDLVKAYIS  978
            CPRT     + +L K +IS
Sbjct  340  CPRTGDVFKFKELKKVFIS  358



>ref|NP_001007963.1| macrophage erythroblast attacher [Xenopus (Silurana) tropicalis]
 gb|AAH80474.1| macrophage erythroblast attacher [Xenopus (Silurana) tropicalis]
Length=348

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  347



>ref|XP_004073062.1| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Oryzias 
latipes]
Length=396

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>emb|CDQ74752.1| unnamed protein product [Oncorhynchus mykiss]
Length=396

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T  +P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDSTSINPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_638565.2| hypothetical protein DDB_G0284463 [Dictyostelium discoideum AX4]
 gb|EAL65211.2| hypothetical protein DDB_G0284463 [Dictyostelium discoideum AX4]
Length=423

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            PL   SFR LA  LP S Q HS LVC IT E+M+ +N P+VLPNG V+S +A+ DM KK 
Sbjct  341  PLCDPSFRALATSLPVSLQSHSSLVCRITGEIMNEDNYPMVLPNGNVFSKRAIIDMYKKQ  400

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
            D +I  PR+       DL +AYIS
Sbjct  401  D-KIIDPRSGNEYKLEDLKRAYIS  423



>ref|XP_008938588.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Merops 
nubicus]
 ref|XP_009998536.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Chaetura 
pelagica]
Length=280

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  186  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  245

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  246  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  279



>gb|EJT45337.1| negative regulator of gluconeogenesis [Trichosporon asahii var. 
asahii CBS 2479]
Length=497

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P   E  R LA+ +P +   +S LVC I+ ++MD++N PL  PNG VYS+KAL +MAK N
Sbjct  414  PTCAEDVRILAREVPMAHHVNSTLVCRISGDVMDSDNVPLAFPNGCVYSSKALAEMAKNN  473

Query  907  DGRITCPRTSFTCNYTDLVKAYIS  978
                 CPRT  TC ++ L K YIS
Sbjct  474  FDVCICPRTHETCGFSKLRKVYIS  497



>gb|EMC83044.1| Macrophage erythroblast attacher, partial [Columba livia]
Length=246

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  152  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  211

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  212  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  245



>ref|XP_010147680.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Eurypyga 
helias]
Length=280

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  186  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  245

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  246  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  279



>ref|NP_001085357.2| macrophage erythroblast attacher [Xenopus laevis]
 sp|Q6GR10.2|MAEA_XENLA RecName: Full=Macrophage erythroblast attacher [Xenopus laevis]
Length=396

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPLAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>gb|AAH71124.1| MGC81431 protein [Xenopus laevis]
Length=385

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  291  CYKEDGTSKNPDCPVCSKSLNKLAQPLPLAHCANSRLVCKISGDVMNENNPPMMLPNGYV  350

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  351  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  384



>ref|XP_008938587.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Merops 
nubicus]
 ref|XP_009998535.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Chaetura 
pelagica]
Length=307

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  213  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  272

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  273  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  306



>ref|XP_008919197.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Manacus 
vitellinus]
 ref|XP_009070541.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Acanthisitta 
chloris]
 ref|XP_009469981.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Nipponia 
nippon]
 ref|XP_009579304.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Fulmarus 
glacialis]
 ref|XP_009647159.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Egretta 
garzetta]
 ref|XP_009820599.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Gavia 
stellata]
 ref|XP_009880833.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Charadrius 
vociferus]
 ref|XP_009933061.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Opisthocomus 
hoazin]
 ref|XP_010017716.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Nestor 
notabilis]
 ref|XP_010132460.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Buceros 
rhinoceros silvestris]
 ref|XP_010076883.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Pterocles 
gutturalis]
 ref|XP_010121334.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Chlamydotis 
macqueenii]
 ref|XP_010203854.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Colius 
striatus]
 ref|XP_010280568.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Phaethon 
lepturus]
 ref|XP_010307045.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Balearica 
regulorum gibbericeps]
Length=280

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  186  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  245

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  246  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  279



>gb|KFZ61624.1| Macrophage erythroblast attacher, partial [Podiceps cristatus]
Length=284

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  190  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  249

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  250  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  283



>ref|XP_002676279.1| predicted protein [Naegleria gruberi]
 gb|EFC43535.1| predicted protein [Naegleria gruberi]
Length=433

