BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13835_g1_i2 len=900 path=[1:0-213 215:214-239 2618:240-342
356:343-899]

Length=900
                                                                      Score     E

ref|XP_010316561.1|  PREDICTED: uncharacterized protein LOC101267...    302   4e-91   
ref|XP_006348176.1|  PREDICTED: uncharacterized protein LOC102586818    303   9e-91   
ref|XP_010316559.1|  PREDICTED: uncharacterized protein LOC101267...    303   1e-90   
ref|XP_009591088.1|  PREDICTED: uncharacterized protein LOC104088...    295   1e-88   
emb|CDP01697.1|  unnamed protein product                                296   2e-88   
ref|XP_009591085.1|  PREDICTED: uncharacterized protein LOC104088...    295   7e-88   
ref|XP_009790767.1|  PREDICTED: uncharacterized protein LOC104238...    291   3e-87   
ref|XP_009790764.1|  PREDICTED: uncharacterized protein LOC104238...    291   1e-86   
emb|CAN82853.1|  hypothetical protein VITISV_028768                     259   4e-75   Vitis vinifera
ref|XP_010648895.1|  PREDICTED: uncharacterized protein LOC100253065    259   5e-75   
ref|XP_002526580.1|  Ran GTPase binding protein, putative               257   2e-74   Ricinus communis
ref|XP_006481958.1|  PREDICTED: uncharacterized protein LOC102629590    246   1e-70   
ref|XP_010246209.1|  PREDICTED: uncharacterized protein LOC104589...    244   3e-70   
ref|XP_010246208.1|  PREDICTED: uncharacterized protein LOC104589...    245   4e-70   
ref|XP_010105606.1|  putative E3 ubiquitin-protein ligase HERC1         244   5e-70   
ref|XP_009631453.1|  PREDICTED: uncharacterized protein LOC104121...    243   8e-70   
ref|XP_006372478.1|  regulator of chromosome condensation (RCC1) ...    243   1e-69   
ref|XP_004231705.1|  PREDICTED: uncharacterized protein LOC101256142    241   3e-69   
ref|XP_011038333.1|  PREDICTED: uncharacterized protein LOC105135...    242   6e-69   
ref|XP_009765137.1|  PREDICTED: uncharacterized protein LOC104216716    239   2e-68   
emb|CBI27342.3|  unnamed protein product                                239   3e-68   
gb|KHF97252.1|  putative E3 ubiquitin-protein ligase HERC1              239   4e-68   
ref|XP_011043875.1|  PREDICTED: uncharacterized protein LOC105139209    237   2e-67   
ref|XP_006350488.1|  PREDICTED: uncharacterized protein LOC102583534    236   3e-67   
ref|XP_008227901.1|  PREDICTED: uncharacterized protein LOC103327368    231   3e-65   
ref|XP_010062322.1|  PREDICTED: uncharacterized protein LOC104449763    231   3e-65   
ref|XP_010908615.1|  PREDICTED: uncharacterized protein LOC105034955    229   1e-64   
ref|XP_009631452.1|  PREDICTED: uncharacterized protein LOC104121...    226   1e-63   
ref|XP_009631454.1|  PREDICTED: uncharacterized protein LOC104121...    226   1e-63   
ref|XP_008794532.1|  PREDICTED: uncharacterized protein LOC103710544    226   2e-63   
ref|XP_007146986.1|  hypothetical protein PHAVU_006G086900g             224   1e-62   
ref|XP_006602026.1|  PREDICTED: uncharacterized protein LOC100797...    224   1e-62   
ref|XP_006591312.1|  PREDICTED: uncharacterized protein LOC100794953    220   3e-61   
gb|KHN24172.1|  Putative E3 ubiquitin-protein ligase HERC2              220   3e-61   
ref|XP_006391327.1|  hypothetical protein EUTSA_v10018066mg             214   2e-59   
ref|XP_008454367.1|  PREDICTED: uncharacterized protein LOC103494787    213   9e-59   
ref|XP_002888466.1|  hypothetical protein ARALYDRAFT_475695             213   1e-58   
ref|XP_007216689.1|  hypothetical protein PRUPE_ppa026859mg             212   1e-58   
ref|NP_176767.1|  Regulator of chromosome condensation (RCC1) fam...    211   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124153.1|  PREDICTED: uncharacterized protein LOC103849...    210   8e-58   
ref|XP_010511515.1|  PREDICTED: uncharacterized protein LOC104787607    210   9e-58   
ref|XP_009400323.1|  PREDICTED: uncharacterized protein LOC103984534    210   1e-57   
gb|KFK41026.1|  hypothetical protein AALP_AA2G075500                    209   1e-57   
emb|CDY31624.1|  BnaA06g20390D                                          209   2e-57   
ref|XP_009124152.1|  PREDICTED: uncharacterized protein LOC103849...    209   2e-57   
ref|XP_010470464.1|  PREDICTED: uncharacterized protein LOC104750376    209   2e-57   
ref|XP_009410703.1|  PREDICTED: uncharacterized protein LOC103992609    209   3e-57   
emb|CDX87989.1|  BnaC03g54070D                                          208   3e-57   
ref|XP_004152369.1|  PREDICTED: uncharacterized protein LOC101216037    209   3e-57   
ref|XP_006300666.1|  hypothetical protein CARUB_v10019706mg             209   3e-57   
ref|XP_010528597.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    208   5e-57   
ref|XP_003600638.1|  RCC1 and BTB domain-containing protein             206   3e-56   
ref|XP_004503095.1|  PREDICTED: uncharacterized protein LOC101491261    205   9e-56   
ref|XP_009367145.1|  PREDICTED: probable E3 ubiquitin-protein lig...    204   1e-55   
ref|XP_009367146.1|  PREDICTED: probable E3 ubiquitin-protein lig...    204   1e-55   
emb|CAC84086.1|  ZR1 protein                                            200   3e-54   Medicago sativa [alfalfa]
gb|KFK41025.1|  hypothetical protein AALP_AA2G075500                    198   1e-53   
ref|XP_010415137.1|  PREDICTED: uncharacterized protein LOC104701184    197   2e-53   
ref|XP_008381523.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    197   7e-53   
ref|XP_004156895.1|  PREDICTED: uncharacterized protein LOC101227493    192   2e-51   
gb|KDO57314.1|  hypothetical protein CISIN_1g001683mg                   191   9e-51   
ref|XP_006855611.1|  hypothetical protein AMTR_s00044p00073920          187   2e-49   
ref|XP_010316560.1|  PREDICTED: uncharacterized protein LOC101267...    179   1e-46   
gb|KHN08772.1|  E3 ubiquitin-protein ligase HERC2                       171   7e-44   
ref|XP_009591086.1|  PREDICTED: uncharacterized protein LOC104088...    170   1e-43   
gb|KCW69452.1|  hypothetical protein EUGRSUZ_F02909                     169   2e-43   
ref|XP_009790765.1|  PREDICTED: uncharacterized protein LOC104238...    169   3e-43   
ref|XP_010269341.1|  PREDICTED: uncharacterized protein LOC104606...    169   3e-43   
ref|XP_009350077.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    169   4e-43   
ref|XP_009399981.1|  PREDICTED: uncharacterized protein LOC103984245    169   4e-43   
ref|XP_008385699.1|  PREDICTED: uncharacterized protein LOC103448227    168   6e-43   
gb|AET00240.2|  regulator of chromosome condensation (RCC1) famil...    168   8e-43   
ref|XP_010227233.1|  PREDICTED: uncharacterized protein LOC100842512    168   8e-43   
ref|XP_002313993.2|  zinc finger family protein                         168   9e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010276611.1|  PREDICTED: uncharacterized protein LOC104611308    167   1e-42   
gb|KDP36001.1|  hypothetical protein JCGZ_08396                         167   1e-42   
ref|XP_011090167.1|  PREDICTED: uncharacterized protein LOC105170925    167   2e-42   
ref|XP_010539249.1|  PREDICTED: uncharacterized protein LOC104813389    166   3e-42   
ref|XP_010926966.1|  PREDICTED: uncharacterized protein LOC105049105    166   5e-42   
ref|XP_006595771.1|  PREDICTED: uncharacterized protein LOC100802...    166   5e-42   
ref|XP_008449668.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    166   6e-42   
ref|XP_007141489.1|  hypothetical protein PHAVU_008G200300g             165   1e-41   
ref|XP_010536113.1|  PREDICTED: uncharacterized protein LOC104811189    165   1e-41   
ref|XP_006854768.1|  hypothetical protein AMTR_s00063p00100200          165   1e-41   
ref|XP_010269339.1|  PREDICTED: uncharacterized protein LOC104606...    165   1e-41   
ref|XP_004491255.1|  PREDICTED: uncharacterized protein LOC101508617    165   1e-41   
ref|XP_010269344.1|  PREDICTED: uncharacterized protein LOC104606...    164   1e-41   
ref|XP_010269343.1|  PREDICTED: uncharacterized protein LOC104606...    164   1e-41   
ref|XP_007146313.1|  hypothetical protein PHAVU_006G030000g             164   1e-41   
ref|XP_006575627.1|  PREDICTED: uncharacterized protein LOC100806...    164   1e-41   
gb|KHG00947.1|  putative E3 ubiquitin-protein ligase HERC1              164   1e-41   
ref|XP_006575629.1|  PREDICTED: uncharacterized protein LOC100806...    164   2e-41   
gb|EPS63615.1|  hypothetical protein M569_11169                         164   2e-41   
ref|XP_004953476.1|  PREDICTED: uncharacterized protein LOC101768...    163   2e-41   
ref|XP_008363119.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       164   2e-41   
ref|XP_006400502.1|  hypothetical protein EUTSA_v10012507mg             164   2e-41   
ref|XP_011080399.1|  PREDICTED: uncharacterized protein LOC105163660    164   3e-41   
ref|XP_007015313.1|  Regulator of chromosome condensation (RCC1) ...    163   3e-41   
