BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13851_g2_i1 len=442 path=[420:0-37 458:38-441]

Length=442
                                                                      Score     E

ref|XP_002276934.1|  PREDICTED: outer envelope pore protein 16-2,...    158   1e-45   Vitis vinifera
ref|XP_002314929.1|  mitochondrial import inner membrane transloc...    158   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011100784.1|  PREDICTED: outer envelope pore protein 16-2,...    157   2e-45   
emb|CDO98781.1|  unnamed protein product                                159   2e-45   
ref|XP_011010062.1|  PREDICTED: outer envelope pore protein 16-2,...    156   5e-45   
gb|EYU45503.1|  hypothetical protein MIMGU_mgv1a015003mg                154   4e-44   
ref|XP_008390546.1|  PREDICTED: outer envelope pore protein 16-2,...    154   4e-44   
gb|EYU44015.1|  hypothetical protein MIMGU_mgv1a014750mg                153   1e-43   
ref|XP_002312339.1|  hypothetical protein POPTR_0008s10670g             151   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010094311.1|  hypothetical protein L484_007726                   150   1e-42   
ref|XP_011071393.1|  PREDICTED: outer envelope pore protein 16-2,...    149   3e-42   
ref|XP_002519203.1|  protein translocase, putative                      149   3e-42   Ricinus communis
ref|XP_010921504.1|  PREDICTED: outer envelope pore protein 16-2,...    148   7e-42   
gb|KDP27896.1|  hypothetical protein JCGZ_18976                         147   2e-41   
ref|XP_009789603.1|  PREDICTED: outer envelope pore protein 16-2,...    147   2e-41   
ref|XP_008340618.1|  PREDICTED: outer envelope pore protein 16-2,...    147   3e-41   
ref|XP_010259322.1|  PREDICTED: outer envelope pore protein 16-2,...    146   4e-41   
ref|XP_009369946.1|  PREDICTED: outer envelope pore protein 16-2,...    146   4e-41   
ref|XP_009601372.1|  PREDICTED: outer envelope pore protein 16-2,...    145   6e-41   
ref|XP_008781093.1|  PREDICTED: outer envelope pore protein 16-2,...    145   7e-41   
ref|XP_007227528.1|  hypothetical protein PRUPE_ppa012201mg             145   1e-40   
gb|KDO71888.1|  hypothetical protein CISIN_1g036913mg                   144   2e-40   
ref|XP_008223316.1|  PREDICTED: outer envelope pore protein 16-2,...    144   2e-40   
ref|XP_011020263.1|  PREDICTED: outer envelope pore protein 16-2,...    144   3e-40   
ref|XP_006419410.1|  hypothetical protein CICLE_v10006030mg             144   3e-40   
gb|KHG27138.1|  Outer envelope pore 16-2, chloroplastic -like pro...    143   8e-40   
ref|XP_006355389.1|  PREDICTED: outer envelope pore protein 16-2,...    142   1e-39   
ref|XP_009416248.1|  PREDICTED: outer envelope pore protein 16-2,...    142   3e-39   
ref|XP_004229002.1|  PREDICTED: outer envelope pore protein 16-2,...    141   4e-39   
ref|XP_010671676.1|  PREDICTED: outer envelope pore protein 16-2,...    141   6e-39   
ref|XP_003533195.1|  PREDICTED: outer envelope pore protein 16-2,...    140   8e-39   
ref|XP_010063276.1|  PREDICTED: outer envelope pore protein 16-2,...    139   3e-38   
emb|CDY34437.1|  BnaC01g21960D                                          137   1e-37   
ref|XP_004487776.1|  PREDICTED: outer envelope pore protein 16-2,...    137   1e-37   
ref|XP_009146383.1|  PREDICTED: outer envelope pore protein 16-2,...    137   1e-37   
ref|NP_001049884.1|  Os03g0305600                                       137   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007138986.1|  hypothetical protein PHAVU_009G255100g             137   2e-37   
ref|NP_001237610.1|  uncharacterized protein LOC100305849               136   3e-37   
ref|XP_011010074.1|  PREDICTED: outer envelope pore protein 16-2,...    135   4e-37   
gb|KFK23123.1|  hypothetical protein AALP_AAs72355U000300               135   7e-37   
gb|KFK23122.1|  hypothetical protein AALP_AAs72355U000300               134   2e-36   
ref|XP_007035757.1|  Mitochondrial import inner membrane transloc...    134   3e-36   
gb|AES91953.2|  outer envelope pore protein                             134   4e-36   
ref|XP_003529533.1|  PREDICTED: outer envelope pore protein 16-2,...    133   9e-36   
ref|XP_010440195.1|  PREDICTED: outer envelope pore protein 16-2,...    132   2e-35   
gb|AEV46836.1|  plastid OEP16.2                                         132   2e-35   
gb|EAY89687.1|  hypothetical protein OsI_11222                          132   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_003594780.1|  hypothetical protein MTR_2g034550                  131   4e-35   
ref|XP_006651306.1|  PREDICTED: outer envelope pore protein 16-2,...    130   5e-35   
ref|XP_010524578.1|  PREDICTED: outer envelope pore protein 16-2,...    130   5e-35   
gb|EPS72464.1|  hypothetical protein M569_02294                         130   6e-35   
ref|XP_010434869.1|  PREDICTED: outer envelope pore protein 16-2,...    130   7e-35   
ref|XP_010440196.1|  PREDICTED: outer envelope pore protein 16-2,...    129   2e-34   
gb|AFK34430.1|  unknown                                                 129   2e-34   
ref|XP_010548992.1|  PREDICTED: outer envelope pore protein 16-2,...    129   2e-34   
ref|XP_010548993.1|  PREDICTED: outer envelope pore protein 16-2,...    129   3e-34   
ref|XP_003558089.1|  PREDICTED: outer envelope pore protein 16-2,...    129   3e-34   
ref|XP_006282840.1|  hypothetical protein CARUB_v10006765mg             128   4e-34   
ref|XP_010434870.1|  PREDICTED: outer envelope pore protein 16-2,...    128   5e-34   
ref|NP_567488.1|  outer envelope pore protein 16-2                      128   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870177.1|  ATOEP16-2/ATOEP16-S                                128   7e-34   
ref|XP_004508261.1|  PREDICTED: outer envelope pore protein 16-2,...    127   7e-34   
ref|XP_008786243.1|  PREDICTED: outer envelope pore protein 16-2,...    127   7e-34   
gb|AAV84280.1|  dehydration up-regulated putative membrane pore p...    127   9e-34   Xerophyta humilis
dbj|BAJ86836.1|  predicted protein                                      127   1e-33   
ref|NP_849394.1|  outer envelope pore protein 16-2                      127   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107889.1|  PREDICTED: outer envelope pore protein 16-2,...    126   3e-33   
ref|XP_006414382.1|  hypothetical protein EUTSA_v10026380mg             124   1e-32   
ref|XP_010228715.1|  PREDICTED: outer envelope pore protein 16-2,...    124   2e-32   
ref|XP_003609756.1|  hypothetical protein MTR_4g121900                  124   3e-32   
ref|XP_006419409.1|  hypothetical protein CICLE_v10006030mg             121   1e-31   
ref|XP_008458360.1|  PREDICTED: outer envelope pore protein 16-2,...    122   1e-31   
gb|EMS68749.1|  hypothetical protein TRIUR3_14005                       120   9e-31   
gb|KGN47380.1|  hypothetical protein Csa_6G307410                       121   1e-30   
ref|XP_004172663.1|  PREDICTED: outer envelope pore protein 16-2,...    120   1e-30   
ref|XP_007035758.1|  Mitochondrial import inner membrane transloc...    119   2e-30   
ref|XP_003567585.1|  PREDICTED: outer envelope pore protein 16-2,...    119   2e-30   
ref|XP_004148230.1|  PREDICTED: outer envelope pore protein 16-2,...    120   4e-30   
ref|XP_004984632.1|  PREDICTED: outer envelope pore protein 16-2,...    117   7e-30   
emb|CDY09710.1|  BnaC07g33510D                                          117   1e-29   
ref|XP_004295096.1|  PREDICTED: outer envelope pore protein 16-2,...    117   2e-29   
ref|XP_009136748.1|  PREDICTED: outer envelope pore protein 16-2,...    116   2e-29   
emb|CDX90540.1|  BnaA03g42410D                                          116   2e-29   
gb|ACG48163.1|  hypothetical protein                                    114   1e-28   Zea mays [maize]
gb|EPS58527.1|  hypothetical protein M569_16286                         112   1e-27   
gb|EAZ26649.1|  hypothetical protein OsJ_10553                          107   5e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAB10395.1|  pore protein homolog                                   103   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EMT25997.1|  hypothetical protein F775_27388                         104   3e-24   
ref|NP_001142523.1|  uncharacterized protein LOC100274762               101   1e-23   Zea mays [maize]
gb|ACG25972.1|  hypothetical protein                                    101   1e-23   Zea mays [maize]
ref|XP_006645799.1|  PREDICTED: outer envelope pore protein 16-2,...  98.2    2e-22   
ref|XP_004967558.1|  PREDICTED: outer envelope pore protein 16-2,...  97.4    4e-22   
gb|EMS47409.1|  hypothetical protein TRIUR3_06756                     96.3    1e-21   
ref|NP_001152606.1|  LOC100286246                                     95.9    1e-21   Zea mays [maize]
gb|ADK88900.1|  outer membrane channel protein OEP16-2                94.7    4e-21   
ref|XP_006839205.1|  hypothetical protein AMTR_s02234p00007680        91.3    4e-20   
gb|EEC70487.1|  hypothetical protein OsI_01558                        88.6    8e-19   Oryza sativa Indica Group [Indian rice]
dbj|BAB20636.1|  putative stress-inducible membrane pore protein      84.0    9e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAL23749.1|  stress-inducible membrane pore protein                81.6    2e-16   Bromus inermis [awnless brome grass]
tpg|DAA54342.1|  TPA: putative mitochondrial import inner membran...  76.6    6e-15   
emb|CAK26794.1|  hypothetical protein                                 75.5    3e-14   Sporobolus stapfianus [resurrection grass]
ref|XP_001761140.1|  predicted protein                                70.9    1e-12   
ref|XP_001772989.1|  predicted protein                                70.9    1e-12   
ref|XP_002971785.1|  hypothetical protein SELMODRAFT_441602           67.0    7e-11   
ref|XP_002963833.1|  hypothetical protein SELMODRAFT_438581           65.5    1e-10   
ref|XP_002972844.1|  hypothetical protein SELMODRAFT_413476           64.7    2e-10   
ref|XP_001774786.1|  predicted protein                                64.7    2e-10   
ref|XP_002984416.1|  hypothetical protein SELMODRAFT_423634           64.7    2e-10   
gb|KHG03976.1|  smek1                                                 67.8    3e-10   
gb|AAT45008.1|  stress-inducible membrane pore-like protein           63.5    4e-10   Xerophyta humilis
gb|EMT04893.1|  hypothetical protein F775_26935                       62.0    2e-09   
ref|XP_001764509.1|  predicted protein                                55.1    5e-07   
emb|CDY22776.1|  BnaA08g06060D                                        55.1    5e-07   
ref|XP_001779980.1|  predicted protein                                54.7    7e-07   
ref|XP_001777747.1|  predicted protein                                50.8    1e-05   
ref|XP_002972971.1|  hypothetical protein SELMODRAFT_413325           50.8    2e-05   
emb|CAA09867.1|  amino acid selective channel protein                 50.4    2e-05   Hordeum vulgare [barley]
gb|EMT26097.1|  hypothetical protein F775_31817                       50.1    3e-05   
ref|XP_009345977.1|  PREDICTED: outer envelope pore protein 16, c...  50.4    3e-05   
gb|ABK21269.1|  unknown                                               50.1    3e-05   Picea sitchensis
gb|EEC72263.1|  hypothetical protein OsI_05414                        49.7    4e-05   Oryza sativa Indica Group [Indian rice]
gb|EMS53533.1|  hypothetical protein TRIUR3_34729                     49.7    7e-05   
ref|XP_006846173.1|  hypothetical protein AMTR_s00012p00202200        48.9    9e-05   
ref|XP_006645400.1|  PREDICTED: outer envelope pore protein 16, c...  48.5    1e-04   
dbj|BAJ89521.1|  predicted protein                                    48.1    2e-04   
ref|NP_001151965.1|  amino acid selective channel protein             47.8    2e-04   Zea mays [maize]
ref|XP_009345978.1|  PREDICTED: outer envelope pore protein 16, c...  47.4    3e-04   
ref|XP_009353670.1|  PREDICTED: outer envelope pore protein 16, c...  47.0    4e-04   
ref|XP_006653965.1|  PREDICTED: outer envelope pore protein 16, c...  46.6    5e-04   
ref|NP_001054446.1|  Os05g0111200                                     46.6    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACG31308.1|  amino acid selective channel protein                  46.6    5e-04   Zea mays [maize]
ref|XP_004960518.1|  PREDICTED: outer envelope pore protein 16, c...  46.6    6e-04   
ref|XP_002457029.1|  hypothetical protein SORBIDRAFT_03g047420        45.8    9e-04   Sorghum bicolor [broomcorn]
gb|ABR16919.1|  unknown                                               45.8    0.001   Picea sitchensis
gb|KFK32251.1|  hypothetical protein AALP_AA6G217900                  45.8    0.001   