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  EDDCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKA  882
            E+     DPLS   F++LA+ LP++  HHSKLVC I  ++MD  NPPLV PNG VYS K 
Sbjct  342  ENSINVNDPLSHPLFKELAKDLPFAHHHHSKLVCSICGDIMDHLNPPLVFPNGNVYSQKG  401

Query  883  LEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            + +   KN+G    PR   +    D  K +I
Sbjct  402  VAENMAKNNGTFVDPRDGKSFQEEDGKKLFI  432


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  304  LFDAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYPYD  447
            L+D K+WD LV++F +E  KLYGMT E  L   L+AGLSALKTPY YD
Sbjct  294  LYDDKRWDELVEEFNKENYKLYGMTEEATLFKLLKAGLSALKTPYSYD  341



>gb|EUC59117.1| macrophage erythroblast attacher [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP52761.1| macrophage erythroblast attacher [Rhizoctonia solani 123E]
Length=452

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LA+ +P+S   +S +VC IT ++MD +NPPL LPNG VYS +ALE+ A KN+G++TCP+T
Sbjct  378  LAKEVPWSHHVNSVIVCRITGKIMDGDNPPLCLPNGQVYSQRALEEQAAKNNGQVTCPKT  437

Query  934  SFTCNYTDLVKAYIS  978
                ++    K +IS
Sbjct  438  GDVFSFQQTKKMFIS  452



>ref|XP_010165175.1| PREDICTED: macrophage erythroblast attacher, partial [Caprimulgus 
carolinensis]
Length=282

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  188  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  247

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  248  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  281



>gb|KFZ50296.1| Macrophage erythroblast attacher, partial [Caprimulgus carolinensis]
Length=284

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  190  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  249

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  250  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  283



>ref|XP_010147679.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Eurypyga 
helias]
Length=307

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  213  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  272

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  273  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  306



>emb|CEG70497.1| hypothetical protein RMATCC62417_06384 [Rhizopus microsporus]
Length=393

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  742  SFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRIT  921
            +  KLA+ LP S   +S +VC I+ ++M+  NPP++LPNG VYS  AL++MA KND ++ 
Sbjct  315  TLGKLAEKLPLSHHVNSTIVCRISGKIMNENNPPMLLPNGRVYSFNALKEMADKNDNKVI  374

Query  922  CPRTSFTCNYTDLVKAYIS  978
            CPRT     + +L K +IS
Sbjct  375  CPRTGDVFKFKELKKVFIS  393



>gb|EMD35442.1| hypothetical protein CERSUDRAFT_116204 [Ceriporiopsis subvermispora 
B]
Length=399

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +1

Query  697  CYEDDCTKED-PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLP-NGYVY  870
            CY+ +    D P+      +LAQ +P+S   +S +VC +  ++MD +N P+  P +G VY
Sbjct  304  CYDPETRNADCPICDPDLGRLAQEVPFSHHVNSTIVCRLNGKIMDADNMPMAFPQSGQVY  363

Query  871  STKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            S +AL +MA KNDG +TCPRT   C ++ L K +IS
Sbjct  364  SKEALGEMAAKNDGFVTCPRTGEQCEFSALRKVFIS  399



>ref|XP_006629704.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Lepisosteus 
oculatus]
Length=355

 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  261  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVICPRTKEVFSFSQAEKVYI  354



>ref|XP_008919195.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Manacus 
vitellinus]
 ref|XP_009070468.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Acanthisitta 
chloris]
 ref|XP_009469980.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Nipponia 
nippon]
 ref|XP_009579303.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Fulmarus 
glacialis]
 ref|XP_009647158.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Egretta 
garzetta]
 ref|XP_009820597.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Gavia 
stellata]
 ref|XP_009880832.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Charadrius 
vociferus]
 ref|XP_009933060.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Opisthocomus 
hoazin]
 ref|XP_010017715.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Nestor 
notabilis]
 ref|XP_010132459.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Buceros 
rhinoceros silvestris]
 ref|XP_010076876.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Pterocles 
gutturalis]
 ref|XP_010121326.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Chlamydotis 
macqueenii]
 ref|XP_010203853.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Colius 
striatus]
 ref|XP_010280567.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Phaethon 
lepturus]
 ref|XP_010307044.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Balearica 
regulorum gibbericeps]
Length=307

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  213  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  272

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  273  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  306



>ref|XP_006874175.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Chrysochloris 
asiatica]
Length=328

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +1

Query  688  YRLCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPP  843
            + L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP
Sbjct  226  WPLGHQDSCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPP  285

Query  844  LVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            ++LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  286  MMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  327