ref|XP_004513412.1|  PREDICTED: uncharacterized protein LOC101496615    164   3e-41   
ref|XP_007015312.1|  Regulator of chromosome condensation (RCC1) ...    163   3e-41   
ref|XP_007015311.1|  Regulator of chromosome condensation (RCC1) ...    163   3e-41   
ref|XP_006470568.1|  PREDICTED: uncharacterized protein LOC102612...    163   3e-41   
ref|XP_006446270.1|  hypothetical protein CICLE_v10014100mg             163   3e-41   
ref|XP_010269342.1|  PREDICTED: uncharacterized protein LOC104606...    163   3e-41   
ref|XP_004953475.1|  PREDICTED: uncharacterized protein LOC101768...    163   3e-41   
ref|XP_009767054.1|  PREDICTED: uncharacterized protein LOC104218296    163   4e-41   
ref|XP_004291740.1|  PREDICTED: uncharacterized protein LOC101306203    163   5e-41   
ref|XP_002527043.1|  Ran GTPase binding protein, putative               163   5e-41   Ricinus communis
ref|XP_003551961.1|  PREDICTED: uncharacterized protein LOC100791...    163   5e-41   
ref|XP_010673731.1|  PREDICTED: uncharacterized protein LOC104890071    163   6e-41   
ref|XP_002871523.1|  ran GTPase binding protein                         162   6e-41   
ref|NP_568268.3|  Regulator of chromosome condensation-like prote...    162   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799103.1|  PREDICTED: uncharacterized protein LOC103713841    162   6e-41   
ref|XP_006362314.1|  PREDICTED: uncharacterized protein LOC102578724    162   6e-41   
ref|XP_004250909.1|  PREDICTED: uncharacterized protein LOC101265608    162   7e-41   
ref|XP_003545401.1|  PREDICTED: uncharacterized protein LOC100802...    162   8e-41   
gb|KHN12021.1|  Putative E3 ubiquitin-protein ligase HERC1              162   9e-41   
ref|XP_009121854.1|  PREDICTED: uncharacterized protein LOC103846644    162   9e-41   
emb|CDX97187.1|  BnaC09g44380D                                          162   9e-41   
ref|XP_008227676.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       162   9e-41   
ref|XP_010491996.1|  PREDICTED: uncharacterized protein LOC104769476    162   1e-40   
ref|XP_003519514.1|  PREDICTED: uncharacterized protein LOC100806...    162   1e-40   
ref|XP_009630183.1|  PREDICTED: uncharacterized protein LOC104120162    162   1e-40   
ref|XP_010424068.1|  PREDICTED: uncharacterized protein LOC104709101    162   1e-40   
ref|XP_006286948.1|  hypothetical protein CARUB_v10000094mg             162   1e-40   
gb|KHG19721.1|  putative E3 ubiquitin-protein ligase HERC1              162   1e-40   
ref|XP_010519782.1|  PREDICTED: bifunctional serine/threonine-pro...    162   1e-40   
ref|XP_010453304.1|  PREDICTED: uncharacterized protein LOC104735251    162   1e-40   
ref|XP_006286943.1|  hypothetical protein CARUB_v10000090mg             161   2e-40   
ref|XP_008678946.1|  PREDICTED: uncharacterized protein LOC103653...    161   2e-40   
ref|XP_004140201.1|  PREDICTED: uncharacterized protein LOC101207486    161   2e-40   
ref|XP_006575628.1|  PREDICTED: uncharacterized protein LOC100806...    161   2e-40   
ref|XP_003617281.1|  Lateral signaling target protein-like protein      161   2e-40   
gb|KHN38378.1|  Putative E3 ubiquitin-protein ligase HERC1              161   2e-40   
ref|XP_008450356.1|  PREDICTED: uncharacterized protein LOC103491987    161   2e-40   
ref|XP_009603791.1|  PREDICTED: uncharacterized protein LOC104098...    161   2e-40   
ref|XP_004154652.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    161   2e-40   
ref|XP_004139058.1|  PREDICTED: uncharacterized protein LOC101219074    161   2e-40   
ref|XP_009603792.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    160   2e-40   
emb|CDX69686.1|  BnaA10g20350D                                          160   3e-40   
ref|XP_007213716.1|  hypothetical protein PRUPE_ppa000548mg             160   4e-40   
ref|XP_008782005.1|  PREDICTED: uncharacterized protein LOC103701639    160   4e-40   
emb|CDP08456.1|  unnamed protein product                                160   4e-40   
ref|XP_002279847.2|  PREDICTED: uncharacterized protein LOC100248282    160   6e-40   Vitis vinifera
ref|XP_010555025.1|  PREDICTED: uncharacterized protein LOC104824622    160   6e-40   
ref|XP_010420743.1|  PREDICTED: uncharacterized protein LOC104706266    160   6e-40   
gb|KFK25508.1|  hypothetical protein AALP_AA8G123700                    159   6e-40   
ref|XP_010454214.1|  PREDICTED: uncharacterized protein LOC104736008    160   7e-40   
emb|CBI24230.3|  unnamed protein product                                159   7e-40   
ref|XP_010493003.1|  PREDICTED: uncharacterized protein LOC104770301    159   7e-40   
ref|XP_006349801.1|  PREDICTED: uncharacterized protein LOC102600493    159   7e-40   
ref|XP_004252890.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    159   8e-40   
ref|NP_197443.3|  regulator of chromosome condensation-like prote...    159   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785512.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    159   9e-40   
ref|XP_009785511.1|  PREDICTED: uncharacterized protein LOC104233...    159   1e-39   
ref|XP_010031729.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       159   1e-39   
ref|XP_006399751.1|  hypothetical protein EUTSA_v10012520mg             159   1e-39   
ref|XP_003532065.2|  PREDICTED: uncharacterized protein LOC100797527    159   1e-39   
ref|XP_009785513.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    158   1e-39   
ref|XP_010938572.1|  PREDICTED: uncharacterized protein LOC105057618    159   1e-39   
ref|XP_002980107.1|  hypothetical protein SELMODRAFT_112120             159   1e-39   
emb|CDX91165.1|  BnaC02g04320D                                          159   1e-39   
ref|XP_006654344.1|  PREDICTED: uncharacterized protein LOC102712360    158   2e-39   
ref|XP_009131736.1|  PREDICTED: uncharacterized protein LOC103856379    158   2e-39   
gb|KFK26205.1|  hypothetical protein AALP_AA8G216200                    158   2e-39   
ref|XP_002873947.1|  hypothetical protein ARALYDRAFT_488831             158   2e-39   
emb|CBI31979.3|  unnamed protein product                                153   2e-39   
ref|XP_008668987.1|  PREDICTED: uncharacterized protein LOC103646027    158   3e-39   
ref|NP_001055416.1|  Os05g0384800                                       157   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010645610.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    157   4e-39   
gb|AAT77332.1|  unknown prtein                                          157   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678947.1|  PREDICTED: uncharacterized protein LOC103653...    157   4e-39   
ref|XP_011004007.1|  PREDICTED: uncharacterized protein LOC105110613    157   5e-39   
ref|XP_011015114.1|  PREDICTED: uncharacterized protein LOC105118779    157   5e-39   
ref|XP_006470569.1|  PREDICTED: uncharacterized protein LOC102612...    156   8e-39   
ref|XP_006470567.1|  PREDICTED: uncharacterized protein LOC102612...    156   8e-39   
ref|XP_004168499.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    155   8e-39   
ref|XP_006646687.1|  PREDICTED: uncharacterized protein LOC102710941    156   1e-38   
ref|XP_002298476.2|  zinc finger family protein                         156   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009410388.1|  PREDICTED: uncharacterized protein LOC103992424    156   1e-38   
gb|KGN61393.1|  hypothetical protein Csa_2G109700                       155   1e-38   
ref|XP_008441693.1|  PREDICTED: uncharacterized protein LOC103485...    155   1e-38   
ref|XP_004138993.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    155   1e-38   
gb|EYU35939.1|  hypothetical protein MIMGU_mgv1a019835mg                156   1e-38   
ref|XP_008441692.1|  PREDICTED: uncharacterized protein LOC103485...    155   1e-38   
gb|KDO54855.1|  hypothetical protein CISIN_1g0026771mg                  155   1e-38   
gb|KDO54854.1|  hypothetical protein CISIN_1g0026771mg                  155   2e-38   
gb|EEE56014.1|  hypothetical protein OsJ_04782                          155   2e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72175.1|  hypothetical protein OsI_05225                          155   2e-38   Oryza sativa Indica Group [Indian rice]
dbj|BAD87854.1|  putative ZR1 protein                                   155   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009125861.1|  PREDICTED: uncharacterized protein LOC103850825    155   2e-38   
gb|KDO49057.1|  hypothetical protein CISIN_1g0013612mg                  155   2e-38   
ref|XP_006420722.1|  hypothetical protein CICLE_v10004216mg             155   2e-38   
ref|XP_004971285.1|  PREDICTED: uncharacterized protein LOC101782721    155   2e-38   
ref|NP_001045419.2|  Os01g0952300                                       155   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006470863.1|  PREDICTED: uncharacterized protein LOC102630...    155   2e-38   