>ref|XP_002276934.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Vitis 
vinifera]
 emb|CBI22901.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 8/123 (7%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSSNLETRSLLDE+R F++ GF +LGHPLLNR AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSSNLETRSLLDELRDFDKGGFFDLGHPLLNRFAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  -GCKNTSAVT----GAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGL  11
             G ++   VT    G  K   QRFPDLKGE+++KS+EAL+ +TGKE++QWG AAGMYSGL
Sbjct  61   SGLESPGGVTEVTVGGKK---QRFPDLKGESSRKSLEALVKSTGKESLQWGLAAGMYSGL  117

Query  10   TYG  2
            TYG
Sbjct  118  TYG  120



>ref|XP_002314929.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEF01100.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=179

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRS +DEIRHF++  F + GHPLLNR+AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSHNLETRSFVDEIRHFDKSSFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  GCKNTS----AVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
                +S    A      K+  RFPDL+GE N+KS+EAL+ NTGKE++QWG AAG+YSGLT
Sbjct  61   AGLESSGGLPAEISVDGKKPHRFPDLRGETNRKSLEALVMNTGKESLQWGLAAGVYSGLT  120

Query  7    YG  2
            YG
Sbjct  121  YG  122



>ref|XP_011100784.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Sesamum 
indicum]
Length=181

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 98/122 (80%), Gaps = 7/122 (6%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            SNLETRSLLDE+RHFE+  F +LGHPLLNR+AE+F+++AG+GA+QAV+RE +  AV+   
Sbjct  4    SNLETRSLLDELRHFEKGFFFDLGHPLLNRIAESFVRAAGIGAVQAVSREAYFTAVESVG  63

Query  169  KNTSA------VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
             +T++        GAPKK   RFPDLKG NN+KS+EAL+ +TGKE++QWG AAGMYSGLT
Sbjct  64   GDTASGLPPELGVGAPKKS-NRFPDLKGANNRKSLEALVKSTGKESLQWGIAAGMYSGLT  122

Query  7    YG  2
            YG
Sbjct  123  YG  124



>emb|CDO98781.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = -1

Query  364  TTKMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAA  185
            T   SSNLETRS++DE+R+F++ G  +LGHPLLNR+AE+F+K+AG+GA+QAVARE +  A
Sbjct  46   TMSSSSNLETRSIIDELRNFDKSGLFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYLTA  105

Query  184  VQGGCKNTSAV---TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
            V+G   +TS +     A K+   RFPDL+GE N K+VEAL+  TGKE++QWG AAGMYSG
Sbjct  106  VEGAGADTSGIPPEISAAKR--HRFPDLRGETNAKTVEALVKGTGKESLQWGLAAGMYSG  163

Query  13   LTYG  2
            LTYG
Sbjct  164  LTYG  167



>ref|XP_011010062.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011010068.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=179

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRS +DEIRHF++  F + GHPLLNR+AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSHNLETRSFVDEIRHFDKSSFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  GCKNTS----AVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
                +S    A      K+  RFPDL GE N+KS+EAL+ NTGKE++QWG AAG+YSGLT
Sbjct  61   AGLESSGGLPAEISVDGKKRHRFPDLGGETNRKSLEALVRNTGKESLQWGLAAGVYSGLT  120

Query  7    YG  2
            YG
Sbjct  121  YG  122



>gb|EYU45503.1| hypothetical protein MIMGU_mgv1a015003mg [Erythranthe guttata]
Length=171

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = -1

Query  346  NLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCK  167
            +LE RSL+DE+  F+  GFL+LGHPLLNR+AE+F K+AG+GAIQAV+RE +  AV+ G  
Sbjct  2    SLEKRSLIDELSSFDSGGFLDLGHPLLNRMAESFTKAAGIGAIQAVSREAYFTAVESGSG  61

Query  166  NTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            +TS   GA KK    FPDL+GENN+KSVEAL+ +TGKE+MQWG AAG+YSGLTYG
Sbjct  62   STSE-NGASKKH-HHFPDLRGENNRKSVEALVKSTGKESMQWGLAAGVYSGLTYG  114



>ref|XP_008390546.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Malus 
domestica]
Length=184

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = -1

Query  361  TKMSSNLETR-SLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAA  185
            T  S++LET+ SLL E+R F++ GF +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  A
Sbjct  4    TTSSTSLETKPSLLXELRSFDKSGFFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFIA  63

Query  184  VQGGCKNTSAV---TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
            ++G   +T+ +      P  + QRFPDL+GENN+KS+EA++ NTGKE++QWG AAG+YSG
Sbjct  64   IEGFDSSTNGIPPEISVPGNKRQRFPDLRGENNRKSLEAMVKNTGKESLQWGLAAGVYSG  123

Query  13   LTYG  2
            LTYG
Sbjct  124  LTYG  127



>gb|EYU44015.1| hypothetical protein MIMGU_mgv1a014750mg [Erythranthe guttata]
Length=179

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 5/120 (4%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            SNLETRSLLDE+++FE+  F +LGHPLLNRVAE F+++AG+GA+ AV+RE +  AV+   
Sbjct  4    SNLETRSLLDELKNFEKGLFFDLGHPLLNRVAETFVRAAGIGAVHAVSREAYLTAVESVS  63

Query  169  KNTSA----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             + +       GAPKKR   FPDL+GENN+KSVEAL+ +TGKE++QWG AAGMYSGLTYG
Sbjct  64   GDATGGLPREIGAPKKR-HVFPDLRGENNRKSVEALVKSTGKESLQWGVAAGMYSGLTYG  122



>ref|XP_002312339.1| hypothetical protein POPTR_0008s10670g [Populus trichocarpa]
 gb|EEE89706.1| hypothetical protein POPTR_0008s10670g [Populus trichocarpa]
Length=179

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 8/124 (6%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRSL+ EIR F++C F + GHPLLNR+AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSHNLETRSLMGEIRRFDKCCFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  GCKNTSAVTGAPK------KRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
                +S   G P       K+  R PDL+GE N+KS+EAL+ NTGKE++QWG AAG+YSG
Sbjct  61   SGFESSG--GVPPEISVDGKKRHRAPDLRGETNRKSLEALVRNTGKESLQWGLAAGVYSG  118

Query  13   LTYG  2
            LTYG
Sbjct  119  LTYG  122



>ref|XP_010094311.1| hypothetical protein L484_007726 [Morus notabilis]
 gb|EXB55731.1| hypothetical protein L484_007726 [Morus notabilis]
Length=177

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 95/120 (79%), Gaps = 5/120 (4%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            S  LE +S ++E+R F++ GF ELGHPLLNRVAE+F+K+AG+GAIQAV+RE +  A +G 
Sbjct  3    SGKLENKSFMEELRSFDKGGFFELGHPLLNRVAESFIKAAGIGAIQAVSREAYFTAFEG-  61

Query  172  CKNTSAVTGA---PKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             +N+S+  GA   P  +  RFPDL+GE N+KS+EA++ NTGKE++QWG AAG+YSGLTYG
Sbjct  62   -ENSSSSVGATEIPGAKKHRFPDLRGETNRKSLEAMVKNTGKESLQWGLAAGVYSGLTYG  120



>ref|XP_011071393.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Sesamum indicum]
Length=181

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -1

Query  358  KMS-SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAV  182
            +MS SNLETRSL+DE+R F+  GF +LGHPLLNRVAE+F+K+AG+GA+QAV+R  +  AV
Sbjct  2    RMSGSNLETRSLIDELRSFDSGGFFDLGHPLLNRVAESFIKAAGIGAVQAVSRHAYFTAV  61

Query  181  Q--GGCKNTSAV--TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
            +  GG    S +   G  KK   R PDL+GEN++KSVEAL+ +TGKE+MQWG AAG+YSG
Sbjct  62   ESAGGDVGGSILPEVGGSKKH-HRIPDLRGENSQKSVEALVKSTGKESMQWGLAAGVYSG  120

Query  13   LTYG  2
            LTYG
Sbjct  121  LTYG  124



>ref|XP_002519203.1| protein translocase, putative [Ricinus communis]
 gb|EEF43067.1| protein translocase, putative [Ricinus communis]
Length=181

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 98/125 (78%), Gaps = 8/125 (6%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS+ L+TR+ +DE+R FE+    +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSNKLQTRTFMDELRGFEKGWMFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  -GCKNTSAV------TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYS  17
             G  ++S+V       GA KKR  RFPDL+GE N KS+EAL+ +TGKE+MQWG AAG+YS
Sbjct  61   SGLDSSSSVPPELSPAGAAKKR-NRFPDLRGETNGKSLEALVKSTGKESMQWGLAAGVYS  119

Query  16   GLTYG  2
            GLTYG
Sbjct  120  GLTYG  124



>ref|XP_010921504.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Elaeis 
guineensis]
Length=177

 Score =   148 bits (374),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            +SNLETR+LLDEIR  E+    + GHPLLNR+AE+F+K+AG+GAIQAV+RE +  AV+G 
Sbjct  4    NSNLETRTLLDEIRSLEKGWLFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYLTAVEGA  63

Query  172  CKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              +  A+      +  RFPDL+GEN  KS+EA + +TGKE  QWG AAGMYSGLTYG
Sbjct  64   GADPGAIPDMTSSKRHRFPDLRGENCTKSLEATVKSTGKEAFQWGMAAGMYSGLTYG  120



>gb|KDP27896.1| hypothetical protein JCGZ_18976 [Jatropha curcas]
Length=178

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 97/123 (79%), Gaps = 7/123 (6%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSSNLETRSL+DE R+ E+    +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  A QG
Sbjct  1    MSSNLETRSLMDEFRNLEKGWSFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYLTASQG  60

Query  175  GCKNTSA-----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGL  11
               ++S+     ++GA KKR  RFP+LKGE + KS+EAL+  TG+E++QWG AAG+YSGL
Sbjct  61   NGLDSSSGLPPELSGAAKKR--RFPNLKGETSVKSLEALVKRTGEESLQWGLAAGVYSGL  118

Query  10   TYG  2
            TYG
Sbjct  119  TYG  121



>ref|XP_009789603.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nicotiana 
sylvestris]
Length=173

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 97/122 (80%), Gaps = 10/122 (8%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M+SNLETRSLL     F++ GF +LGHPLLNR+AE+F+K+AG+GA+QAVARE +  A +G
Sbjct  1    MNSNLETRSLL---HGFDKGGFFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYFTASEG  57

Query  175  GCKNTSAV----TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
               +++++    TG PKK   RFPDL+GE N+KS+EAL+ +TGKE++QWG AAGMYSGLT
Sbjct  58   ASGDSTSIPPEITG-PKK--NRFPDLRGETNRKSIEALVKSTGKESVQWGLAAGMYSGLT  114

Query  7    YG  2
            YG
Sbjct  115  YG  116



>ref|XP_008340618.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Malus domestica]
Length=185

 Score =   147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = -1

Query  370  ITTTKMSSNLETR-SLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGF  194
            + T+  SS+LET+ SLL E+R F++ GF +LGHPLLNR+AE+F+K+A +GAIQAV+RE +
Sbjct  2    LNTSSGSSSLETKPSLLQELRSFDKGGFSDLGHPLLNRIAESFVKAAXIGAIQAVSREAY  61

Query  193  SAAVQGGCKNTSAV---TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGM  23
              A +G   +T+ +         + QRFPDL+GENN+KS+EA++ NTGKE++QWG AAG+
Sbjct  62   FTATEGFDSSTNGIPPEISVSGNKKQRFPDLRGENNRKSLEAMVKNTGKESLQWGLAAGV  121

Query  22   YSGLTYG  2
            YSGLTYG
Sbjct  122  YSGLTYG  128



>ref|XP_010259322.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nelumbo 
nucifera]
Length=175