>ref|XP_002117764.1| hypothetical protein TRIADDRAFT_32981 [Trichoplax adhaerens]
 gb|EDV19740.1| hypothetical protein TRIADDRAFT_32981 [Trichoplax adhaerens]
Length=405

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+   +F ++A+ LP+S   HS+LVC I+ E M+  NPP++LPNG VYS KAL  +A  N
Sbjct  322  PICSSNFNEIARTLPFSHCSHSRLVCRISGEEMNGNNPPMMLPNGMVYSEKALLKLADSN  381

Query  907  DGRITCPRTSFTCNYTDLVKAYI  975
             G + CPRT+ +  +++L + ++
Sbjct  382  HGTVICPRTNTSYPFSELKRVFL  404



>ref|XP_005427936.1| PREDICTED: macrophage erythroblast attacher [Geospiza fortis]
 ref|XP_008938586.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Merops 
nubicus]
 ref|XP_009998534.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Chaetura 
pelagica]
Length=348

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  347



>gb|KDR16975.1| Macrophage erythroblast attacher [Zootermopsis nevadensis]
Length=397

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  727  PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKN  906
            P+ Q+SF +LAQPLP++    S+LVC I+   ++  N P++LPNGYVY  KALE MA +N
Sbjct  314  PVCQDSFNELAQPLPFAHCSQSRLVCTISGLPLNEHNLPMMLPNGYVYGEKALEQMANEN  373

Query  907  DGRITCPRTSFTCNYTDLVKAYI  975
            + +I CP+T     +  L K ++
Sbjct  374  NSQIICPKTKEVYPFKKLEKVFV  396



>gb|KDQ20772.1| hypothetical protein BOTBODRAFT_26790 [Botryobasidium botryosum 
FD-172 SS1]
Length=402

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +1

Query  697  CYEDDCTKED---PLSQE-SFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLP-NG  861
            CYE D   ++   P+  E    +LA+ +P+S   +S +VC IT ++MD EN P+  P  G
Sbjct  304  CYERDAKAKNVDCPVCDERGLGELAREVPWSHHVNSVIVCRITGKIMDDENYPMCFPVQG  363

Query  862  YVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            YVYS +A+E MA +N+GR+TC  T  TC +++L K +IS
Sbjct  364  YVYSREAMEAMAAENNGRVTCRETKETCLFSELRKVFIS  402



>ref|XP_003773500.1| PREDICTED: macrophage erythroblast attacher isoform 2 [Sarcophilus 
harrisii]
Length=355

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  354



>ref|XP_008643326.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Corvus 
brachyrhynchos]
 ref|XP_009097001.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Serinus 
canaria]
Length=317

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  223  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  282

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  283  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  316



>ref|XP_009554301.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Cuculus 
canorus]
 ref|XP_009902511.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Picoides 
pubescens]
 ref|XP_009990130.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Tauraco 
erythrolophus]
 ref|XP_010188312.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Mesitornis 
unicolor]
Length=328

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  234  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  293

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  294  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  327



>ref|XP_008118396.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Anolis 
carolinensis]
Length=348

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSVRQDDKVICPRTKEVFNFSQAEKVYI  347



>emb|CDQ85287.1| unnamed protein product [Oncorhynchus mykiss]
Length=396

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFSFSQAEKVYI  395



>ref|XP_006629703.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Lepisosteus 
oculatus]
Length=396

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D T ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  302  CYKEDGTSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFSFSQAEKVYI  395



>gb|KFP59366.1| Macrophage erythroblast attacher, partial [Cathartes aura]
Length=350

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  256  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  315

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  316  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  349



>ref|XP_010147678.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Eurypyga 
helias]
Length=348