ref|XP_004307114.1|  PREDICTED: uncharacterized protein LOC101307830    155   3e-38   
ref|XP_006854588.1|  hypothetical protein AMTR_s00030p00120950          155   3e-38   
dbj|BAJ88383.1|  predicted protein                                      155   3e-38   
ref|XP_007011054.1|  Regulator of chromosome condensation (RCC1) ...    155   3e-38   
ref|XP_009360355.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   3e-38   
ref|XP_003565075.1|  PREDICTED: uncharacterized protein LOC100834588    154   4e-38   
ref|XP_002273996.2|  PREDICTED: uncharacterized protein LOC100250...    154   5e-38   Vitis vinifera
ref|XP_004298436.1|  PREDICTED: uncharacterized protein LOC101307114    154   6e-38   
ref|XP_009395123.1|  PREDICTED: uncharacterized protein LOC103980429    154   6e-38   
ref|XP_002513064.1|  Ran GTPase binding protein, putative               153   1e-37   Ricinus communis
ref|XP_008656863.1|  PREDICTED: uncharacterized protein LOC103636281    153   1e-37   
ref|XP_010091214.1|  putative E3 ubiquitin-protein ligase HERC1         153   1e-37   
ref|XP_004976599.1|  PREDICTED: uncharacterized protein LOC101769145    153   1e-37   
ref|XP_011024954.1|  PREDICTED: uncharacterized protein LOC105125...    153   2e-37   
emb|CDX70876.1|  BnaC03g09600D                                          152   2e-37   
emb|CDX88891.1|  BnaA03g07580D                                          152   2e-37   
ref|XP_003568548.1|  PREDICTED: uncharacterized protein LOC100838586    152   3e-37   
gb|KDO76103.1|  hypothetical protein CISIN_1g0026021mg                  141   3e-37   
ref|NP_001190338.1|  regulator of chromosome condensation-like pr...    152   3e-37   
ref|XP_002992739.1|  hypothetical protein SELMODRAFT_430894             151   3e-37   
emb|CBI40156.3|  unnamed protein product                                151   3e-37   
emb|CDX85690.1|  BnaA02g01230D                                          151   4e-37   
emb|CDM86514.1|  unnamed protein product                                151   4e-37   
emb|CAC42896.1|  putative protein                                       151   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221643.1|  PREDICTED: uncharacterized protein LOC103321597    151   6e-37   
emb|CDY13998.1|  BnaC09g38280D                                          150   9e-37   
ref|XP_002991915.1|  hypothetical protein SELMODRAFT_430200             142   9e-37   
ref|XP_007224988.1|  hypothetical protein PRUPE_ppa020628mg             150   1e-36   
ref|XP_002511559.1|  Ran GTPase binding protein, putative               149   2e-36   Ricinus communis
ref|XP_004966829.1|  PREDICTED: uncharacterized protein LOC101764879    149   2e-36   
ref|XP_007046139.1|  Regulator of chromosome condensation (RCC1) ...    149   2e-36   
ref|XP_009361965.1|  PREDICTED: uncharacterized protein LOC103952146    149   2e-36   
ref|XP_010062134.1|  PREDICTED: uncharacterized protein LOC104449612    149   3e-36   
ref|XP_007221066.1|  hypothetical protein PRUPE_ppa016519mg             149   3e-36   
ref|XP_008389492.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    149   3e-36   
ref|XP_008347000.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    147   3e-36   
ref|XP_007153813.1|  hypothetical protein PHAVU_003G066900g             148   4e-36   
ref|XP_010247275.1|  PREDICTED: uncharacterized protein LOC104590345    149   4e-36   
ref|XP_010937079.1|  PREDICTED: uncharacterized protein LOC105056557    148   5e-36   
ref|XP_011075488.1|  PREDICTED: uncharacterized protein LOC105159...    148   5e-36   
ref|XP_008808052.1|  PREDICTED: uncharacterized protein LOC103720223    148   5e-36   
ref|XP_009411942.1|  PREDICTED: uncharacterized protein LOC103993562    148   5e-36   
ref|XP_011075486.1|  PREDICTED: uncharacterized protein LOC105159...    148   5e-36   
ref|XP_006279150.1|  hypothetical protein CARUB_v100079710mg            137   5e-36   
ref|XP_011024953.1|  PREDICTED: uncharacterized protein LOC105125...    148   6e-36   
ref|XP_002522401.1|  Ran GTPase binding protein, putative               147   1e-35   Ricinus communis
ref|XP_008348288.1|  PREDICTED: uncharacterized protein LOC103411430    147   1e-35   
ref|XP_010227829.1|  PREDICTED: uncharacterized protein LOC100836916    140   1e-35   
gb|KCW51717.1|  hypothetical protein EUGRSUZ_J01184                     147   1e-35   
emb|CBI35500.3|  unnamed protein product                                147   1e-35   
ref|XP_010032304.1|  PREDICTED: uncharacterized protein LOC104421...    147   1e-35   
emb|CDO99240.1|  unnamed protein product                                147   1e-35   
gb|KDP43019.1|  hypothetical protein JCGZ_25205                         147   1e-35   
gb|EYU28734.1|  hypothetical protein MIMGU_mgv1a000772mg                147   1e-35   
ref|XP_008375471.1|  PREDICTED: uncharacterized protein LOC103438700    147   1e-35   
ref|XP_010032303.1|  PREDICTED: uncharacterized protein LOC104421...    147   1e-35   
ref|XP_010032302.1|  PREDICTED: uncharacterized protein LOC104421...    147   1e-35   
ref|XP_010999798.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       147   2e-35   
ref|XP_002307488.1|  chromosome condensation regulator family pro...    147   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002264093.1|  PREDICTED: uncharacterized protein LOC100246114    147   2e-35   Vitis vinifera
ref|XP_010245275.1|  PREDICTED: uncharacterized protein LOC104588850    147   2e-35   
emb|CDX92532.1|  BnaA10g15710D                                          146   2e-35   
ref|XP_007201762.1|  hypothetical protein PRUPE_ppa000526mg             146   3e-35   
ref|XP_003535575.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    146   3e-35   
emb|CDP18270.1|  unnamed protein product                                146   3e-35   
ref|XP_002993711.1|  hypothetical protein SELMODRAFT_431761             146   3e-35   
ref|XP_008441536.1|  PREDICTED: uncharacterized protein LOC103485640    146   3e-35   
ref|XP_003556142.1|  PREDICTED: uncharacterized protein LOC100811999    146   3e-35   
ref|XP_010670475.1|  PREDICTED: uncharacterized protein LOC104887522    145   4e-35   
ref|XP_007152065.1|  hypothetical protein PHAVU_004G099000g             145   4e-35   
gb|KHN06842.1|  Putative E3 ubiquitin-protein ligase HERC1              146   4e-35   
ref|XP_004148808.1|  PREDICTED: uncharacterized protein LOC101222741    145   4e-35   
ref|XP_004511218.1|  PREDICTED: uncharacterized protein LOC101514...    145   4e-35   
ref|XP_002526126.1|  Ran GTPase binding protein, putative               145   5e-35   Ricinus communis
ref|XP_010530240.1|  PREDICTED: uncharacterized protein LOC104806...    145   5e-35   
ref|XP_010530239.1|  PREDICTED: uncharacterized protein LOC104806...    145   6e-35   
ref|XP_006856002.1|  hypothetical protein AMTR_s00059p00031410          145   6e-35   
ref|XP_010263145.1|  PREDICTED: uncharacterized protein LOC104601...    145   6e-35   
ref|XP_002281342.2|  PREDICTED: uncharacterized protein LOC100254552    145   6e-35   Vitis vinifera
ref|XP_009120889.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    145   7e-35   
ref|XP_009765012.1|  PREDICTED: uncharacterized protein LOC104216614    145   8e-35   
ref|XP_010935924.1|  PREDICTED: uncharacterized protein LOC105055696    145   9e-35   
gb|KHG15510.1|  putative E3 ubiquitin-protein ligase HERC1              145   9e-35   
gb|EYU26996.1|  hypothetical protein MIMGU_mgv1a022703mg                145   9e-35   
ref|XP_009608585.1|  PREDICTED: uncharacterized protein LOC104102557    145   9e-35   
ref|XP_001761845.1|  predicted protein                                  144   1e-34   
ref|XP_010683221.1|  PREDICTED: uncharacterized protein LOC104897942    144   1e-34   
ref|XP_010547351.1|  PREDICTED: uncharacterized protein LOC104819...    144   1e-34   
ref|XP_004290546.1|  PREDICTED: uncharacterized protein LOC101304637    144   1e-34   
gb|EEE63569.1|  hypothetical protein OsJ_18386                          144   1e-34   
ref|XP_007019444.1|  Regulator of chromosome condensation (RCC1) ...    144   1e-34   
ref|XP_007019446.1|  Regulator of chromosome condensation (RCC1) ...    144   1e-34   
ref|XP_007019445.1|  Regulator of chromosome condensation (RCC1) ...    144   1e-34   
gb|KDO83669.1|  hypothetical protein CISIN_1g001236mg                   144   2e-34   
ref|XP_006472955.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    144   2e-34   
ref|XP_003623558.1|  Chromosome condensation regulator-like protein     144   2e-34   
ref|XP_006438667.1|  hypothetical protein CICLE_v10030553mg             144   2e-34   
gb|KDO83668.1|  hypothetical protein CISIN_1g001236mg                   144   2e-34   
ref|XP_008464943.1|  PREDICTED: uncharacterized protein LOC103502691    144   2e-34   
ref|XP_004141119.1|  PREDICTED: uncharacterized protein LOC101220986    144   2e-34   