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 6/121 (5%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRSL DEIR F +    +LGHPLLNR+AE+F+K+AG+GA+QAV+RE +  A++G
Sbjct  1    MSINLETRSLFDEIRGFHKECLFDLGHPLLNRIAESFVKAAGIGAVQAVSREVYFIAIEG  60

Query  175  GCKNTS---AVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
               +++    +TG+ K   QR P+LKGE N+KS+EA++ +TGKE +QWG AAGMYSGLTY
Sbjct  61   AGTDSNGAPVITGSKK---QRLPELKGETNRKSLEAMVKSTGKECLQWGLAAGMYSGLTY  117

Query  4    G  2
            G
Sbjct  118  G  118



>ref|XP_009369946.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Pyrus 
x bretschneideri]
Length=184

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 96/124 (77%), Gaps = 4/124 (3%)
 Frame = -1

Query  361  TKMSSNLETR-SLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAA  185
            T  S++LET+ SLL E+R F++ G  +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  A
Sbjct  4    TPSSTSLETKPSLLQELRSFDKSGIFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFIA  63

Query  184  VQGGCKNTSAV---TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
             +G   +T+ +      P  + Q FPDL+GENN+KS+EA++ NTGKE++QWG AAG+YSG
Sbjct  64   TEGFDSSTNGIPPEISVPGNKRQCFPDLRGENNRKSLEAMVKNTGKESLQWGLAAGVYSG  123

Query  13   LTYG  2
            LTYG
Sbjct  124  LTYG  127



>ref|XP_009601372.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nicotiana 
tomentosiformis]
Length=173

 Score =   145 bits (367),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 97/122 (80%), Gaps = 10/122 (8%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M+SNLETRSLL     F++ GF +LGHPLLNR+AE+F+K+AG+GA+QAVARE +  A +G
Sbjct  1    MNSNLETRSLL---HGFDKGGFFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYFTASEG  57

Query  175  GCKNTSAV----TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
               +++++    TG PK+   RFPDL+GE N+KS+EAL+ +TGKE++QWG AAGMYSGLT
Sbjct  58   ASGDSTSIPPEITG-PKR--NRFPDLRGETNRKSIEALVKSTGKESVQWGLAAGMYSGLT  114

Query  7    YG  2
            YG
Sbjct  115  YG  116



>ref|XP_008781093.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Phoenix dactylifera]
Length=177

 Score =   145 bits (367),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            SNLET +LLDEIR  E+    +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  AV+G  
Sbjct  5    SNLETMTLLDEIRSLEKGWLFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYLTAVEGAG  64

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             + +A+      +  RF DL GEN KKS+EA++ +TGKE+ QWG AAGMYSGLTYG
Sbjct  65   ADPAAMPDLTSSKKHRFSDLGGENCKKSLEAMVKSTGKESFQWGMAAGMYSGLTYG  120



>ref|XP_007227528.1| hypothetical protein PRUPE_ppa012201mg [Prunus persica]
 gb|EMJ28727.1| hypothetical protein PRUPE_ppa012201mg [Prunus persica]
Length=180

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 8/122 (7%)
 Frame = -1

Query  352  SSNLETR-SLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            SSNLETR SLL E+R FE+ GF + GHPLLNR+AE+FLK+AG+GAIQAV+RE +  A +G
Sbjct  5    SSNLETRPSLLQELRSFEKGGFFDFGHPLLNRIAESFLKAAGIGAIQAVSREAYFTATEG  64

Query  175  ----GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
                G      ++G  K    RFPDL+GENN KS+EA++ +TGKE++QWG AAG+YSGLT
Sbjct  65   LDSSGGGIPPEISGNKK---HRFPDLRGENNTKSLEAMVKHTGKESLQWGLAAGVYSGLT  121

Query  7    YG  2
            YG
Sbjct  122  YG  123



>gb|KDO71888.1| hypothetical protein CISIN_1g036913mg [Citrus sinensis]
Length=176

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M+SN+E RSL  E+  FE+ GF +LGHPLLNR+ E+F+K+AG+GAIQAV RE +  AV+G
Sbjct  1    MTSNMENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAYFTAVEG  60

Query  175  -GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G  +++ V+     +  +FP+LKGE N+KS+EA++ NTGKE++QWG  AG+YSGLTYG
Sbjct  61   SGFDSSNNVSDMGDAKKHQFPNLKGETNRKSLEAMVKNTGKESLQWGVVAGIYSGLTYG  119



>ref|XP_008223316.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Prunus 
mume]
Length=181

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 8/122 (7%)
 Frame = -1

Query  352  SSNLETR-SLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            SSNLETR SLL E+R FE+ GF + GHPLLNR+AE+FLK+AG+GAIQAV+RE +  A +G
Sbjct  6    SSNLETRPSLLQELRSFEKGGFFDFGHPLLNRIAESFLKAAGIGAIQAVSRETYFTATEG  65

Query  175  ----GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
                G      ++G  K    RFPDL+GENN KS+EA++ +TGKE++QWG AAG+YSGLT
Sbjct  66   LDSRGGGIPPEISGNKK---HRFPDLRGENNTKSLEAMVKHTGKESLQWGLAAGVYSGLT  122

Query  7    YG  2
            YG
Sbjct  123  YG  124



>ref|XP_011020263.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Populus euphratica]
Length=179

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 8/124 (6%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRSL+ EIR F++C F + GHPLLN +AE+F+K+AG+GAIQAV+RE +  A++G
Sbjct  1    MSHNLETRSLMGEIRRFDKCCFFDFGHPLLNCIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  175  GCKNTSAVTGAPK------KRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSG  14
                +S   G P       K+  R P L+GE N KS+EAL+ NTGKE++QWG AAG+YSG
Sbjct  61   AGIESSG--GVPPEISVDGKKRHRAPHLRGETNIKSLEALVRNTGKESLQWGLAAGVYSG  118

Query  13   LTYG  2
            LTYG
Sbjct  119  LTYG  122



>ref|XP_006419410.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
 ref|XP_006488859.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR32650.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
Length=176

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 91/122 (75%), Gaps = 7/122 (6%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M+SN+E RSL  E+  FE+ GF +LGHPLLNR+ E+F+K+AG+GAIQAV RE +  AV+G
Sbjct  1    MTSNMENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAYFTAVEG  60

Query  175  ----GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
                   N S + GA K    +FP+LKGE N+KS+EA++ NTGKE++QWG  AG+YSGLT
Sbjct  61   SGFDSSNNVSDMGGAKK---HQFPNLKGETNRKSLEAMVKNTGKESLQWGVVAGIYSGLT  117

Query  7    YG  2
            YG
Sbjct  118  YG  119



>gb|KHG27138.1| Outer envelope pore 16-2, chloroplastic -like protein [Gossypium 
arboreum]
Length=187

 Score =   143 bits (361),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 12/130 (9%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M++NLETRSLLDE+R F++ GF +LGHPLLNR+AE+F+K+AG+GAI+ VAREG   A++G
Sbjct  1    MTTNLETRSLLDELRSFDKGGFFDLGHPLLNRIAESFVKAAGIGAIKGVAREGCYLALEG  60

Query  175  ----------GCKNTSAVTGAPKKRLQR--FPDLKGENNKKSVEALITNTGKETMQWGFA  32
                      G K+ S+ T    K  ++  FP L+GE N+KS+EA++ +TGKE++QWG A
Sbjct  61   KHKFNSNLVAGTKSRSSSTDISAKNNKKNPFPYLRGETNRKSLEAMVKSTGKESLQWGLA  120

Query  31   AGMYSGLTYG  2
            AG+YSG+TYG
Sbjct  121  AGLYSGITYG  130



>ref|XP_006355389.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Solanum tuberosum]
Length=173

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 10/122 (8%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSSNLE+RSLL     F++ G  +LGHPLLNR++E+F+K+AG+GA+QAVARE +  A + 
Sbjct  1    MSSNLESRSLL---HGFDKGGLFDLGHPLLNRISESFVKAAGIGAVQAVAREAYFTASES  57

Query  175  GCKNTSAV----TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
               +TS++    TG PKK   RFPDL+GE N+KSVEAL+ +TGKE++QWG AAGMYSGLT
Sbjct  58   TGGDTSSIPPEITG-PKK--NRFPDLRGETNRKSVEALVKSTGKESVQWGLAAGMYSGLT  114

Query  7    YG  2
            YG
Sbjct  115  YG  116



>ref|XP_009416248.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=176

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            S  LETR+LLDEIR  +     + GHPL+NRVAE F K+AG+GA+QAV RE +  AV+G 
Sbjct  3    SGKLETRTLLDEIRDMDNGWLFDFGHPLINRVAECFFKAAGIGAVQAVTREAYFTAVEGS  62

Query  172  CKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              +T  V      + +RF DL+GEN KKS+EA++ +TGKE+ QWG AAGMYSGLTYG
Sbjct  63   GVDTGGVADVTGGKKRRFSDLRGENCKKSLEAMVKSTGKESFQWGMAAGMYSGLTYG  119



>ref|XP_004229002.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Solanum 
lycopersicum]
Length=173

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 10/122 (8%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSSNLE RSLL     F++ G  +LGHPLLNR++E+F+K+AG+GA+QAVARE +  A + 
Sbjct  1    MSSNLECRSLL---HGFDKGGLFDLGHPLLNRISESFVKAAGIGAVQAVAREAYFTASES  57

Query  175  GCKNTSAV----TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
               +TS++    TG PKK   RFPDL+GE N+KSVEAL+ +TGKE++QWG AAGMYSGLT
Sbjct  58   TGGDTSSIPPEITG-PKK--NRFPDLRGETNRKSVEALVKSTGKESVQWGLAAGMYSGLT  114

Query  7    YG  2
            YG
Sbjct  115  YG  116



>ref|XP_010671676.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=189

 Score =   141 bits (355),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  LETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKN  164
             E RS++DEIR FE+ GF +LGHPLLNR+  +F+K AG+GAIQAV+RE +  A+ G   +
Sbjct  19   FEKRSMMDEIRSFEKDGFFDLGHPLLNRITHSFIKVAGIGAIQAVSREAYFTAIDGVGID  78

Query  163  TSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + +  G   KR   F DL+GE ++KSVEAL+ +TGKE+ QWG AAG++SGLTYG
Sbjct  79   SGSANGNGAKRRNTFSDLRGETSRKSVEALVKHTGKESFQWGLAAGVFSGLTYG  132



>ref|XP_003533195.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Glycine max]
 gb|KHN12892.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=181

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 91/122 (75%), Gaps = 8/122 (7%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            SSNLETRSLLDE+ +F + G  +LGHPLLNR+ E F+K+AG+GA+QAV+RE +  A++G 
Sbjct  6    SSNLETRSLLDELCNFHKKGLFDLGHPLLNRILETFVKAAGIGAVQAVSREAYFTAIEGT  65

Query  172  CKNTSA-----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
              + S      ++ A K RL   P LKGE N KS+EA++ NTGKE++QWG AAG+Y+GLT
Sbjct  66   GTDNSGGLPPEISSAKKNRL---PSLKGETNNKSLEAMVKNTGKESLQWGVAAGLYAGLT  122

Query  7    YG  2
            YG
Sbjct  123  YG  124



>ref|XP_010063276.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87948.1| hypothetical protein EUGRSUZ_A00350 [Eucalyptus grandis]
Length=178

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = -1

Query  352  SSNLE--TRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            +SN+E  T+SLL E+ +F++ GF +LGHPLLNR+AE+F+K+AG+GAIQAV+RE +  AV+
Sbjct  3    TSNMEARTQSLLSEL-NFDKGGFFDLGHPLLNRIAESFIKAAGIGAIQAVSREAYFTAVE  61

Query  178  G-GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            G G  +++ V   P  +  RFP+L+GE N+ S+EA++ +TGKE++QWG AAG+YSGLTYG
Sbjct  62   GAGLDSSNGVPEIPGAKKHRFPELRGETNRNSLEAMVKSTGKESLQWGLAAGVYSGLTYG  121



>emb|CDY34437.1| BnaC01g21960D [Brassica napus]
Length=179

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 88/115 (77%), Gaps = 5/115 (4%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNRVA++F+K+A VGA+QAV+RE +   V G   ++S+
Sbjct  7    RKVMDEIRSFEKASLFDLGHPLLNRVADSFVKAAAVGALQAVSREAYFTVVDGTGFDSSS  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + G P +    +  RFP+L+GENN KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   M-GPPSEDTGSKKHRFPNLRGENNSKSLEALVKNTGKESLQWGLAAGLYSGITYG  120