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  347



>ref|XP_005016192.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Anas 
platyrhynchos]
 ref|XP_005490890.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Zonotrichia 
albicollis]
 ref|XP_005509995.1| PREDICTED: macrophage erythroblast attacher [Columba livia]
 ref|XP_006038729.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Alligator 
sinensis]
 ref|XP_008643324.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Corvus 
brachyrhynchos]
 ref|XP_008919194.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Manacus 
vitellinus]
 ref|XP_009070395.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Acanthisitta 
chloris]
 ref|XP_009096984.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Serinus 
canaria]
 ref|XP_009327054.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Pygoscelis 
adeliae]
 ref|XP_009469979.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Nipponia 
nippon]
 ref|XP_009579302.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Fulmarus 
glacialis]
 ref|XP_009684406.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Struthio 
camelus australis]
 ref|XP_009647157.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Egretta 
garzetta]
 ref|XP_009820596.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Gavia 
stellata]
 ref|XP_009880830.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Charadrius 
vociferus]
 ref|XP_009922132.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009933059.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Opisthocomus 
hoazin]
 ref|XP_010132458.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Buceros 
rhinoceros silvestris]
 ref|XP_010076868.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Pterocles 
gutturalis]
 ref|XP_010121318.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Chlamydotis 
macqueenii]
 ref|XP_010203852.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Colius 
striatus]
 ref|XP_010221935.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Tinamus 
guttatus]
 ref|XP_010280566.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Phaethon 
lepturus]
 ref|XP_010307043.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Balearica 
regulorum gibbericeps]
 ref|XP_010400358.1| PREDICTED: macrophage erythroblast attacher [Corvus cornix cornix]
 ref|XP_010400359.1| PREDICTED: macrophage erythroblast attacher [Corvus cornix cornix]
 ref|XP_010400360.1| PREDICTED: macrophage erythroblast attacher [Corvus cornix cornix]
 ref|XP_010400361.1| PREDICTED: macrophage erythroblast attacher [Corvus cornix cornix]
 ref|XP_010708925.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Meleagris 
gallopavo]
 ref|XP_010708926.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Meleagris 
gallopavo]
 ref|XP_010708927.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Meleagris 
gallopavo]
Length=348

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  254  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  313

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  314  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  347



>ref|XP_009201271.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Papio 
anubis]
Length=328

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +1

Query  688  YRLCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPP  843
            + L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP
Sbjct  226  WPLSHQDTCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPP  285

Query  844  LVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            ++LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  286  MMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  327



>ref|XP_008643325.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Corvus 
brachyrhynchos]
 ref|XP_009096992.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Serinus 
canaria]
Length=344

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  250  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  309

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  310  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  343



>ref|XP_010373641.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Rhinopithecus 
roxellana]
Length=328

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +1

Query  688  YRLCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPP  843
            + L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP
Sbjct  226  WPLSHQDACYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPP  285

Query  844  LVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            ++LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  286  MMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  327



>ref|NP_001284360.1| macrophage erythroblast attacher isoform 4 [Homo sapiens]
Length=328

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +1

Query  688  YRLCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPP  843
            + L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP
Sbjct  226  WPLSHQDTCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPP  285

Query  844  LVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            ++LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  286  MMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  327



>gb|EKD00291.1| negative regulator of gluconeogenesis [Trichosporon asahii var. 
asahii CBS 8904]
Length=622

 Score = 81.6 bits (200),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query  709  DCTKEDPLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALE  888
            DC    P   E  R LA+ +P +   +S LVC I+ ++MD++N PL  PNG VYS+KAL 
Sbjct  537  DC----PTCAEDVRILAREVPMAHHVNSTLVCRISGDVMDSDNVPLAFPNGCVYSSKALA  592

Query  889  DMAKKNDGRITCPRTSFTCNYTDLVKAYIS  978
            +MAK N     CPRT  TC ++ L K YIS
Sbjct  593  EMAKNNFDVCICPRTHETCGFSKLRKVYIS  622



>ref|XP_005490889.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Zonotrichia 
albicollis]
Length=355

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  354



>dbj|BAB14072.1| unnamed protein product [Homo sapiens]
Length=328

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +1

Query  688  YRLCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPP  843
            + L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP
Sbjct  226  WPLSHQDTCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPP  285

Query  844  LVLPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            ++LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  286  MMLPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  327



>ref|XP_006122969.1| PREDICTED: macrophage erythroblast attacher isoform X6 [Pelodiscus 
sinensis]
Length=379

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  285  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  344

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  345  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  378



>ref|XP_005045610.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Ficedula 
albicollis]
 ref|XP_005148601.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Melopsittacus 
undulatus]
 ref|XP_005229898.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Falco 
peregrinus]
 ref|XP_005446445.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Falco 
cherrug]
 ref|XP_007063761.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Chelonia 
mydas]
 ref|XP_008500076.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Calypte 
anna]
 ref|XP_009554300.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Cuculus 
canorus]
 ref|XP_009902510.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Picoides 
pubescens]
 ref|XP_009990128.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Tauraco 
erythrolophus]
 ref|XP_010188311.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Mesitornis 
unicolor]
Length=355

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  354



>ref|XP_005517965.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Pseudopodoces 
humilis]
Length=355

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  354



>ref|XP_005016191.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Anas 
platyrhynchos]
Length=355