ref|XP_011042822.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       144   2e-34   
gb|EEC79138.1|  hypothetical protein OsI_19792                          144   2e-34   
ref|XP_004492531.1|  PREDICTED: uncharacterized protein LOC101515...    144   2e-34   
ref|XP_006438666.1|  hypothetical protein CICLE_v10030553mg             143   2e-34   
ref|XP_006483183.1|  PREDICTED: uncharacterized protein LOC102623...    143   2e-34   
ref|XP_006483182.1|  PREDICTED: uncharacterized protein LOC102623...    143   2e-34   
gb|KGN59721.1|  hypothetical protein Csa_3G840960                       144   2e-34   
ref|XP_002300931.1|  chromosome condensation regulator family pro...    144   2e-34   
gb|KEH25818.1|  chromosome condensation regulator RCC1 repeat pro...    143   3e-34   
ref|XP_008237622.1|  PREDICTED: uncharacterized protein LOC103336358    143   3e-34   
ref|XP_004492532.1|  PREDICTED: uncharacterized protein LOC101515...    143   3e-34   
ref|XP_006483185.1|  PREDICTED: uncharacterized protein LOC102623...    143   3e-34   
ref|XP_011020389.1|  PREDICTED: uncharacterized protein LOC105122796    143   3e-34   
ref|XP_002304793.1|  hypothetical protein POPTR_0003s19720g             143   3e-34   
ref|XP_003518608.1|  PREDICTED: uncharacterized protein LOC100805364    143   3e-34   
ref|XP_010069123.1|  PREDICTED: uncharacterized protein LOC104456095    143   3e-34   
ref|XP_011071628.1|  PREDICTED: uncharacterized protein LOC105157032    142   4e-34   
emb|CDP00317.1|  unnamed protein product                                142   5e-34   
gb|EMT20640.1|  Putative E3 ubiquitin-protein ligase HERC1              142   5e-34   
ref|XP_011074744.1|  PREDICTED: uncharacterized protein LOC105159392    142   5e-34   
ref|XP_006434432.1|  hypothetical protein CICLE_v10000092mg             142   5e-34   
ref|XP_008784134.1|  PREDICTED: uncharacterized protein LOC103703...    142   5e-34   
ref|XP_007143519.1|  hypothetical protein PHAVU_007G078300g             142   5e-34   
ref|XP_008784135.1|  PREDICTED: uncharacterized protein LOC103703...    142   6e-34   
ref|XP_008803202.1|  PREDICTED: uncharacterized protein LOC103716809    142   6e-34   
ref|XP_008339128.1|  PREDICTED: uncharacterized protein LOC103402168    142   6e-34   
ref|XP_008784136.1|  PREDICTED: uncharacterized protein LOC103703...    142   6e-34   
ref|XP_008356221.1|  PREDICTED: uncharacterized protein LOC103419911    142   6e-34   
ref|XP_004139677.1|  PREDICTED: uncharacterized protein LOC101214149    142   6e-34   
ref|XP_008389490.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    142   7e-34   
ref|XP_006476624.1|  PREDICTED: probable E3 ubiquitin-protein lig...    142   7e-34   
ref|XP_008461940.1|  PREDICTED: uncharacterized protein LOC103500422    142   7e-34   
ref|XP_009368253.1|  PREDICTED: uncharacterized protein LOC103957773    142   7e-34   
ref|XP_011091308.1|  PREDICTED: uncharacterized protein LOC105171777    142   8e-34   
ref|XP_006476622.1|  PREDICTED: probable E3 ubiquitin-protein lig...    142   8e-34   
ref|XP_008339910.1|  PREDICTED: uncharacterized protein LOC103402905    142   8e-34   
gb|AES62396.2|  chromosome condensation regulator RCC1 repeat pro...    142   9e-34   
ref|XP_010242447.1|  PREDICTED: uncharacterized protein LOC104586793    142   9e-34   
ref|XP_010533394.1|  PREDICTED: uncharacterized protein LOC104809...    141   1e-33   
ref|XP_010687585.1|  PREDICTED: uncharacterized protein LOC104901687    141   1e-33   
ref|XP_010317406.1|  PREDICTED: uncharacterized protein LOC101263083    141   1e-33   
ref|XP_006356114.1|  PREDICTED: uncharacterized protein LOC102591374    141   1e-33   
ref|XP_006300290.1|  hypothetical protein CARUB_v100164061mg            136   2e-33   
ref|XP_010917119.1|  PREDICTED: uncharacterized protein LOC105041789    141   2e-33   
ref|XP_004515119.1|  PREDICTED: uncharacterized protein LOC101511...    140   2e-33   
ref|XP_004515120.1|  PREDICTED: uncharacterized protein LOC101511...    140   2e-33   
emb|CBI15243.3|  unnamed protein product                                134   2e-33   
emb|CAD41378.2|  OSJNBa0088A01.18                                       140   2e-33   
gb|EAY95299.1|  hypothetical protein OsI_17124                          140   3e-33   
ref|NP_001053665.2|  Os04g0583700                                       140   3e-33   
ref|XP_006279937.1|  hypothetical protein CARUB_v10025795mg             140   3e-33   
ref|XP_006599510.1|  PREDICTED: probable E3 ubiquitin-protein lig...    138   3e-33   
ref|XP_010482021.1|  PREDICTED: uncharacterized protein LOC104760...    140   3e-33   
ref|XP_010482023.1|  PREDICTED: uncharacterized protein LOC104760...    140   3e-33   
emb|CDP12338.1|  unnamed protein product                                140   3e-33   
ref|XP_010482022.1|  PREDICTED: uncharacterized protein LOC104760...    140   3e-33   
ref|XP_010680417.1|  PREDICTED: uncharacterized protein LOC104895565    140   3e-33   
ref|XP_010912400.1|  PREDICTED: uncharacterized protein LOC105038...    140   4e-33   
ref|XP_006362814.1|  PREDICTED: uncharacterized protein LOC102604257    140   4e-33   
ref|XP_010912399.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    140   5e-33   
ref|XP_010533392.1|  PREDICTED: uncharacterized protein LOC104809...    140   5e-33   
ref|XP_010095965.1|  putative E3 ubiquitin-protein ligase HERC1         139   5e-33   
ref|XP_010445928.1|  PREDICTED: uncharacterized protein LOC104728670    140   5e-33   
ref|XP_007035131.1|  Regulator of chromosome condensation (RCC1) ...    139   6e-33   
ref|XP_009368476.1|  PREDICTED: uncharacterized protein LOC103957979    139   6e-33   
ref|XP_011000561.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   6e-33   
emb|CDY47138.1|  BnaA08g05450D                                          139   6e-33   
ref|XP_008810526.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   7e-33   
gb|KHN15444.1|  Putative E3 ubiquitin-protein ligase HERC1              139   7e-33   
emb|CDY11586.1|  BnaC06g31530D                                          139   8e-33   
ref|XP_006430406.1|  hypothetical protein CICLE_v10010970mg             139   8e-33   
ref|XP_006600015.1|  PREDICTED: uncharacterized protein LOC102660152    139   8e-33   
ref|XP_009365985.1|  PREDICTED: uncharacterized protein LOC103955813    139   8e-33   
gb|EMT20664.1|  Putative E3 ubiquitin-protein ligase HERC1              139   1e-32   
ref|XP_004237767.1|  PREDICTED: uncharacterized protein LOC101260...    139   1e-32   
ref|XP_008382399.1|  PREDICTED: uncharacterized protein LOC103445186    138   2e-32   
gb|EYU35847.1|  hypothetical protein MIMGU_mgv1a018189mg                138   2e-32   
ref|XP_011101424.1|  PREDICTED: uncharacterized protein LOC105179485    138   2e-32   
ref|XP_009105712.1|  PREDICTED: uncharacterized protein LOC103831580    138   2e-32   
gb|KHG24995.1|  E3 ubiquitin-protein ligase HERC2                       137   2e-32   
ref|XP_006827182.1|  hypothetical protein AMTR_s00010p00256680          137   3e-32   
ref|XP_009620351.1|  PREDICTED: uncharacterized protein LOC104112201    137   3e-32   
gb|KFK32945.1|  hypothetical protein AALP_AA6G309800                    137   3e-32   
ref|XP_004496492.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    137   4e-32   
ref|XP_002863817.1|  hypothetical protein ARALYDRAFT_917597             137   4e-32   
ref|XP_004959991.1|  PREDICTED: uncharacterized protein LOC101771832    137   5e-32   
ref|XP_008356820.1|  PREDICTED: uncharacterized protein LOC103420538    136   6e-32   
ref|XP_010551527.1|  PREDICTED: uncharacterized protein LOC104822...    136   6e-32   
gb|AFW83944.1|  putative regulator of chromosome condensation (RC...    136   6e-32   
ref|XP_006364189.1|  PREDICTED: uncharacterized protein LOC102590844    136   7e-32   
ref|XP_008785790.1|  PREDICTED: uncharacterized protein LOC103704...    136   7e-32   
ref|XP_006489723.1|  PREDICTED: uncharacterized protein LOC102629726    136   7e-32   
ref|XP_006420243.1|  hypothetical protein CICLE_v10004207mg             136   7e-32   
ref|XP_010911949.1|  PREDICTED: uncharacterized protein LOC105037994    136   7e-32   
ref|XP_009616446.1|  PREDICTED: uncharacterized protein LOC104108984    136   7e-32   
ref|XP_009775743.1|  PREDICTED: uncharacterized protein LOC104225600    136   8e-32   
ref|XP_007037299.1|  Ran GTPase binding protein, putative isoform 2     135   9e-32   
ref|XP_002311672.2|  disease resistance family protein                  136   9e-32   
ref|XP_007037300.1|  Ran GTPase binding protein, putative isoform 3     135   1e-31   
ref|XP_007037298.1|  Ran GTPase binding protein, putative isoform 1     135   1e-31   
ref|XP_007037301.1|  Ran GTPase binding protein, putative isoform 4     135   1e-31   
ref|XP_009150226.1|  PREDICTED: uncharacterized protein LOC103873573    135   1e-31   