>ref|XP_004487776.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cicer arietinum]
Length=176

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            K SS +ETR LLDEI +F++ G  +LGHPLLNR+AE+F+K+AG+GA+Q+++R+ +  A+Q
Sbjct  4    KTSSEVETRCLLDEICNFDRKGLFDLGHPLLNRIAESFVKAAGIGAVQSLSRQAYFTAIQ  63

Query  178  GGCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            GG    S V+   K RL     L+GE N KS+EA++ NTGKE++QWG AAG+YSGLTYG
Sbjct  64   GGLP-PSDVSATRKSRLP--AALRGETNDKSLEAMVINTGKESLQWGVAAGIYSGLTYG  119



>ref|XP_009146383.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Brassica 
rapa]
 emb|CDY32222.1| BnaA01g17620D [Brassica napus]
Length=179

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNRVA++F+K+AGVGA+QAV+RE +   V G   ++S+
Sbjct  7    RKVMDEIRSFEKASLFDLGHPLLNRVADSFVKAAGVGALQAVSREAYFTVVDGTGFDSSS  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + G P +    +  RFP+L+GEN+ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   M-GPPSEDTGSKKHRFPNLRGENSSKSLEALVKNTGKESLQWGLAAGLYSGITYG  120



>ref|NP_001049884.1| Os03g0305600 [Oryza sativa Japonica Group]
 gb|ABF95523.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11798.1| Os03g0305600 [Oryza sativa Japonica Group]
 dbj|BAG88837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=179

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S+LETR+ LDE+R  E+   ++LGHPLLNRVAE+F+K+AG+GA+QAVARE +  A++G  
Sbjct  7    SSLETRTFLDEVRGLEKNWMVDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMAMEGEG  66

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              T AV+ +   R + FPDL G N+ KS EA++ +  KE++QWG AAG++SGLTYG
Sbjct  67   GGTGAVSDSTGARKRSFPDLNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGLTYG  122



>ref|XP_007138986.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 ref|XP_007138987.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 gb|ESW10980.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 gb|ESW10981.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
Length=180

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            SSNLETRSLLDE+ +F++ G  +LGHPLLNR+ E+F+K++G+GA+QAV+RE +  AV+G 
Sbjct  6    SSNLETRSLLDELCNFDKKGLFDLGHPLLNRILESFVKASGIGALQAVSREAYFTAVEGN  65

Query  172  CKNTSAVTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
              N+   TG P +    +  + P L+GE + KS+EA++ +TGKE++QWG AAG+YSGLTY
Sbjct  66   GANS---TGLPAEVSSTKKNQLPGLRGETSNKSLEAMVKSTGKESLQWGVAAGLYSGLTY  122

Query  4    G  2
            G
Sbjct  123  G  123



>ref|NP_001237610.1| uncharacterized protein LOC100305849 [Glycine max]
 gb|ACU13727.1| unknown [Glycine max]
 gb|KHN14666.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=181

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 93/122 (76%), Gaps = 8/122 (7%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-  176
            SS+LETRSLLDE+ +F + G L+LGHPLLNR+ E+F+K+AG+GA+QAV+RE +  A+ G 
Sbjct  6    SSDLETRSLLDELCNFNKKGLLDLGHPLLNRIFESFVKAAGIGAVQAVSREAYFTAIDGT  65

Query  175  GCKNTSA----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
            G  N+      ++ A K RL   P LKGE + KS+EA++ +TGKE++QWG AAG+YSGLT
Sbjct  66   GADNSGGLPPEISSAKKNRL---PGLKGETSNKSLEAMVKSTGKESLQWGVAAGLYSGLT  122

Query  7    YG  2
            YG
Sbjct  123  YG  124



>ref|XP_011010074.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=151

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 24/118 (20%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS NLETRS +DEIRHF++  F + GHPLLNR+AE+F+K+AG+GAIQAV+RE +      
Sbjct  1    MSHNLETRSFVDEIRHFDKSSFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAY------  54

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                              F  ++GE N+KS+EAL+ NTGKE++QWG AAG+YSGLTYG
Sbjct  55   ------------------FTAIEGETNRKSLEALVRNTGKESLQWGLAAGVYSGLTYG  94



>gb|KFK23123.1| hypothetical protein AALP_AAs72355U000300 [Arabis alpina]
Length=178

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEI+ FE+    +LGHPLLNR+A++F+K+AGVGA+QAV REG+   V+G   +++ 
Sbjct  7    RKVIDEIKSFEKASLFDLGHPLLNRIADSFVKAAGVGALQAVTREGYFTVVEGAGYDSNN  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            V G P +    +  RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   V-GPPSENNSSKKHRFPNLRGESSSKSLEALVKNTGKESLQWGLAAGLYSGITYG  120



>gb|KFK23122.1| hypothetical protein AALP_AAs72355U000300 [Arabis alpina]
Length=176

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 7/115 (6%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEI+ FE+    +LGHPLLNR+A++F+K+AGVGA+QAV REG+   V+G   N   
Sbjct  7    RKVIDEIKSFEKASLFDLGHPLLNRIADSFVKAAGVGALQAVTREGYFTVVEGYDSNN--  64

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              G P +    +  RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  65   -VGPPSENNSSKKHRFPNLRGESSSKSLEALVKNTGKESLQWGLAAGLYSGITYG  118



>ref|XP_007035757.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 1 [Theobroma cacao]
 gb|EOY06683.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 1 [Theobroma cacao]
Length=175

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS+NLETRSLLD+ R+F++  F +LGHPLLNR+AE+F+K+AG+GAIQA ARE    AV+G
Sbjct  1    MSTNLETRSLLDDWRNFDKGCFFDLGHPLLNRIAESFVKAAGIGAIQAAARESCFIAVEG  60

Query  175  G-CKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                N+  +TG+  K+  RFPDL+GE N+KS+EA++ +TGKE++QWG AAG+YSGLTYG
Sbjct  61   TESSNSPDITGSKNKK-NRFPDLRGETNRKSLEAMVKSTGKESLQWGLAAGLYSGLTYG  118



>gb|AES91953.2| outer envelope pore protein [Medicago truncatula]
Length=179

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-  176
            +SNLETR+LLDE+  F + G  + GHPL+NR+AE+F+K+AG+GA+QAV+RE +   ++G 
Sbjct  4    NSNLETRTLLDELSDFNKGGLFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTVIEGT  63

Query  175  GCKNTSA----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
            G  N       ++GA K    RF  L+GE + KS+EA++ NTGKE+ QWG AAG+YSGLT
Sbjct  64   GIDNAGGMPPEISGAKK---NRFHGLRGETSSKSIEAMVKNTGKESFQWGLAAGLYSGLT  120

Query  7    YG  2
            YG
Sbjct  121  YG  122



>ref|XP_003529533.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Glycine max]
 gb|KHN02907.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=182

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 8/128 (6%)
 Frame = -1

Query  370  ITTTKMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFS  191
            ++++  + NLETRS LDE+  F + G  +LGHPLLNR+AE+F+K++G+GA+QAV+RE + 
Sbjct  1    MSSSSSNVNLETRSPLDEVICFNKGGLFDLGHPLLNRIAESFVKASGIGAVQAVSREAYF  60

Query  190  AAVQGG-CKNT----SAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAG  26
            +AV G    NT    S V+ A K RL     L+GE + KS+EA++ NTGKE++QWG AAG
Sbjct  61   SAVDGNRMDNTGGMPSEVSNAKKHRLH---GLRGETSSKSLEAMVKNTGKESLQWGLAAG  117

Query  25   MYSGLTYG  2
            +YSGLTYG
Sbjct  118  IYSGLTYG  125



>ref|XP_010440195.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=175

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  340  ETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNT  161
            E R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V+G   ++
Sbjct  5    EGRIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDS  64

Query  160  SAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + V    + +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  65   NNVGPPSENKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  116



>gb|AEV46836.1| plastid OEP16.2 [Pisum sativum]
Length=182

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 93/123 (76%), Gaps = 9/123 (7%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-  176
            SS +ETR++LD++ +F++ G  +LGHPL+NR+AE+F+K+AG+GA QAV+R+ + +A+ G 
Sbjct  6    SSEVETRTMLDDLCNFDRKGLFDLGHPLVNRIAESFVKAAGIGAAQAVSRDAYFSAIDGT  65

Query  175  -----GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGL  11
                 G K +S V+   K+RL   P L+GE + KS+EA++ + GKE++QWG AAG+YSGL
Sbjct  66   RTDNNGVKASSDVSATGKRRL---PGLRGETSNKSLEAMVIDAGKESLQWGVAAGLYSGL  122

Query  10   TYG  2
            TYG
Sbjct  123  TYG  125



>gb|EAY89687.1| hypothetical protein OsI_11222 [Oryza sativa Indica Group]
 gb|EAY89693.1| hypothetical protein OsI_11229 [Oryza sativa Indica Group]
Length=188

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 9/125 (7%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S+LETR+ LDE+R  E+   ++LGHPLLNRVAE+F+K+AG+GA+QAVARE +  A++G C
Sbjct  7    SSLETRTFLDEVRGLEKNWMVDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMAMEGTC  66

Query  169  ---------KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYS  17
                       T AV+ +   R + FPDL G N+ KS EA++ +  KE++QWG AAG++S
Sbjct  67   LVAAATGEGGGTGAVSDSTGARKRSFPDLNGGNSSKSAEAMVKSVSKESLQWGLAAGLHS  126

Query  16   GLTYG  2
            GLTYG
Sbjct  127  GLTYG  131



>ref|XP_003594780.1| hypothetical protein MTR_2g034550 [Medicago truncatula]
 gb|ABD32318.1| Mitochondrial import inner membrane translocase, subunit Tim17/22 
[Medicago truncatula]
 gb|AES65031.1| outer envelope pore protein [Medicago truncatula]
Length=182

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            K SS +ETR+LLDEI  F++ G  +LGHPLLNR+AE+F+K+AG+GA+QAV+RE +  A+ 
Sbjct  4    KTSSEVETRALLDEICSFDRKGLFDLGHPLLNRIAESFVKAAGIGAVQAVSREAYFTAID  63

Query  178  GGCKNTSAVTG---APKKRLQRFP-DLKGENNKKSVEALITNTGKETMQWGFAAGMYSGL  11
            G   +   V     +P  + +R P  L+GE + KS++A++ NTGKE++QWG AAG+YSGL
Sbjct  64   GHKVDKGGVIPQDVSPTNK-RRLPAGLRGETSNKSLDAMVINTGKESLQWGVAAGIYSGL  122

Query  10   TYG  2
            TYG
Sbjct  123  TYG  125



>ref|XP_006651306.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Oryza brachyantha]
Length=179

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S+LETR+ LDE+R  E+   L+LGHPLLNRVAE+F+K+AG+GA+QAVARE +  A++G  
Sbjct  7    SSLETRTFLDEVRGLEKNWMLDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMAMEGEG  66

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                AV+ +   R + FPDL G N+ KS EA++ +  KE++QWG AAG++SGLTYG
Sbjct  67   GGAGAVSDSTGARKRSFPDLNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGLTYG  122



>ref|XP_010524578.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Tarenaya 
hassleriana]
Length=177

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 6/115 (5%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTS-  158
            R ++DEIR FE+    +LGHPLL+R+A++F+K+AG+GA QAV+RE +S   +G   ++S 
Sbjct  7    RKVMDEIRRFEKLPLFDLGHPLLDRIADSFVKAAGIGAAQAVSREAYSTVFEGTGLDSSV  66

Query  157  ---AVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               +   A KK   RFP+L GE++ KS+EAL+ NTGKE+MQWG AAG+YSGLTYG
Sbjct  67   PPPSEVSASKK--NRFPNLNGESSTKSLEALVKNTGKESMQWGLAAGLYSGLTYG  119



>gb|EPS72464.1| hypothetical protein M569_02294, partial [Genlisea aurea]
Length=167

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -1

Query  340  ETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNT  161
            ETRS LD+IR+F++  F +LGHP+LNR+A++F+++A + ++QAV RE +  A++ G    
Sbjct  1    ETRSFLDDIRNFDRGCFFDLGHPILNRMADSFVRAAVISSVQAVTREAYFTAIETGGIVK  60

Query  160  SAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            S     P+K+   FP+L+GE+++KSVEAL+ +TGKE++QWG AAG+YSGLTYG
Sbjct  61   SET--GPQKKNHPFPELRGEDSRKSVEALVKSTGKESLQWGMAAGLYSGLTYG  111