 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  261  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  320

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  321  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  354



>ref|XP_001365484.1| PREDICTED: macrophage erythroblast attacher [Monodelphis domestica]
 ref|XP_003773499.1| PREDICTED: macrophage erythroblast attacher isoform 1 [Sarcophilus 
harrisii]
Length=396

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  395



>gb|EOB03758.1| Macrophage erythroblast attacher, partial [Anas platyrhynchos]
Length=375

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  281  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  340

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  341  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  374



>gb|KFU91590.1| Macrophage erythroblast attacher, partial [Chaetura pelagica]
Length=411

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVVCPRTKEVFNFSQAEKVYI  410



>ref|XP_005292466.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Chrysemys 
picta bellii]
Length=386

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  292  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  351

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  352  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  385



>ref|XP_010708924.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Meleagris 
gallopavo]
Length=388

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  294  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  353

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  354  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  387



>ref|XP_003227109.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Anolis 
carolinensis]
Length=396

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSVRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_008991974.1| PREDICTED: macrophage erythroblast attacher-like [Callithrix 
jacchus]
Length=201

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 5/99 (5%)
 Frame = +1

Query  688  YRLCYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPN  858
            +R CY++D + + P   +   S  KLAQPLP +   +S+LVC I+ ++M+  NPP +LPN
Sbjct  104  HRQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPRMLPN  163

Query  859  GYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            GYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  164  GYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  200



>ref|XP_010221934.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Tinamus 
guttatus]
Length=386

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  292  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  351

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  352  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  385



>ref|XP_006038728.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Alligator 
sinensis]
Length=386

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  292  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  351

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  352  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  385



>ref|XP_009283698.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Aptenodytes 
forsteri]
 ref|XP_009327055.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Pygoscelis 
adeliae]
 ref|XP_009684405.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Struthio 
camelus australis]
 ref|XP_009922130.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Haliaeetus 
albicilla]
Length=386

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  292  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  351

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  352  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  385



>gb|EAW82590.1| macrophage erythroblast attacher, isoform CRA_d [Homo sapiens]
 gb|EAW82592.1| macrophage erythroblast attacher, isoform CRA_d [Homo sapiens]
Length=317

 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 10/102 (10%)
 Frame = +1

Query  694  LCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLV  849
            L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP++
Sbjct  217  LSHQDTCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMM  276

Query  850  LPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            LPNGYVY   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  277  LPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFHFSQAEKVYI  316



>gb|ELU43420.1| macrophage erythroblast attacher isoform 1 [Rhizoctonia solani 
AG-1 IA]
Length=863

 Score = 81.3 bits (199),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  754  LAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYVYSTKALEDMAKKNDGRITCPRT  933
            LA+ +P+S   +S +VC IT ++MD +NPPL LPNG VYS KALE+ A +N+G++TCP+T
Sbjct  757  LAKEVPWSHHINSVIVCRITGKIMDGDNPPLCLPNGQVYSQKALEEQAARNNGQVTCPKT  816

Query  934  SFTCNYTDLVKAYIS  978
                ++    K +IS
Sbjct  817  GDVFSFQQTKKMFIS  831



>ref|XP_005517964.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Pseudopodoces 
humilis]
Length=396

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_008149139.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Eptesicus 
fuscus]
Length=328

 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = +1

Query  694  LCYEDDCTKED--------PLSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLV  849
            L ++D C KED        P+   S  KLAQPLP +   +S+LVC I+ ++M+  NPP++
Sbjct  228  LGHQDSCYKEDGSSRSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMM  287

Query  850  LPNGYVYSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            LPNGYVY   +L  ++ + D ++ CPRT     ++   K YI
Sbjct  288  LPNGYVYGYNSL--LSIRQDDKVVCPRTKEVFRFSQAEKVYI  327



>ref|NP_001012622.1| macrophage erythroblast attacher [Gallus gallus]
 ref|XP_003206056.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Meleagris 
gallopavo]
 ref|XP_005045609.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Ficedula 
albicollis]
 ref|XP_005148600.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005229897.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Falco 
peregrinus]
 ref|XP_005292465.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Chrysemys 
picta bellii]
 ref|XP_005446444.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Falco 
cherrug]
 ref|XP_006276444.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Alligator 
mississippiensis]
 ref|XP_007063760.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Chelonia 
mydas]
 ref|XP_008500075.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Calypte 
anna]
 ref|XP_009283697.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Aptenodytes 
forsteri]
 ref|XP_009554299.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Cuculus 
canorus]
 ref|XP_009902509.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Picoides 
pubescens]
 ref|XP_009990127.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Tauraco 
erythrolophus]
 ref|XP_010188310.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Mesitornis 
unicolor]
 ref|XP_010575857.1| PREDICTED: macrophage erythroblast attacher isoform X3 [Haliaeetus 
leucocephalus]
 sp|Q5F398.1|MAEA_CHICK RecName: Full=Macrophage erythroblast attacher [Gallus gallus]
 emb|CAH65386.1| hypothetical protein RCJMB04_26n5 [Gallus gallus]
Length=396