emb|CDY21795.1|  BnaA06g20640D                                          135   1e-31   
emb|CDX77871.1|  BnaC03g53480D                                          135   1e-31   
ref|XP_009769888.1|  PREDICTED: uncharacterized protein LOC104220679    135   1e-31   
ref|XP_009770546.1|  PREDICTED: uncharacterized protein LOC104221...    135   1e-31   
gb|KHG30704.1|  putative E3 ubiquitin-protein ligase HERC1              135   2e-31   
ref|XP_009598715.1|  PREDICTED: uncharacterized protein LOC104094479    135   2e-31   
gb|EEC78290.1|  hypothetical protein OsI_18002                          135   2e-31   
ref|XP_008224348.1|  PREDICTED: uncharacterized protein LOC103324...    135   2e-31   
ref|XP_009770543.1|  PREDICTED: uncharacterized protein LOC104221...    135   2e-31   
gb|KCW64968.1|  hypothetical protein EUGRSUZ_G02511                     135   2e-31   
ref|XP_011074548.1|  PREDICTED: uncharacterized protein LOC105159...    135   2e-31   
ref|XP_011029821.1|  PREDICTED: uncharacterized protein LOC105129442    135   2e-31   
ref|XP_008224347.1|  PREDICTED: uncharacterized protein LOC103324...    135   2e-31   
ref|NP_001054325.1|  Os04g0686200                                       135   2e-31   
ref|XP_010066924.1|  PREDICTED: uncharacterized protein LOC104453...    135   2e-31   
ref|XP_010318794.1|  PREDICTED: uncharacterized protein LOC101257...    134   2e-31   
ref|XP_010066923.1|  PREDICTED: uncharacterized protein LOC104453...    134   2e-31   
emb|CDX88324.1|  BnaC06g37680D                                          134   3e-31   
ref|XP_001770494.1|  predicted protein                                  134   3e-31   
emb|CAJ86040.1|  H0723C07.10                                            134   3e-31   
ref|XP_002533468.1|  Ran GTPase binding protein, putative               134   3e-31   
ref|XP_010451525.1|  PREDICTED: 1-phosphatidylinositol 4,5-bispho...    125   3e-31   
ref|XP_006602295.1|  PREDICTED: uncharacterized protein LOC100791...    134   4e-31   
ref|XP_007224834.1|  hypothetical protein PRUPE_ppa023189mg             134   4e-31   
ref|XP_007146310.1|  hypothetical protein PHAVU_006G029700g             124   4e-31   
gb|EYU36844.1|  hypothetical protein MIMGU_mgv1a000614mg                134   5e-31   
ref|XP_010426213.1|  PREDICTED: uncharacterized protein LOC104711231    133   7e-31   
ref|XP_004296374.1|  PREDICTED: uncharacterized protein LOC101302544    133   7e-31   
ref|XP_008366257.1|  PREDICTED: probable E3 ubiquitin-protein lig...    133   7e-31   
ref|XP_002887252.1|  hypothetical protein ARALYDRAFT_476103             133   7e-31   
ref|XP_010909635.1|  PREDICTED: uncharacterized protein LOC105035685    133   8e-31   
ref|XP_010415627.1|  PREDICTED: uncharacterized protein LOC104701...    133   8e-31   
ref|XP_006300387.1|  hypothetical protein CARUB_v10019712mg             133   8e-31   
ref|XP_010512024.1|  PREDICTED: uncharacterized protein LOC104788044    133   9e-31   
ref|XP_010415626.1|  PREDICTED: uncharacterized protein LOC104701...    133   9e-31   
emb|CDY12764.1|  BnaC04g28770D                                          133   9e-31   
ref|XP_004511219.1|  PREDICTED: uncharacterized protein LOC101514...    133   9e-31   
ref|XP_006406056.1|  hypothetical protein EUTSA_v10019964mg             133   1e-30   
ref|XP_008654599.1|  PREDICTED: uncharacterized protein LOC100273...    133   1e-30   
ref|XP_009147090.1|  PREDICTED: uncharacterized protein LOC103870680    133   1e-30   
ref|XP_010503375.1|  PREDICTED: uncharacterized protein LOC104780...    132   1e-30   
ref|XP_010547813.1|  PREDICTED: X-linked retinitis pigmentosa GTP...    132   1e-30   
ref|XP_002883417.1|  regulator of chromosome condensation family ...    133   1e-30   
ref|XP_004238788.1|  PREDICTED: uncharacterized protein LOC101262813    133   1e-30   
gb|EYU17468.1|  hypothetical protein MIMGU_mgv1a000524mg                133   1e-30   
gb|AAG52535.1|AC013289_2  putative regulator of chromosome conden...    133   1e-30   
ref|NP_199029.1|  Regulator of chromosome condensation (RCC1) fam...    133   1e-30   
ref|XP_010470972.1|  PREDICTED: uncharacterized protein LOC104750821    132   1e-30   
ref|XP_009386434.1|  PREDICTED: uncharacterized protein LOC103973552    132   1e-30   
ref|NP_177129.2|  regulator of chromosome condensation and FYVE z...    132   1e-30   
emb|CDY49416.1|  BnaCnng17260D                                          132   1e-30   
ref|XP_006653059.1|  PREDICTED: uncharacterized protein LOC102704416    132   1e-30   
ref|XP_006390980.1|  hypothetical protein EUTSA_v10018063mg             132   1e-30   
emb|CDX87557.1|  BnaA07g33160D                                          132   2e-30   
ref|XP_008668207.1|  PREDICTED: uncharacterized protein LOC100304...    132   2e-30   
ref|XP_009106357.1|  PREDICTED: uncharacterized protein LOC103832150    132   2e-30   
ref|XP_003636756.1|  Chromosome condensation regulator protein          132   2e-30   
ref|XP_008668206.1|  PREDICTED: uncharacterized protein LOC100304...    132   2e-30   
ref|XP_006575771.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    132   2e-30   
ref|XP_010539720.1|  PREDICTED: uncharacterized protein LOC104813...    132   2e-30   
ref|XP_010663866.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   2e-30   
gb|KHN00263.1|  Putative E3 ubiquitin-protein ligase HERC1              132   2e-30   
ref|XP_009127757.1|  PREDICTED: uncharacterized protein LOC103852607    131   3e-30   
ref|XP_006363228.1|  PREDICTED: uncharacterized protein LOC102588539    131   3e-30   
gb|EPS64081.1|  hypothetical protein M569_10696                         131   3e-30   
ref|NP_188968.1|  regulator of chromosome condensation-like prote...    131   4e-30   
ref|XP_010551689.1|  PREDICTED: uncharacterized protein LOC104822243    131   4e-30   
gb|AES60260.2|  chromosome condensation regulator RCC1 repeat pro...    131   4e-30   
gb|EMT17445.1|  Putative E3 ubiquitin-protein ligase HERC2              131   5e-30   
ref|XP_006390139.1|  hypothetical protein EUTSA_v10018039mg             131   5e-30   
ref|XP_010532647.1|  PREDICTED: uncharacterized protein LOC104808625    130   5e-30   
ref|XP_006390138.1|  hypothetical protein EUTSA_v10018039mg             130   6e-30   
gb|KFK21924.1|  hypothetical protein AALP_AAs63887U000400               130   7e-30   
emb|CDY70949.1|  BnaC06g43200D                                          126   8e-30   
emb|CBI23652.3|  unnamed protein product                                130   1e-29   
ref|XP_009390052.1|  PREDICTED: uncharacterized protein LOC103976537    129   1e-29   
ref|XP_010428763.1|  PREDICTED: uncharacterized protein LOC104713360    129   2e-29   
ref|XP_010416621.1|  PREDICTED: uncharacterized protein LOC104702461    129   2e-29   
ref|XP_010471858.1|  PREDICTED: uncharacterized protein LOC104751587    129   2e-29   
gb|KFK39615.1|  hypothetical protein AALP_AA3G267000                    129   2e-29   
ref|XP_006390883.1|  hypothetical protein EUTSA_v10019747mg             129   2e-29   
ref|XP_010515074.1|  PREDICTED: uncharacterized protein LOC104790973    129   2e-29   
ref|XP_002456212.1|  hypothetical protein SORBIDRAFT_03g032200          129   3e-29   
ref|XP_001770491.1|  predicted protein                                  129   3e-29   
gb|KHN00291.1|  Putative E3 ubiquitin-protein ligase HERC1              128   4e-29   
ref|XP_003536842.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    128   4e-29   
emb|CDY28580.1|  BnaC02g19490D                                          128   4e-29   
ref|XP_002887663.1|  zinc finger protein                                128   4e-29   
gb|KFK42089.1|  hypothetical protein AALP_AA2G209500                    128   5e-29   
ref|XP_006301556.1|  hypothetical protein CARUB_v10021990mg             127   6e-29   
ref|XP_008802137.1|  PREDICTED: probable E3 ubiquitin-protein lig...    127   7e-29   
gb|EMT05572.1|  Putative E3 ubiquitin-protein ligase HERC2              127   8e-29   
ref|XP_008802135.1|  PREDICTED: uncharacterized protein LOC103716...    127   8e-29   
ref|XP_003580861.1|  PREDICTED: uncharacterized protein LOC100835...    127   1e-28   
ref|XP_010240645.1|  PREDICTED: uncharacterized protein LOC100835...    127   1e-28   
emb|CDY44086.1|  BnaA02g14500D                                          127   1e-28   
gb|AAL58903.1|AF462811_1  At1g76950/F22K20_5                            127   1e-28   
ref|NP_565144.1|  protein PRAF1                                         127   1e-28   
ref|NP_001043984.1|  Os01g0700200                                       126   1e-28   
ref|XP_007145857.1|  hypothetical protein PHAVU_007G273900g             126   2e-28   
ref|NP_001154232.2|  regulator of chromosome condensation repeat-...    126   2e-28   
ref|XP_007011055.1|  Regulator of chromosome condensation (RCC1) ...    126   2e-28   