>ref|XP_010434869.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010449838.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X1 [Camelina sativa]
Length=175

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V+G   +++ 
Sbjct  7    RIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDSNN  66

Query  154  VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            V    + +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   VGPPSENKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  116



>ref|XP_010440196.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=173

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -1

Query  340  ETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNT  161
            E R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V+G   N 
Sbjct  5    EGRIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGFDSNN  64

Query  160  SAVTGAP-KKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                G P + +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  65   ---VGPPSENKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  114



>gb|AFK34430.1| unknown [Lotus japonicus]
Length=184

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 11/127 (9%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQC-GFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAV  182
            K SS +ETR+LLD++  F++  G   LGHPLLNR+AE F+K+AG+GA+QAV+REG+S  +
Sbjct  4    KTSSEVETRALLDKVSSFDKNEGLFNLGHPLLNRIAECFVKAAGIGAVQAVSREGYSITI  63

Query  181  QG--GCKNTSA-----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGM  23
            QG  G  + +      ++GA K  L   P L+GE N KS EA++  +GKE++QWG AAG+
Sbjct  64   QGTRGVDSNNGSIPPELSGAKKNHL---PGLRGETNSKSFEAMVLKSGKESLQWGVAAGI  120

Query  22   YSGLTYG  2
            YSGLTYG
Sbjct  121  YSGLTYG  127



>ref|XP_010548992.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=179

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEI  FE+    +LGHPLLNR A++F+K+ G+GA+QAV+RE +  AV+    +++ 
Sbjct  7    RKVMDEIISFEKLPLFDLGHPLLNRFADSFVKATGIGALQAVSREAYFTAVEAAGLDSNN  66

Query  154  VTGAPKKRL-----QRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            V   P   +      RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSGLTYG
Sbjct  67   VLSPPPSEVTASKKHRFPNLRGESSSKSLEALVKNTGKESLQWGLAAGLYSGLTYG  122



>ref|XP_010548993.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=177

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 9/117 (8%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNT--  161
            R ++DEI  FE+    +LGHPLLNR A++F+K+ G+GA+QAV+RE +  AV+G   N   
Sbjct  7    RKVMDEIISFEKLPLFDLGHPLLNRFADSFVKATGIGALQAVSREAYFTAVEGLDSNNVL  66

Query  160  ----SAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                S VT + K    RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSGLTYG
Sbjct  67   SPPPSEVTASKK---HRFPNLRGESSSKSLEALVKNTGKESLQWGLAAGLYSGLTYG  120



>ref|XP_003558089.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Brachypodium distachyon]
Length=174

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S  E R  +DE+R  E+   L+LGHPLLNRVA++F K+AG+GAIQAV R+ +  AV+G  
Sbjct  2    STHEARKFVDEVRGLEKNWMLDLGHPLLNRVADSFAKAAGIGAIQAVTRDSYFMAVEGES  61

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              T AV+ A   R + F D+KG NN KS E ++ +  KE+ QWG AAGM+SGLTYG
Sbjct  62   GGTGAVSDATGTRKRTFGDIKGTNNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYG  117



>ref|XP_006282840.1| hypothetical protein CARUB_v10006765mg [Capsella rubella]
 gb|EOA15738.1| hypothetical protein CARUB_v10006765mg [Capsella rubella]
Length=173

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V G   N   
Sbjct  7    RMVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGFDSNNVG  66

Query  154  VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                 KK   RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   PPSESKK--HRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  114



>ref|XP_010434870.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X2 [Camelina sativa]
 ref|XP_010449839.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X2 [Camelina sativa]
Length=173

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V+G   N   
Sbjct  7    RIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGFDSNN--  64

Query  154  VTGAP-KKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              G P + +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  65   -VGPPSENKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  114



>ref|NP_567488.1| outer envelope pore protein 16-2 [Arabidopsis thaliana]
 gb|AAM65873.1| pore protein homolog [Arabidopsis thaliana]
 gb|AEE83705.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=176

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 8/115 (7%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNT--  161
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V G   N   
Sbjct  7    RIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGFDSNNVG  66

Query  160  --SAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              S +TG  K    RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   PPSEITGNKK---HRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  117



>ref|XP_002870177.1| ATOEP16-2/ATOEP16-S [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46436.1| ATOEP16-2/ATOEP16-S [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   128 bits (321),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 89/115 (77%), Gaps = 6/115 (5%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V+G   +++ 
Sbjct  7    RMVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDSNN  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            V G P +    +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   V-GPPSEITGNKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  119



>ref|XP_004508261.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cicer arietinum]
Length=175

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 12/122 (10%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-  176
            SSNLETRSLLDE+  F + G  + GHPL+NR+AE+F+K+AG+GA+QAV+RE +  A++G 
Sbjct  4    SSNLETRSLLDELSTFNKGGIFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTAIEGT  63

Query  175  GCKNTSA----VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
            G  NTS     ++ A K RL     L+GE + KS+EA++    K T QWG AAG+YSGLT
Sbjct  64   GIDNTSGMPPEISAAKKHRLH---GLRGETSSKSIEAMV----KSTFQWGLAAGLYSGLT  116

Query  7    YG  2
            YG
Sbjct  117  YG  118



>ref|XP_008786243.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Phoenix dactylifera]
Length=173

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSSN    +LL EIR  E+  F +LGHPLLNRVAE+F+K+AG+GAIQAV+RE +  AV+G
Sbjct  1    MSSN---SNLLGEIRSLEKGWFFDLGHPLLNRVAESFVKAAGIGAIQAVSREAYFTAVEG  57

Query  175  GCKNTSAV-TGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               +  A+       +  R  DL+GEN  KS+EA++ NTGKE+ QWG AAG+YSG+TYG
Sbjct  58   AGVDPGAMPPDMTSGKRHRLSDLRGENCNKSLEAMVKNTGKESFQWGMAAGLYSGVTYG  116



>gb|AAV84280.1| dehydration up-regulated putative membrane pore protein [Xerophyta 
humilis]
Length=178

 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -1

Query  352  SSNLETRSLLDEIRH-FEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            +++L+TR+  DEI+  +++    +LGHPLLNRV E+F+K+AG+GAIQAV REG+   V+G
Sbjct  4    TTSLDTRTFTDEIKGGWDKGWMFDLGHPLLNRVTESFVKAAGIGAIQAVTREGYFITVEG  63

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               N          +  RFP+L+GEN+ KS+E ++  TGKE  QWG AAG+YSGLTYG
Sbjct  64   SRSNNDGTPDMTAGKNNRFPNLRGENSSKSLEEMVKATGKEAFQWGLAAGVYSGLTYG  121



>dbj|BAJ86836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=180

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            KMSS+ E R  ++E+R  E+   LELGHPLLNRVA++F+K+AG+GA+QAVAR+ +  A++
Sbjct  5    KMSSH-EARKFVEEVRGLEKNWMLELGHPLLNRVADSFVKAAGIGAMQAVARDSYFMAIE  63

Query  178  GGCKNTSAVTGAPKKRLQRFPDLK-GENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            G    T AV+ A   R + FPDL  G +N KS E ++ +  KE+ QWG AAGM+SGLTYG
Sbjct  64   GESGGTGAVSDATGSRKRTFPDLNGGTSNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYG  123



>ref|NP_849394.1| outer envelope pore protein 16-2 [Arabidopsis thaliana]
 sp|Q0WMZ5.1|OP162_ARATH RecName: Full=Outer envelope pore protein 16-2, chloroplastic; 
AltName: Full=Chloroplastic outer envelope pore protein of 
16 kDa 2; Short=AtOEP16-2; Short=OEP16-2; AltName: Full=Outer 
plastid envelope protein 16-S; Short=AtOEP16-S; Short=Seeds 
outer plastid envelope protein 16 [Arabidopsis thaliana]
 dbj|BAF01505.1| pore protein homolog [Arabidopsis thaliana]
 gb|AEE83706.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=178

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V G   +++ 
Sbjct  7    RIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGAGFDSNN  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            V G P +    +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   V-GPPSEITGNKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  119



>ref|XP_009107889.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brassica rapa]
Length=178

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 85/115 (74%), Gaps = 6/115 (5%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V G     S 
Sbjct  7    RKVMDEIRSFEKASLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGAGFEASN  66

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + G P +    +  RFP+L GE++ KS++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  67   M-GPPSENAGSKKHRFPNLSGESS-KSLDALVKNTGKESLQWGLAAGLYSGITYG  119



>ref|XP_006414382.1| hypothetical protein EUTSA_v10026380mg [Eutrema salsugineum]
 gb|ESQ55835.1| hypothetical protein EUTSA_v10026380mg [Eutrema salsugineum]
Length=175

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 86/115 (75%), Gaps = 8/115 (7%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R+++DEIR FE+    +LGHPLLNR+A++F+K+AGVGA+QAV+RE +   V G     S+
Sbjct  6    RNVMDEIRSFEKASLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDG---FDSS  62

Query  154  VTGAPKK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              G P +    +  RFP+L+GE++ KS++AL+ NTGKE++QWG AAG+YSG+ YG
Sbjct  63   NLGPPSENNGSKKHRFPNLRGESS-KSLDALVKNTGKESLQWGLAAGLYSGIAYG  116



>ref|XP_010228715.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Brachypodium distachyon]
Length=175

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S  E R  +DE+R  E+   L+LGHPLLNRVA++F K+AG+GAIQAV R+ +  AV+G  
Sbjct  2    STHEARKFVDEVRGLEKNWMLDLGHPLLNRVADSFAKAAGIGAIQAVTRDSYFMAVEGES  61

Query  169  KNTSAVTGAPKKRLQRFPDLK-GENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              T AV+ A   R + F D+K G NN KS E ++ +  KE+ QWG AAGM+SGLTYG
Sbjct  62   GGTGAVSDATGTRKRTFGDIKAGTNNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYG  118



>ref|XP_003609756.1| hypothetical protein MTR_4g121900 [Medicago truncatula]
Length=194

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 23/137 (17%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-  176
            +SNLETR+LLDE+  F + G  + GHPL+NR+AE+F+K+AG+GA+QAV+RE +   ++G 
Sbjct  4    NSNLETRTLLDELSDFNKGGLFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTVIEGT  63

Query  175  GCKNTSA----VTGAPKKRLQRFPDLKGENNKKSVEALIT---------------NTGKE  53
            G  N       ++GA K    RF  L+GE + KS+EA+++               NTGKE
Sbjct  64   GIDNAGGMPPEISGAKK---NRFHGLRGETSSKSIEAMVSSCVQESCCLTVAYVKNTGKE  120

Query  52   TMQWGFAAGMYSGLTYG  2
            + QWG AAG+YSGLTYG
Sbjct  121  SFQWGLAAGLYSGLTYG  137



>ref|XP_006419409.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
 gb|ESR32649.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
Length=151

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 78/118 (66%), Gaps = 24/118 (20%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M+SN+E RSL  E+  FE+ GF +LGHPLLNR+ E+F+K+AG+GAIQAV RE +      
Sbjct  1    MTSNMENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAY------  54

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                              F  ++GE N+KS+EA++ NTGKE++QWG  AG+YSGLTYG
Sbjct  55   ------------------FTAVEGETNRKSLEAMVKNTGKESLQWGVVAGIYSGLTYG  94



>ref|XP_008458360.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Cucumis 
melo]
Length=177

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFL-ELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            S +++  SL+DEIR      FL +LGHPLLNRVA++F+K+AG+GA+Q+V+RE +      
Sbjct  3    SRSIDNLSLVDEIRCTHSGPFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGS  62

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               N+         R QRFP LKGE NK+S+EA++ + GKE++QWG AAG+YSGLTYG
Sbjct  63   VDSNSVPPPELSSIRKQRFPGLKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYG  120



>gb|EMS68749.1| hypothetical protein TRIUR3_14005 [Triticum urartu]
Length=189

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 16/133 (12%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MSS+ ETR  +DE+R  E+   L+LGHPLLNRVA++F+K+AG+GAIQAV R+ +  A++G
Sbjct  1    MSSH-ETRKFVDEVRGLEKNWMLDLGHPLLNRVADSFVKAAGIGAIQAVTRDSYFMAIEG  59

Query  175  GCKNTSAVTGAPKKRLQRFPDLK-GENNKKSVEALITNTGKETMQW--------------  41
                T AV+GA     + FPDL  G +N KS EA++ +  KE+ QW              
Sbjct  60   ESGGTGAVSGATGSSKRTFPDLNGGTSNSKSAEAMVKSVSKESFQWGKQCSPYNFVDVVA  119