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_008643323.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Corvus 
brachyrhynchos]
 ref|XP_009096976.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Serinus 
canaria]
Length=385

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  291  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  350

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  351  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  384



>ref|XP_005490888.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Zonotrichia 
albicollis]
Length=396

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  302  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  361

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  362  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  395



>ref|XP_006122967.1| PREDICTED: macrophage erythroblast attacher isoform X4 [Pelodiscus 
sinensis]
Length=420

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  326  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  385

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  386  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  419



>ref|XP_010017714.1| PREDICTED: macrophage erythroblast attacher isoform X1 [Nestor 
notabilis]
Length=385

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  291  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  350

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  351  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  384



>gb|KFW07742.1| Macrophage erythroblast attacher, partial [Fulmarus glacialis]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFO13991.1| Macrophage erythroblast attacher, partial [Balearica regulorum 
gibbericeps]
 gb|KFQ07994.1| Macrophage erythroblast attacher, partial [Haliaeetus albicilla]
 gb|KFQ71325.1| Macrophage erythroblast attacher, partial [Phaethon lepturus]
 gb|KFW70431.1| Macrophage erythroblast attacher, partial [Pygoscelis adeliae]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFV86996.1| Macrophage erythroblast attacher, partial [Struthio camelus australis]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFO88535.1| Macrophage erythroblast attacher, partial [Buceros rhinoceros 
silvestris]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>ref|XP_006122968.1| PREDICTED: macrophage erythroblast attacher isoform X5 [Pelodiscus 
sinensis]
Length=414

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  320  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  379

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  380  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  413



>ref|XP_005816591.1| PREDICTED: macrophage erythroblast attacher-like, partial [Xiphophorus 
maculatus]
Length=373

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ E+M+  NPP++LPNGYV
Sbjct  279  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYV  338

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    +++   K YI
Sbjct  339  YGYNSL--LSIRQDDKVVCPRTKEVFSFSQAEKVYI  372



>gb|KFQ54041.1| Macrophage erythroblast attacher, partial [Nestor notabilis]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KGL83442.1| Macrophage erythroblast attacher, partial [Tinamus guttatus]
Length=413

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  319  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  378

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  379  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  412



>ref|XP_009283695.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Aptenodytes 
forsteri]
 ref|XP_010575848.1| PREDICTED: macrophage erythroblast attacher isoform X2 [Haliaeetus 
leucocephalus]
Length=426

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  332  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  391

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  392  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  425



>gb|KFR10848.1| Macrophage erythroblast attacher, partial [Opisthocomus hoazin]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFP69191.1| Macrophage erythroblast attacher, partial [Acanthisitta chloris]
Length=411

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFP11159.1| Macrophage erythroblast attacher, partial [Egretta garzetta]
 gb|KFW78501.1| Macrophage erythroblast attacher, partial [Manacus vitellinus]
Length=413

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  319  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  378

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  379  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  412



>gb|KFW03170.1| Macrophage erythroblast attacher, partial [Eurypyga helias]
Length=411

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFV40778.1| Macrophage erythroblast attacher, partial [Gavia stellata]
 gb|KGL91272.1| Macrophage erythroblast attacher, partial [Charadrius vociferus]
Length=411

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  317  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  376

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  377  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  410



>gb|KFR04543.1| Macrophage erythroblast attacher, partial [Nipponia nippon]
Length=413

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +1

Query  697  CYEDDCTKEDP---LSQESFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPLVLPNGYV  867
            CY++D + ++P   +  +S  KLAQPLP +   +S+LVC I+ ++M+  NPP++LPNGYV
Sbjct  319  CYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV  378

Query  868  YSTKALEDMAKKNDGRITCPRTSFTCNYTDLVKAYI  975
            Y   +L  ++ + D ++ CPRT    N++   K YI
Sbjct  379  YGYNSL--LSIRQDDKVICPRTKEVFNFSQAEKVYI  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4223647644888