>ref|XP_010316561.1| PREDICTED: uncharacterized protein LOC101267670 isoform X3 [Solanum 
lycopersicum]
Length=957

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L    SDRAVEQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHLTIDPSDRAVEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TN+I GQ T  +QPE E+QCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNVIRGQSTVIIQPEMENQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R + + KSKRG  SCISSPA YMRR+QNLGL    + +LS+VRSLAGSP +SFS
Sbjct  121  SRTHHHRMVDSLKSKRGTHSCISSPAGYMRRKQNLGL-SAKTIRLSQVRSLAGSPTQSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSS+SFFSE S+S   N +D   S S Y  PDDL++        E Q +ML
Sbjct  180  ERCFTDGLSCSSESFFSESSLS---NVMDNFTSCSSYFEPDDLSQTRASCAGTEIQTDML  236

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
              L  S  ES       LRDVFIWGE
Sbjct  237  APLLPSSNESRPFGKNILRDVFIWGE  262



>ref|XP_006348176.1| PREDICTED: uncharacterized protein LOC102586818 [Solanum tuberosum]
Length=1076

 Score =   303 bits (775),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L    SDRAVEQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHLTFDPSDRAVEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TN+I GQ T  LQPE ESQCISL+Y NG+R+LDLICKD+MQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNVIRGQSTVILQPEMESQCISLIYGNGERTLDLICKDQMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R + + KSKRG  SCISSPA YMRR+QNLGL    + +LS+VRSLAGSP +SFS
Sbjct  121  SRTHHHRMVDSLKSKRGAHSCISSPAGYMRRKQNLGL-SAKTIRLSQVRSLAGSPTQSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSC+S+SFFSE S+S   N +D   S S Y  PDDL++        E Q +ML
Sbjct  180  ERCFTDGLSCTSESFFSESSLS---NVMDNFTSCSSYFEPDDLSQTRASCAGTEIQTDML  236

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
              L  S  ES       LRDVFIWGE
Sbjct  237  APLLPSSNESRPFGKNVLRDVFIWGE  262



>ref|XP_010316559.1| PREDICTED: uncharacterized protein LOC101267670 isoform X1 [Solanum 
lycopersicum]
Length=1076

 Score =   303 bits (775),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L    SDRAVEQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHLTIDPSDRAVEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TN+I GQ T  +QPE E+QCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNVIRGQSTVIIQPEMENQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R + + KSKRG  SCISSPA YMRR+QNLGL    + +LS+VRSLAGSP +SFS
Sbjct  121  SRTHHHRMVDSLKSKRGTHSCISSPAGYMRRKQNLGL-SAKTIRLSQVRSLAGSPTQSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSS+SFFSE S+S   N +D   S S Y  PDDL++        E Q +ML
Sbjct  180  ERCFTDGLSCSSESFFSESSLS---NVMDNFTSCSSYFEPDDLSQTRASCAGTEIQTDML  236

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
              L  S  ES       LRDVFIWGE
Sbjct  237  APLLPSSNESRPFGKNILRDVFIWGE  262



>ref|XP_009591088.1| PREDICTED: uncharacterized protein LOC104088155 isoform X3 [Nicotiana 
tomentosiformis]
Length=946