Query  40   GFAAGMYSGLTYG  2
            G AAGM+SGLTYG
Sbjct  120  GLAAGMHSGLTYG  132



>gb|KGN47380.1| hypothetical protein Csa_6G307410 [Cucumis sativus]
Length=226

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFL-ELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            S +++  S++DEIR      FL +LGHPLLNRVA++F+K+AG+GA+Q+V+RE +      
Sbjct  52   SRSIDNLSMVDEIRCSHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGS  111

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               N +        R QRFP LKGE NK+S+EA++ + GKE++QWG AAG+YSGLTYG
Sbjct  112  VDSNIAPPPELSSMRKQRFPGLKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYG  169



>ref|XP_004172663.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like, 
partial [Cucumis sativus]
Length=222

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFL-ELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            S +++  S++DEIR      FL +LGHPLLNRVA++F+K+AG+GA+Q+V+RE +      
Sbjct  48   SRSIDNLSMVDEIRCSHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGS  107

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               N +        R QRFP LKGE NK+S+EA++ + GKE++QWG AAG+YSGLTYG
Sbjct  108  VDSNIAPPPELSSMRKQRFPGLKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYG  165



>ref|XP_007035758.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 2 [Theobroma cacao]
 gb|EOY06684.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 2 [Theobroma cacao]
Length=201

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 97/145 (67%), Gaps = 28/145 (19%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS+NLETRSLLD+ R+F++  F +LGHPLLNR+AE+F+K+AG+GAIQA ARE    AV+G
Sbjct  1    MSTNLETRSLLDDWRNFDKGCFFDLGHPLLNRIAESFVKAAGIGAIQAAARESCFIAVEG  60

Query  175  G-CKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALIT-----------------------  68
                N+  +TG+  K+  RFPDL+GE N+KS+EA++                        
Sbjct  61   TESSNSPDITGSKNKK-NRFPDLRGETNRKSLEAMVPAIPEDILLIYFFCFIQVIFNNIL  119

Query  67   ---NTGKETMQWGFAAGMYSGLTYG  2
               +TGKE++QWG AAG+YSGLTYG
Sbjct  120  QVKSTGKESLQWGLAAGLYSGLTYG  144



>ref|XP_003567585.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brachypodium distachyon]
Length=174

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            MS+ L+TR+L DE+ + ++   L+LGHPLLNRVA++F+++AGVGA +AV+RE +   V+G
Sbjct  1    MSTRLDTRTLKDEVANMDKRPLLDLGHPLLNRVADSFIRAAGVGATRAVSREAYFVTVEG  60

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                 +A   +  KR   F  ++G++ +KS++A++ + GKE  QWG AAG+YSG+TYG
Sbjct  61   LGSGDAAALDSNAKR-NHFSSIRGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGITYG  117



>ref|XP_004148230.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cucumis sativus]
Length=272

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFL-ELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            S +++  S++DEIR      FL +LGHPLLNRVA++F+K+AG+GA+Q+V+RE +      
Sbjct  98   SRSIDNLSMVDEIRCSHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGS  157

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               N +        R QRFP LKGE NK+S+EA++ + GKE++QWG AAG+YSGLTYG
Sbjct  158  VDSNIAPPPELSSMRKQRFPGLKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYG  215



>ref|XP_004984632.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Setaria italica]
Length=177

 Score =   117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 88/123 (72%), Gaps = 8/123 (7%)
 Frame = -1

Query  355  MSSNLET--RSLLDEIRH-FE-QCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSA  188
            MS ++ET  R+  DE+R   E +   L+LGHPLLNR+AE+F+K+AG+GA+QAVARE +  
Sbjct  1    MSGSMETQARAFADEVRGGLEGKSWMLDLGHPLLNRIAESFVKAAGIGAVQAVARESYFM  60

Query  187  AVQGGCKNTSAVTGAPKKRLQRFPDLKGENN-KKSVEALITNTGKETMQWGFAAGMYSGL  11
            A++G      +V+GA   R + FP+L G N+  KS EA++ N  KE++QWG AAG++SGL
Sbjct  61   AIEG---EGGSVSGATGSRKRSFPELNGTNSGSKSAEAMVKNVSKESLQWGLAAGVHSGL  117

Query  10   TYG  2
            TYG
Sbjct  118  TYG  120



>emb|CDY09710.1| BnaC07g33510D [Brassica napus]
Length=183

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = -1

Query  319  EIRHFE--QCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTG  146
            EI+ FE  +    +LGHPLLN +A++ +K+AGVGA+QAV+RE +   V G   ++S   G
Sbjct  21   EIKRFENEKASLFDLGHPLLNSIADSVVKAAGVGALQAVSREAYFTVVDGAGSDSSENNG  80

Query  145  APKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + K    RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  81   SNK---HRFPNLRGESS-KSLEALVKNTGKESLQWGLAAGLYSGITYG  124



>ref|XP_004295096.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=185

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = -1

Query  319  EIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAP  140
            E   FE+    +LGHPLLNR+AE+F+K+AG+GA+QAV+RE +  A +     +S   G P
Sbjct  21   EFPGFEKGAMFDLGHPLLNRIAESFVKAAGIGAVQAVSREAYFTATEASGLGSS--NGTP  78

Query  139  KK----RLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                  +  RFPDL+G N+ KS+EA++ +TGKE++QWG AAG+YSGLTYG
Sbjct  79   PDISGHKKNRFPDLRGGNSSKSLEAMVKHTGKESLQWGLAAGVYSGLTYG  128



>ref|XP_009136748.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brassica rapa]
Length=183

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = -1

Query  319  EIRHFE--QCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTG  146
            EI+ FE  +    +LGHPLLN +A++F+K+AGVGA+QAV+RE +     G   ++S   G
Sbjct  21   EIKRFENEKASLFDLGHPLLNSIADSFVKAAGVGALQAVSREAYFTVADGAGSDSSENNG  80

Query  145  APKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + +    RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  81   SKQ---HRFPNLRGESS-KSLEALVKNTGKESLQWGLAAGLYSGITYG  124



>emb|CDX90540.1| BnaA03g42410D [Brassica napus]
Length=174

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = -1

Query  319  EIRHFE--QCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTG  146
            EI+ FE  +    +LGHPLLN +A++F+K+AGVGA+QAV+RE +     G   ++S   G
Sbjct  12   EIKRFENEKASLFDLGHPLLNSIADSFVKAAGVGALQAVSREAYFTVADGAGSDSSENNG  71

Query  145  APKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + +    RFP+L+GE++ KS+EAL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  72   SKQ---HRFPNLRGESS-KSLEALVKNTGKESLQWGLAAGLYSGITYG  115



>gb|ACG48163.1| hypothetical protein [Zea mays]
 tpg|DAA45003.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=178

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = -1

Query  355  MSSNLET--RSLLDEIR-HFEQCGF-LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSA  188
            M+S ++T  R+L DE+R   E   + L+LGHPLLNRVAE+F K+AG+GA+QAVARE +  
Sbjct  1    MNSGVDTQARALADEVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFM  60

Query  187  AVQGGCKNTSAVTGAPKKRLQRFPDLKGENNK--KSVEALITNTGKETMQWGFAAGMYSG  14
            A +G   + S  TGA K+    FP+L G N+   KS EA++ +  KE++QWG AAG++SG
Sbjct  61   ATEGEGGSVSGATGARKR---SFPELNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHSG  117

Query  13   LTYG  2
            LTYG
Sbjct  118  LTYG  121



>gb|EPS58527.1| hypothetical protein M569_16286, partial [Genlisea aurea]
Length=175

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 7/119 (6%)
 Frame = -1

Query  346  NLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGF----SAAVQ  179
            NL+TRS  DE++ F+     +LGHPLLNR+ E+F+K+AGVGA+QA++R+        + Q
Sbjct  3    NLQTRSFFDELKGFDGDDLFDLGHPLLNRIGESFIKAAGVGAVQALSRQTVLKIHDVSGQ  62

Query  178  GGCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                N     G+  KR + F  L GENN KSVEAL+ ++GKE+++WG AAG+YSG++YG
Sbjct  63   NSSDNPHETGGS--KRYRCFLGL-GENNSKSVEALVKSSGKESLKWGLAAGIYSGVSYG  118



>gb|EAZ26649.1| hypothetical protein OsJ_10553 [Oryza sativa Japonica Group]
Length=162

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 17/116 (15%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S+LETR+ LDE+R  E+   ++LGHPLLNRVAE+F+K+AG        R G   AV    
Sbjct  7    SSLETRTFLDEVRGLEKNWMVDLGHPLLNRVAESFVKAAG-------GRLGARGAV----  55

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               S  TGA K+    FPDL G N+ KS EA++ +  KE++QWG AAG++SGLTYG
Sbjct  56   ---SDSTGARKRS---FPDLNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGLTYG  105



>emb|CAB10395.1| pore protein homolog [Arabidopsis thaliana]
 emb|CAB78658.1| pore protein homolog [Arabidopsis thaliana]
Length=160

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 16/111 (14%)
 Frame = -1

Query  334  RSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSA  155
            R ++DEIR FE+    +LGHPLLNR+A++F+K+AGV          F +   G     S 
Sbjct  7    RIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVS---------FDSNNVG---PPSE  54

Query  154  VTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            +TG  K    RFP+L+GE++K S++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  55   ITGNKK---HRFPNLRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYG  101



>gb|EMT25997.1| hypothetical protein F775_27388 [Aegilops tauschii]
Length=271

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 8/119 (7%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            KMSS+ E R  ++E+R  E+   L+LGHPLLNRVA++F+K+AG+GAIQAV R+ +  A++
Sbjct  104  KMSSH-EARKFVEEVRGLEKKWMLDLGHPLLNRVADSFVKAAGIGAIQAVTRDSYFMAME  162

Query  178  GGCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            G    T AV+ A   R + FPDL GE  ++ V  +  +        G AAGM+SGLTYG
Sbjct  163  GESGGTGAVSDATGSRKRTFPDLSGEKRQQGVVPVGLDA-------GLAAGMHSGLTYG  214



>ref|NP_001142523.1| uncharacterized protein LOC100274762 [Zea mays]
 gb|ACG24745.1| hypothetical protein [Zea mays]
Length=179

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 10/125 (8%)
 Frame = -1

Query  355  MSSNLET--RSLLDEIR-HFEQCGF-LELGHPLLNRVAEAFLKSAGVGAIQAVAREG-FS  191
            M+S ++T  R+   E+R   E   + L+LGHPLLNRVAE+F K+AG+GA+QAVARE  F 
Sbjct  1    MNSGVDTQARAFAGEVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFM  60

Query  190  AAVQGGCKNTSAVTGAPKKRLQRFPDLKGENNK--KSVEALITNTGKETMQWGFAAGMYS  17
            A    G  + S  TGA K+    FP+L G N+   KS EA++ +  KE++QWG AAG++S
Sbjct  61   ATEGEGGGSVSGATGARKR---SFPELNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHS  117

Query  16   GLTYG  2
            GLTYG
Sbjct  118  GLTYG  122



>gb|ACG25972.1| hypothetical protein [Zea mays]
Length=179

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 84/124 (68%), Gaps = 8/124 (6%)
 Frame = -1

Query  355  MSSNLET--RSLLDEIR-HFEQCGF-LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSA  188
            M+S ++T  R+   E+R   E   + L+LGHPLLNRVAE+F K+AG+GA+QAVARE +  
Sbjct  1    MNSGVDTQARAFAGEVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFM  60

Query  187  AVQGGCKNTSAVTGAPKKRLQRFPDLKGENNK--KSVEALITNTGKETMQWGFAAGMYSG  14
            A +G    + + T   +KR   FP+L G N+   KS EA++ +  KE++QWG AAG++SG
Sbjct  61   ATEGEGGGSVSGTTGARKR--SFPELNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHSG  118

Query  13   LTYG  2
            LTYG
Sbjct  119  LTYG  122



>ref|XP_006645799.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Oryza brachyantha]
Length=173

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M S L+TR+L DE+   ++   ++LGHPL+NRVA++F+++AGVGA +AV+RE +   V+G
Sbjct  1    MGSRLDTRTLKDEVASMDKRWLVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFVTVEG  60

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                T+ + G  K+    F  ++G++ +KS++A++ + GKE  QWG AAG+YSGLTYG
Sbjct  61   LGGETAGLDGNVKR--SNFSSVRGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLTYG  116



>ref|XP_004967558.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Setaria italica]
Length=174