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 197/266 (74%), Gaps = 2/266 (1%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ +A   SDRAVEQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHVAIVPSDRAVEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TNII GQ T  LQPE ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNIIRGQSTVILQPEMESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R +   KS++G  SCISSPA YMRR+QNLGL    + + S+VRSLAGSP  SFS
Sbjct  121  SRTHHHRVVDPLKSRKGTHSCISSPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSSDSFFSE S+SS+HN ++ +   S Y   D+L ++       E Q ++L
Sbjct  180  ERCFTDGLSCSSDSFFSESSLSSVHNVIENVTCSS-YFESDNLTQKRASCAGTENQTDIL  238

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
                 S +ES       LRDVFIWGE
Sbjct  239  APFIPSTHESRPFGRNVLRDVFIWGE  264



>emb|CDP01697.1| unnamed protein product [Coffea canephora]
Length=1071

 Score =   296 bits (758),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 201/265 (76%), Gaps = 1/265 (0%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ +A   SDRAVEQAIVALKKGAHLLKY R GKPKFCPFRLS DEK LIWYSGE EK
Sbjct  1    MGEEHVALCPSDRAVEQAIVALKKGAHLLKYGRRGKPKFCPFRLSMDEKSLIWYSGEMEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             L+LSSVTNII GQ TKQ++PERESQ  +L+YANG+RSLDLICKDK QA+SWFLGL+++I
Sbjct  61   QLKLSSVTNIIRGQNTKQMKPERESQSFALIYANGERSLDLICKDKAQADSWFLGLKSII  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S SHH+R  GT K++R  QSC++SPASYMRR+Q LG+   ++ K S+ +S+ GSP +SFS
Sbjct  121  SRSHHRRLFGTLKNQRWAQSCVNSPASYMRRKQILGITE-ETAKSSQFQSIDGSPAQSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  SDGLSCSSDSF+SE S+SS  N++D  N+ SP +GPDDLNK+        T  + L
Sbjct  180  ERCFSDGLSCSSDSFYSESSLSSTQNSVDNFNTSSPCLGPDDLNKKEAVCANTRTHVHSL  239

Query  821  NLLETSVYESTQSANYALRDVFIWG  895
            + L       TQ     LRD+ IWG
Sbjct  240  SQLGRPPRNFTQLGMDVLRDLLIWG  264



>ref|XP_009591085.1| PREDICTED: uncharacterized protein LOC104088155 isoform X1 [Nicotiana 
tomentosiformis]
Length=1083

 Score =   295 bits (755),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 197/266 (74%), Gaps = 2/266 (1%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ +A   SDRAVEQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHVAIVPSDRAVEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TNII GQ T  LQPE ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNIIRGQSTVILQPEMESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R +   KS++G  SCISSPA YMRR+QNLGL    + + S+VRSLAGSP  SFS
Sbjct  121  SRTHHHRVVDPLKSRKGTHSCISSPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSSDSFFSE S+SS+HN ++ +   S Y   D+L ++       E Q ++L
Sbjct  180  ERCFTDGLSCSSDSFFSESSLSSVHNVIENVTCSS-YFESDNLTQKRASCAGTENQTDIL  238

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
                 S +ES       LRDVFIWGE
Sbjct  239  APFIPSTHESRPFGRNVLRDVFIWGE  264



>ref|XP_009790767.1| PREDICTED: uncharacterized protein LOC104238167 isoform X3 [Nicotiana 
sylvestris]
Length=946

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ ++   SDRA+EQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHVSIVPSDRALEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TNII GQ T  LQPE ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNIIRGQSTVILQPEMESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R     KS++G  SCISSPA YMRR+QNLGL    + + S+VRSLAGSP  SFS
Sbjct  121  SRTHHHRVADPLKSRKGAHSCISSPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSSDSFFSE S+SS+HN ++ +   S Y   D+L ++       E Q ++L
Sbjct  180  ERCFTDGLSCSSDSFFSESSLSSVHNVIENVTRSS-YFESDNLTQKRASCAGTENQTDIL  238

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
                 S +ES       LRDVFIWGE
Sbjct  239  APFMLSTHESRPFGRNVLRDVFIWGE  264



>ref|XP_009790764.1| PREDICTED: uncharacterized protein LOC104238167 isoform X1 [Nicotiana 
sylvestris]
Length=1083

 Score =   291 bits (746),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ ++   SDRA+EQAIVALKKGAHLLKY R GKPKF P RLS DEKFLIWYSGEKE 
Sbjct  1    MGEEHVSIVPSDRALEQAIVALKKGAHLLKYGRRGKPKFYPLRLSADEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
             LRLSS+TNII GQ T  LQPE ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVI
Sbjct  61   QLRLSSITNIIRGQSTVILQPEMESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVI  120

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S +HH R     KS++G  SCISSPA YMRR+QNLGL    + + S+VRSLAGSP  SFS
Sbjct  121  SRTHHHRVADPLKSRKGAHSCISSPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFS  179

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANML  820
            ER  +DGLSCSSDSFFSE S+SS+HN ++ +   S Y   D+L ++       E Q ++L
Sbjct  180  ERCFTDGLSCSSDSFFSESSLSSVHNVIENVTRSS-YFESDNLTQKRASCAGTENQTDIL  238

Query  821  NLLETSVYESTQSANYALRDVFIWGE  898
                 S +ES       LRDVFIWGE
Sbjct  239  APFMLSTHESRPFGRNVLRDVFIWGE  264



>emb|CAN82853.1| hypothetical protein VITISV_028768 [Vitis vinifera]
Length=1156

 Score =   259 bits (662),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 181/270 (67%), Gaps = 7/270 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ LA    DRAVEQAIV LKKGA+LL+  R GKPKFCPFRLS DEKFLIWYSG++EK
Sbjct  1    MGEESLATVPFDRAVEQAIVTLKKGAYLLRCGRRGKPKFCPFRLSTDEKFLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLSS+T II GQ+T    +QLQ ERE +  SLVYANG+RSLDLICKDK QA+SWFLGL
Sbjct  61   QLRLSSITKIIPGQRTVNFQRQLQEERECRSFSLVYANGERSLDLICKDKAQADSWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R L T ++  GVQ+C +SPA Y RR+ NLGL   D+ K S+VRSL GSP 
Sbjct  121  KAVISRCQHPRQLSTFRNCVGVQTCFNSPAGYFRRKHNLGLLE-DTPKFSQVRSLCGSPT  179

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
            +S SER         +   + SE S+S++ N +D     SPYV PD L +    +   E 
Sbjct  180  QSLSERCFSDGLSYSADSFYSSESSVSNVKNVVDVSLPSSPYVEPDHLKQGEEIYAGTEI  239

Query  806  QANMLNLLETSVYESTQ-SANYALRDVFIW  892
            Q +ML+ +    + S Q   N  LRDV IW
Sbjct  240  QTDMLSQVAAPSHASPQMEKNDILRDVMIW  269



>ref|XP_010648895.1| PREDICTED: uncharacterized protein LOC100253065 [Vitis vinifera]
Length=1091

 Score =   259 bits (661),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 181/270 (67%), Gaps = 7/270 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ LA    DRAVEQAIV LKKGA+LL+  R GKPKFCPFRLS DEKFLIWYSG++EK
Sbjct  1    MGEESLATVPFDRAVEQAIVTLKKGAYLLRCGRRGKPKFCPFRLSTDEKFLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLSS+T II GQ+T    +QLQ ERE +  SLVYANG+RSLDLICKDK QA+SWFLGL
Sbjct  61   QLRLSSITKIIPGQRTVNFQRQLQEERECRSFSLVYANGERSLDLICKDKAQADSWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R L T ++  GVQ+C +SPA Y RR+ NLGL   D+ K S+VRSL GSP 
Sbjct  121  KAVISRCQHPRQLSTFRNCVGVQTCFNSPAGYFRRKHNLGLLE-DTPKFSQVRSLCGSPT  179

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
            +S SER         +   + SE S+S++ N +D     SPYV PD L +    +   E 
Sbjct  180  QSLSERCFSDGLSYSADSFYSSESSVSNVKNVVDVSLPSSPYVEPDHLKQGEEIYAGTEI  239

Query  806  QANMLNLLETSVYESTQ-SANYALRDVFIW  892
            Q +ML+ +    + S Q   N  LRDV IW
Sbjct  240  QTDMLSQVAAPSHASPQMEKNDILRDVMIW  269



>ref|XP_002526580.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF35792.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1086

 Score =   257 bits (656),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 179/260 (69%), Gaps = 7/260 (3%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR VEQAI+ALKKGAHLLKY R GKPKFCPFRLS DEK+LIWYSG++EK L+LSSV  I+
Sbjct  17   DRTVEQAILALKKGAHLLKYGRRGKPKFCPFRLSTDEKYLIWYSGQEEKQLKLSSVMKIV  76