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S L+TR+L DE+ + ++   L+LGHPLLNRVA++F+++AGVGA +AV+RE +   V+G  
Sbjct  2    SRLDTRTLKDELTNMDRRPLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVTVEGLS  61

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             +++ +     KR   F  ++G++++KS++A++   GKE  QWG AAG+YSGLTYG
Sbjct  62   GDSAGLDPNGGKR-SHFSSIRGDDSQKSLDAVVKTAGKEAFQWGLAAGVYSGLTYG  116



>gb|EMS47409.1| hypothetical protein TRIUR3_06756 [Triticum urartu]
Length=187

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = -1

Query  358  KMSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQ  179
            +M S L+ R+L DE+   ++   L+LGHPLLNRVA++F+++AGVGA +AV+RE +  AV+
Sbjct  14   EMGSRLDARTLKDEVASMDRRPLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVE  73

Query  178  GGCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            G   +++ +    K+    F   +G++ +KS++A++ +  KE +QWG AAG+YSG+TYG
Sbjct  74   GMGGDSTGLDSTAKR--NHFSSARGDDGQKSLDAVVKSASKEAIQWGLAAGVYSGITYG  130



>ref|NP_001152606.1| LOC100286246 [Zea mays]
 gb|ACG40477.1| stress-inducible membrane pore protein [Zea mays]
 gb|ACG48502.1| stress-inducible membrane pore protein [Zea mays]
 tpg|DAA54343.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=174

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S L+TR+L DE+   ++   ++LGHPLLNRVA++F+++AGVGA +AV+RE +   V+G  
Sbjct  2    STLDTRTLKDELTSMDRKCLVDLGHPLLNRVADSFIRAAGVGAARAVSREAYVVTVEGLS  61

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
             ++S +     KR   F  ++G++ ++S++A++   GKE  QWG AAG+YSGLTY
Sbjct  62   GDSSGLDADGGKR-SHFSSIRGDDGQRSLDAVVKTAGKEAFQWGLAAGVYSGLTY  115



>gb|ADK88900.1| outer membrane channel protein OEP16-2 [Triticum aestivum]
Length=173

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M S L+  +L DE+   ++   L+LGHPLLNRVA++F+++AGVGA +AV+RE +  AV+G
Sbjct  1    MGSRLDAHTLKDEVASMDRRPLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVEG  60

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               +++ +    K+    F   +G++ +KS++A++ +  KE +QWG AAG+YSG+TYG
Sbjct  61   MWGDSTGLDSTAKR--SHFSSARGDDGQKSLDAVVKSASKEAIQWGLAAGVYSGITYG  116



>ref|XP_006839205.1| hypothetical protein AMTR_s02234p00007680 [Amborella trichopoda]
 gb|ERN01774.1| hypothetical protein AMTR_s02234p00007680 [Amborella trichopoda]
Length=142

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -1

Query  229  VGAIQAVAREGFSAAVQGGCKNTSAVTGAPK-KRLQRFPDLKGENNKKSVEALITNTGKE  53
            +GA+QAV RE +  A++G   +TS V  A K  R QR PDLKGE   KS+EA++  TGKE
Sbjct  9    IGAVQAVCREAYFTALEGAGLDTSGVPDASKLARRQRLPDLKGETCAKSLEAMVKQTGKE  68

Query  52   TMQWGFAAGMYSGLTYG  2
            ++QWG AAGMYSG+TYG
Sbjct  69   SIQWGLAAGMYSGITYG  85



>gb|EEC70487.1| hypothetical protein OsI_01558 [Oryza sativa Indica Group]
 gb|EEE54412.1| hypothetical protein OsJ_01451 [Oryza sativa Japonica Group]
Length=172

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -1

Query  352  SSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGG  173
            SS L+T +L +E+   ++   ++LGHPL+NRVA++F+++AGVGA +AV+RE +   V+G 
Sbjct  3    SSRLDTWTLKEEVASMDKRWLVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFVTVEGL  62

Query  172  CKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              +T+ +  A K+    F   +G++ +KS++A++ + GKE  QWG AAG+YSGLTYG
Sbjct  63   GGDTAGLDNAVKR--SNFS--RGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLTYG  115



>dbj|BAB20636.1| putative stress-inducible membrane pore protein [Oryza sativa 
Japonica Group]
 dbj|BAB93165.1| putative stress-inducible membrane pore protein [Oryza sativa 
Japonica Group]
Length=263

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  343  LETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKN  164
            L+T +L +E+   ++   ++LGHPL+NRVA++F+++AGVGA +AV+RE +   V+G   +
Sbjct  97   LDTWTLKEEVASMDKRWLVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFVTVEGLGGD  156

Query  163  TSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            T+ +  A K+    F   +G++ +KS++A++ + GKE  QWG AAG+YSGLTYG
Sbjct  157  TAGLDNAVKR--SNF--SRGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLTYG  206



>gb|AAL23749.1| stress-inducible membrane pore protein [Bromus inermis]
Length=157

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             L+LGHPLLNRVA++F+++AGVGA +AV+RE +   V+G   +++ +    K+    F  
Sbjct  6    LLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVTVEGMGGDSTGLDSNAKR--SHFSS  63

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             +G++ +KS E ++ + GKE  QWG AAG+YSGLTYG
Sbjct  64   ARGDDGQKSFEVVVKSAGKEAFQWGLAAGVYSGLTYG  100



>tpg|DAA54342.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=104

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = -1

Query  349  SNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGC  170
            S L+TR+L DE+   ++   ++LGHPLLNRVA++F+++AGVGA +AV+RE +   V+G  
Sbjct  2    STLDTRTLKDELTSMDRKCLVDLGHPLLNRVADSFIRAAGVGAARAVSREAYVVTVEGLS  61

Query  169  KNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETMQWG  38
             ++S +     KR   F  ++G++ ++S++A++   GKE  QWG
Sbjct  62   GDSSGLDADGGKR-SHFSSIRGDDGQRSLDAVVKTAGKEAFQWG  104



>emb|CAK26794.1| hypothetical protein [Sporobolus stapfianus]
Length=130

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -1

Query  226  GAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEALITNTGKETM  47
            GA QA+ARE +  A+  G   + + +   KKR   FPDL G N+ KS EAL+ N  KE++
Sbjct  1    GAAQALARESYFMAIDAGEGGSVSGSTGSKKR--SFPDLNGSNSSKSAEALVKNVSKESL  58

Query  46   QWGFAAGMYSGLTYG  2
            QWG AAG++SGLTYG
Sbjct  59   QWGLAAGVHSGLTYG  73



>ref|XP_001761140.1| predicted protein [Physcomitrella patens]
 gb|EDQ74207.1| predicted protein [Physcomitrella patens]
Length=147

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 24/97 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             ++LGHPLLNRV + F+K  GVGA+ A +++ +   +Q                      
Sbjct  18   LVDLGHPLLNRVVDGFVKVGGVGALHAASQDTYLFLLQE---------------------  56

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
               E NKKS+E  +   GKE +QWG  AG+Y+G+TYG
Sbjct  57   ---ETNKKSLEKTVQRMGKEAVQWGLVAGVYTGMTYG  90



>ref|XP_001772989.1| predicted protein [Physcomitrella patens]
 gb|EDQ62214.1| predicted protein [Physcomitrella patens]
Length=147

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 24/97 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             ++LGHP+LNRV + F+K  GVGA+ A +++                         RF  
Sbjct  18   LVDLGHPMLNRVVDGFVKVGGVGALHAASQDA-----------------------SRFL-  53

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            L+ E NKKS+E  +   GKE +QWG  AG+Y+G+TYG
Sbjct  54   LQEETNKKSLEMSVQRMGKEAVQWGLVAGVYTGMTYG  90



>ref|XP_002971785.1| hypothetical protein SELMODRAFT_441602 [Selaginella moellendorffii]
 gb|EFJ27534.1| hypothetical protein SELMODRAFT_441602 [Selaginella moellendorffii]
Length=215

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 24/96 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             +++GHPLLNR+ + F+K  G GA+ A A+E      Q                      
Sbjct  18   LIDMGHPLLNRIVDGFIKVGGTGALHAAAQESMRYVSQESA-------------------  58

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
                 NK+S+E  +   GKE +QWG  AG+YSG+TY
Sbjct  59   -----NKRSLEKSVNQMGKECLQWGMVAGIYSGMTY  89



>ref|XP_002963833.1| hypothetical protein SELMODRAFT_438581 [Selaginella moellendorffii]
 gb|EFJ35704.1| hypothetical protein SELMODRAFT_438581 [Selaginella moellendorffii]
Length=147

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (49%), Gaps = 24/96 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             +++GHPLLNR+ + F+K  G GA+ A A+E      Q                      
Sbjct  18   LIDMGHPLLNRIVDGFIKVGGTGALHAAAQESMRYVSQESA-------------------  58

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
                 +K+S+E  +   GKE +QWG  AG+YSG+TY
Sbjct  59   -----DKRSLEKSVNQMGKECLQWGMVAGIYSGMTY  89



>ref|XP_002972844.1| hypothetical protein SELMODRAFT_413476 [Selaginella moellendorffii]
 gb|EFJ26065.1| hypothetical protein SELMODRAFT_413476 [Selaginella moellendorffii]
Length=139

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 23/97 (24%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
              + G+P+LN V + F+K  GVGAIQA ++E +   V                       
Sbjct  9    MFDTGNPMLNSVVDGFIKVGGVGAIQAASKESYRILVH----------------------  46

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                N+++SVE  +   G++++ WG AAGMY+G++YG
Sbjct  47   -DDTNSRRSVERAVQRMGRDSVNWGLAAGMYTGVSYG  82



>ref|XP_001774786.1| predicted protein [Physcomitrella patens]
 gb|EDQ60457.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 18/97 (19%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG-GCKNTSAVTGAPKKRLQRFP  116
             ++LG+PLLNRV + F+K  G+GA+ A A++ +   +QG  C                  
Sbjct  1    MVDLGNPLLNRVVDGFIKVGGIGALHAAAQDSYRLTLQGTNCTF----------------  44

Query  115  DLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
             L    +++S+E      GKE +QWG AAG+Y+G+TY
Sbjct  45   -LYFTTSQRSLEKTARRLGKEALQWGLAAGVYTGVTY  80



>ref|XP_002984416.1| hypothetical protein SELMODRAFT_423634 [Selaginella moellendorffii]
 gb|EFJ14466.1| hypothetical protein SELMODRAFT_423634 [Selaginella moellendorffii]
Length=139

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 23/97 (24%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
              + G+P+LN V + F+K  GVGAIQA ++E +   V                       
Sbjct  9    MFDTGNPMLNSVVDGFIKVGGVGAIQAASKESYRILVH----------------------  46

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                N+++SVE  +   G++++ WG AAGMY+G++YG
Sbjct  47   -DDTNSRRSVERAVQRMGRDSVNWGLAAGMYTGVSYG  82



>gb|KHG03976.1| smek1 [Gossypium arboreum]
Length=997

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREG  197
            MS N E +SL DE+R F++  F +LGHPLLN  A++F+K+AG+GA+QA+ARE 
Sbjct  946  MSGNSEAKSLFDELR-FDKGDFFDLGHPLLNWTAQSFVKTAGIGALQAIAREA  997



>gb|AAT45008.1| stress-inducible membrane pore-like protein, partial [Xerophyta 
humilis]
Length=110

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  127  QRFPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             RFP+L+G+N+ KS+E ++  TGKE  QWG AAG+YSGLTYG
Sbjct  12   NRFPNLRGDNSSKSLEEMVKATGKEAFQWGLAAGVYSGLTYG  53



>gb|EMT04893.1| hypothetical protein F775_26935 [Aegilops tauschii]
Length=139

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = -1

Query  355  MSSNLETRSLLDEIRHFEQCGFLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQG  176
            M S L+ R+L DE+   ++   L+LGHPLLNRVA++F+++AGVGA +AV+RE +  AV+G
Sbjct  1    MGSRLDARTLKDEVASMDRRPLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVEG  60

Query  175  GCKNTSAVTGAPKKRLQRFPDLKGENNKKSVEAL  74
               +++ +    K+    F   +G++ +KS++A+
Sbjct  61   MGGDSTGLDSTAKR--SHFSSARGDDGQKSLDAV  92



>ref|XP_001764509.1| predicted protein [Physcomitrella patens]
 gb|EDQ70776.1| predicted protein [Physcomitrella patens]
Length=147

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 26/97 (27%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             ++LGHPLLN   + FLK  GVGA  AV ++ F                           
Sbjct  18   IVDLGHPLLNYSVDGFLKVGGVGAAHAVVQDTFRI-------------------------  52

Query  112  LKGEN-NKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
            LK E   K  +E L+   G+E +QWG  AG+Y+G+ Y
Sbjct  53   LKSEALTKNDLEKLVKRAGREGLQWGTVAGVYAGVEY  89



>emb|CDY22776.1| BnaA08g06060D [Brassica napus]
Length=148

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = -1

Query  121  FPDLKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            F   +GE++K S++AL+ NTGKE++QWG AAG+YSG+TYG
Sbjct  51   FLIFRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYG  89



>ref|XP_001779980.1| predicted protein [Physcomitrella patens]
 gb|EDQ55189.1| predicted protein [Physcomitrella patens]
Length=146

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (49%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P+LN     FLK A VGA  AV +E F                      + F D 
Sbjct  19   VDIGNPILNSTVNGFLKVAPVGASHAVTQEAF----------------------RMFQDE  56

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            +    K+ +E ++   GK+ +QWG  AG+YSG+ YG
Sbjct  57   R--VTKRDLERMVKRAGKDGLQWGVVAGVYSGVQYG  90



>ref|XP_001777747.1| predicted protein [Physcomitrella patens]
 gb|EDQ57409.1| predicted protein [Physcomitrella patens]
Length=148

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (45%), Gaps = 24/96 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             ++LGHPLLN   + FLK  GVG   A  ++ F                    R+ R   
Sbjct  18   IVDLGHPLLNSSVDGFLKVGGVGVAHAAVQDTF--------------------RILR---  54

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTY  5
               +  K  +E L+   G E +QWG  AG+Y+G+ Y
Sbjct  55   -SDQVTKNDLEKLVRRAGFEGLQWGAVAGVYAGVEY  89



>ref|XP_002972971.1| hypothetical protein SELMODRAFT_413325 [Selaginella moellendorffii]
 ref|XP_002993391.1| hypothetical protein SELMODRAFT_431462 [Selaginella moellendorffii]
 gb|EFJ05576.1| hypothetical protein SELMODRAFT_431462 [Selaginella moellendorffii]
 gb|EFJ26192.1| hypothetical protein SELMODRAFT_413325 [Selaginella moellendorffii]
Length=152

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 13/95 (14%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
            FL+LGHP++NR  EAFLK+  VG + A ++              +A   A         D
Sbjct  12   FLDLGHPVVNRSVEAFLKAGAVGLVHATSQ-------------IAAREAADFVSTSLNSD  58

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLT  8
             K       +E      GK+ +QWG A+G+YS  T
Sbjct  59   KKSSKCPLQLEEAAFTVGKQAVQWGLASGIYSSAT  93



>emb|CAA09867.1| amino acid selective channel protein [Hordeum vulgare subsp. 
vulgare]
Length=144

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 44/96 (46%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLNR  + FLK   VGA + VA + F                     L R    
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDAFDC-------------------LHR----  53

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K+ +E  +    KE   WG  AG+Y G+ YG
Sbjct  54   -GDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYG  88



>gb|EMT26097.1| hypothetical protein F775_31817 [Aegilops tauschii]
Length=144

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLNR  + FLK   VGA + VA + F       C +                  
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDAFD------CIH------------------  52

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            +G+ +K+ +E  +    KE   WG  AG+Y G+ YG
Sbjct  53   RGDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYG  88



>ref|XP_009345977.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345990.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=158

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 43/96 (45%), Gaps = 12/96 (13%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLN   + FLK   V A +AVA + FSAA +                +    D 
Sbjct  19   IDLGNPLLNHTVDGFLKIGTVAATRAVAEDAFSAAKK------------DADHIVLRSDD  66

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G  + K  E  +    KE   WG  AG+Y G  YG
Sbjct  67   DGAISTKDFEHTLKKMCKEGAYWGTVAGVYVGAEYG  102



>gb|ABK21269.1| unknown [Picea sitchensis]
 gb|ABK23889.1| unknown [Picea sitchensis]
 gb|ABK25773.1| unknown [Picea sitchensis]
 gb|ABR17160.1| unknown [Picea sitchensis]
 gb|ACN40778.1| unknown [Picea sitchensis]
 gb|ACN41066.1| unknown [Picea sitchensis]
Length=147

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 44/97 (45%), Gaps = 24/97 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             +++G+PLLNR  + FLK   VGA + +  E +S+                         
Sbjct  18   VIDMGNPLLNRTVDGFLKIGTVGASRVLVEETYSSLS-----------------------  54

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             KG   K  +E  I   G E ++WG  AG+Y+G+ YG
Sbjct  55   -KGSVTKHDLEHTIKKMGIEGLKWGAVAGVYTGVEYG  90



>gb|EEC72263.1| hypothetical protein OsI_05414 [Oryza sativa Indica Group]
Length=146

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (44%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++GHP LNR  + FLK   VGA +  A E F                     L R    
Sbjct  19   VDMGHPFLNRTVDGFLKIGAVGACKVAAEETFEC-------------------LHR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K  VE+ +    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSKHKVESALKKMCKEGAYWGTIAGVYVGMEYG  90



>gb|EMS53533.1| hypothetical protein TRIUR3_34729 [Triticum urartu]
Length=184

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (47%), Gaps = 18/113 (16%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRL------  128
            ++LG+PLLNR  + FLK   VGA + VA + F   +  G  N S ++ +  + +      
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDAFD-CIHRGNHNASRLSYSSIETVLLATGS  75

Query  127  -------QRFPD----LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                      P+      G+ +K+ +E  +    KE   WG  AG+Y G+ YG
Sbjct  76   GFICVDTNVTPNYLGFFAGDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYG  128



>ref|XP_006846173.1| hypothetical protein AMTR_s00012p00202200 [Amborella trichopoda]
 gb|ERN07848.1| hypothetical protein AMTR_s00012p00202200 [Amborella trichopoda]
Length=146

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 41/97 (42%), Gaps = 24/97 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
            F++LGHP LNR  + FLK   VGA +  A E +                        +  
Sbjct  18   FVDLGHPFLNRTFDGFLKIGAVGASRVAAEEAY------------------------YSI  53

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             KG  +K  +E  +    KE   WG  AG+Y G+ YG
Sbjct  54   SKGTVSKHRLEHTLKKMCKEGALWGTVAGLYVGMEYG  90



>ref|XP_006645400.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Oryza brachyantha]
Length=146

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (44%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++GHP LNR  + F+K   VGA +  A E F                     LQR    
Sbjct  19   VDMGHPFLNRTVDGFIKIGAVGACKVAAEETFDC-------------------LQR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ ++  VE  +    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSQHKVERALKKMCKEGAYWGTIAGVYVGMEYG  90



>dbj|BAJ89521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (45%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLNR  + FLK   VGA +  A + F       C  + +V+             
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVAAEDAFD------CLQSGSVS-------------  57

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                 K+ +E  +    KE   WG  AG+Y G+ YG
Sbjct  58   -----KRKLEQTLKKMCKEGAYWGAVAGVYVGMEYG  88



>ref|NP_001151965.1| amino acid selective channel protein [Zea mays]
 gb|ACG36032.1| amino acid selective channel protein [Zea mays]
 gb|ACG36045.1| amino acid selective channel protein [Zea mays]
 gb|ACG45165.1| amino acid selective channel protein [Zea mays]
Length=146

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 41/96 (43%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P LNR  + FLK   VGA +  A E F                     L R    
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEETFEC-------------------LHR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K  VE  +    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSKHKVEHALRKMCKEGAYWGTVAGVYVGMVYG  90



>ref|XP_009345978.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009345991.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=146

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 41/96 (43%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLN   + FLK   V A +AVA + FSAA                         
Sbjct  19   IDLGNPLLNHTVDGFLKIGTVAATRAVAEDAFSAA------------------------K  54

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            KG  + K  E  +    KE   WG  AG+Y G  YG
Sbjct  55   KGAISTKDFEHTLKKMCKEGAYWGTVAGVYVGAEYG  90



>ref|XP_009353670.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=146

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 41/96 (43%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            ++LG+PLLN   + FLK   V A +AVA + FSAA +G                      
Sbjct  19   IDLGNPLLNHTVDGFLKIGTVAATRAVAEDAFSAAKKGAI--------------------  58

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                + K  E  +    KE   WG  AG+Y G  YG
Sbjct  59   ----STKDFEHTLKKMCKEGAYWGTVAGVYVGAEYG  90



>ref|XP_006653965.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Oryza brachyantha]
Length=146

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 42/96 (44%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P LNR  + FLK   VGA +  A E F                     L R    
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEETFDC-------------------LHR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K  +E ++    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSKHRLEHMLKKMCKEGAYWGTIAGVYVGMEYG  90



>ref|NP_001054446.1| Os05g0111200 [Oryza sativa Japonica Group]
 gb|AAU44206.1| putative amino acid selective channel protein [Oryza sativa Japonica 
Group]
 dbj|BAF16360.1| Os05g0111200 [Oryza sativa Japonica Group]
 dbj|BAG95191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78389.1| hypothetical protein OsI_18168 [Oryza sativa Indica Group]
 gb|EEE62078.1| hypothetical protein OsJ_16862 [Oryza sativa Japonica Group]
Length=146

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (44%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P LNR  + FLK   VGA +  A + F                     L R    
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEDTFDC-------------------LHR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K  +E ++    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSKHKLEHMLKKMCKEGAYWGTVAGVYVGMEYG  90



>gb|ACG31308.1| amino acid selective channel protein [Zea mays]
Length=146

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 41/97 (42%), Gaps = 24/97 (25%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             +++G+P LNR  + FLK   VGA +  A E F                     L R   
Sbjct  18   VIDMGNPFLNRTVDGFLKIGAVGACKVAAEETFEC-------------------LHR---  55

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
              G+ +K  VE  ++   KE   WG  AG+Y  + YG
Sbjct  56   --GDVSKHKVEHALSKMCKEGAYWGTVAGVYVSMVYG  90



>ref|XP_004960518.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Setaria italica]
Length=146

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (43%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P LNR  + FLK   VGA +  A E F                     L R    
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEETFEC-------------------LHR----  55

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
             G+ +K  +E  +    KE   WG  AG+Y G+ YG
Sbjct  56   -GDVSKHKLEHALKKMCKEGAYWGTVAGVYVGMVYG  90



>ref|XP_002457029.1| hypothetical protein SORBIDRAFT_03g047420 [Sorghum bicolor]
 gb|EES02149.1| hypothetical protein SORBIDRAFT_03g047420 [Sorghum bicolor]
Length=128

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 39/94 (41%), Gaps = 24/94 (26%)
 Frame = -1

Query  283  LGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDLKG  104
            +GHP LNR  + F++   VG  +  A E F                     LQR     G
Sbjct  1    MGHPFLNRTVDGFIRIGAVGGCKVAAEETFEC-------------------LQR-----G  36

Query  103  ENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            + +K  VE  +    KE   WG  AG+Y G+ YG
Sbjct  37   DVSKHKVEHALKKMCKEGAYWGTVAGVYVGVEYG  70



>gb|ABR16919.1| unknown [Picea sitchensis]
Length=145

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 44/97 (45%), Gaps = 26/97 (27%)
 Frame = -1

Query  292  FLELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPD  113
             +++G+PLLNR  + FLK   VGA + +  E +S+  +G            K  L+    
Sbjct  18   VIDMGNPLLNRTVDGFLKIGTVGASRVLVEETYSSLSKGSV---------TKHDLEH---  65

Query  112  LKGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
                          T  G E ++WG  AG+Y+G+ YG
Sbjct  66   --------------TKMGIEGLKWGAVAGVYTGVEYG  88



>gb|KFK32251.1| hypothetical protein AALP_AA6G217900 [Arabis alpina]
Length=148

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (46%), Gaps = 24/96 (25%)
 Frame = -1

Query  289  LELGHPLLNRVAEAFLKSAGVGAIQAVAREGFSAAVQGGCKNTSAVTGAPKKRLQRFPDL  110
            +++G+P LN   +AFLK   VG  +++A + + A                          
Sbjct  19   IDMGNPFLNLTVDAFLKIGAVGVTKSLAEDTYKAID------------------------  54

Query  109  KGENNKKSVEALITNTGKETMQWGFAAGMYSGLTYG  2
            KG  +K S+E  + N  KE + WG AAG+Y G  YG
Sbjct  55   KGSLSKSSLEDGLKNMCKEGVYWGSAAGVYVGTEYG  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515467473624