Query  314  HGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T    +QLQP++E Q  SL+YA G+RSLDLICKDK QA+SWF+GLRAVIS  H  R
Sbjct  77   TGQRTVNFQRQLQPDKEHQSFSLIYAKGERSLDLICKDKAQADSWFIGLRAVISRCHRSR  136

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdg  661
             L   +S R  QSC++SPA Y RR+ NLG+   D  + S+VRSL GSP  S SE+  SDG
Sbjct  137  PLTALRSHRSAQSCVNSPAGYFRRKHNLGILE-DDKEFSQVRSLCGSPTPSLSEKCFSDG  195

Query  662  lscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSV  841
            LS SSDSF    S   MHNA+D +   SP VGP  L K   D+   + Q +M     T  
Sbjct  196  LSLSSDSFCLSESSLQMHNAVDILVPNSPCVGP-ILEKCGSDYACSKFQKDMSFRFVTPA  254

Query  842  YESTQ-SANYALRDVFIWGE  898
            Y  TQ   N +L+DV +WGE
Sbjct  255  YGCTQIGKNDSLKDVLMWGE  274



>ref|XP_006481958.1| PREDICTED: uncharacterized protein LOC102629590 [Citrus sinensis]
Length=1080

 Score =   246 bits (629),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 173/261 (66%), Gaps = 7/261 (3%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR V+QAI+A+KKGAHLLK  R GKP+FCPFRLS DEKFLIWYSG+KEK LRL+SVT II
Sbjct  17   DRNVQQAILAIKKGAHLLKCGRRGKPRFCPFRLSMDEKFLIWYSGQKEKQLRLNSVTKII  76

Query  314  HGQQTK----QLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T     Q QP+R+ Q  S++YANG+RSLDLICKDK+QAESWFLGLRA ISS    R
Sbjct  77   MGQRTVNFQCQPQPDRKQQSFSIIYANGERSLDLICKDKVQAESWFLGLRAAISSCRRSR  136

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERg-csd  658
                 + KRGVQSC+SSPASY+RR+ NLGL   D+T+LS+VRSL GSP  S SER     
Sbjct  137  TFSCLREKRGVQSCVSSPASYIRRKHNLGLLE-DATELSQVRSLCGSPSLSLSERCFSDG  195

Query  659  glscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETS  838
                S   + SE S S + N  + I   SP++  ++  K  +++       N  + L T 
Sbjct  196  LSYSSDSFYSSESSSSQIQNLSNIITPSSPHMETENFMKWELNYADTRCPKNESHRLVTP  255

Query  839  VYESTQ-SANYALRDVFIWGE  898
             Y S        L+DV IWGE
Sbjct  256  TYGSPLIERKDILKDVMIWGE  276



>ref|XP_010246209.1| PREDICTED: uncharacterized protein LOC104589558 isoform X2 [Nelumbo 
nucifera]
Length=884

 Score =   244 bits (623),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 189/275 (69%), Gaps = 18/275 (7%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L     DR VEQAIVALKKGAHLLKY R GKPKFCPFRLS DEK LIWYSG++EK
Sbjct  1    MGEEPL-----DREVEQAIVALKKGAHLLKYGRRGKPKFCPFRLSTDEKLLIWYSGKEEK  55

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRL+SVT II GQ+T    +Q QPE+ESQ  S+VYANG+RSLDL+CKDK QA+SWF+GL
Sbjct  56   QLRLTSVTKIIPGQRTVNFLRQPQPEKESQSFSVVYANGERSLDLVCKDKEQADSWFVGL  115

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+IS SHH   L T +++ G Q+C +SP  Y RRR +LGL   DS+K S+VRSL GSP 
Sbjct  116  RALISRSHHYGSLCTLRNRPGAQTCANSPVGYSRRRNSLGL--EDSSKYSQVRSLCGSPP  173

Query  629  RSFSERgcsdglscssds--ffselsmssmHNALDAINSGSPYVGPDDL-NKRTVDFGQG  799
            RS +ER  SDGLS SS+        S+SS+  A+D I     Y+ P+DL  KR  + G G
Sbjct  174  RSLAERCFSDGLSHSSEGFYSSEPRSLSSIRTAMDFIVPHLSYMEPNDLKEKRRANAGTG  233

Query  800  ETQANMLNLLET--SVYESTQSANYALRDVFIWGE  898
              + N+   + T    + ST +    LRDV +WGE
Sbjct  234  -YRVNLPYGVRTHSQCFPSTDNTE-VLRDVLMWGE  266



>ref|XP_010246208.1| PREDICTED: uncharacterized protein LOC104589558 isoform X1 [Nelumbo 
nucifera]
Length=1089

 Score =   245 bits (625),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 189/275 (69%), Gaps = 18/275 (7%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L     DR VEQAIVALKKGAHLLKY R GKPKFCPFRLS DEK LIWYSG++EK
Sbjct  1    MGEEPL-----DREVEQAIVALKKGAHLLKYGRRGKPKFCPFRLSTDEKLLIWYSGKEEK  55

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRL+SVT II GQ+T    +Q QPE+ESQ  S+VYANG+RSLDL+CKDK QA+SWF+GL
Sbjct  56   QLRLTSVTKIIPGQRTVNFLRQPQPEKESQSFSVVYANGERSLDLVCKDKEQADSWFVGL  115

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+IS SHH   L T +++ G Q+C +SP  Y RRR +LGL   DS+K S+VRSL GSP 
Sbjct  116  RALISRSHHYGSLCTLRNRPGAQTCANSPVGYSRRRNSLGLE--DSSKYSQVRSLCGSPP  173

Query  629  RSFSERgcsdglscssds--ffselsmssmHNALDAINSGSPYVGPDDL-NKRTVDFGQG  799
            RS +ER  SDGLS SS+        S+SS+  A+D I     Y+ P+DL  KR  + G G
Sbjct  174  RSLAERCFSDGLSHSSEGFYSSEPRSLSSIRTAMDFIVPHLSYMEPNDLKEKRRANAGTG  233

Query  800  ETQANMLNLLET--SVYESTQSANYALRDVFIWGE  898
              + N+   + T    + ST +    LRDV +WGE
Sbjct  234  -YRVNLPYGVRTHSQCFPSTDNTE-VLRDVLMWGE  266



>ref|XP_010105606.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
 gb|EXC05203.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
Length=1044

 Score =   244 bits (624),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 186/272 (68%), Gaps = 15/272 (6%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ L     DRAV+QAI+++KKGA+LLK  R GKPKFCPFRLS DEKFLIWYSG++E+
Sbjct  1    MAEESLTTLPFDRAVQQAILSIKKGAYLLKCGRRGKPKFCPFRLSTDEKFLIWYSGQEER  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LR+SS+  II GQ+T    +QLQPE+E Q  SLVYANG+RSLDLICKDK+QA+SW LGL
Sbjct  61   QLRMSSIMKIIPGQKTVSFQRQLQPEKEPQSFSLVYANGERSLDLICKDKVQADSWMLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            R +IS  HH R   + +  +GVQSCISSPA ++RR+ NLGL   D+T+ S+V S+ GSP 
Sbjct  121  RVIISRCHHPRPFNSLRGHKGVQSCISSPAGFIRRKHNLGLSE-DATEFSEVHSMCGSPS  179

Query  629  RSFSERgcsdglscssdsff-selsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             S SER  SDGLS SSD+F+ SE ++S + N  +     SPY+GP  + KR         
Sbjct  180  LSLSERCFSDGLSHSSDAFYWSEAALSIVQNVRNVSVPNSPYMGPSHVEKR--------Y  231

Query  806  QANMLNLLETSVYES-TQSANYALRDVFIWGE  898
            + ++ + L  S  ES        L+DV IWGE
Sbjct  232  EVDVPHRLAASTIESPVMEKKNVLKDVMIWGE  263



>ref|XP_009631453.1| PREDICTED: uncharacterized protein LOC104121219 isoform X2 [Nicotiana 
tomentosiformis]
Length=981

 Score =   243 bits (621),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 179/270 (66%), Gaps = 7/270 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MG++ LA   SDR VEQAI ALKKGAHLL Y R GKPKFCP RLS DEKFLIWYSGEKE 
Sbjct  1    MGDEHLAILHSDRVVEQAITALKKGAHLLTYGRRGKPKFCPLRLSTDEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLS+VT+II GQ T    KQLQ + ESQCISL+Y N   +LDLICKD+MQAE+WFLGL
Sbjct  61   QLRLSAVTDIIRGQNTVIQQKQLQADMESQCISLIYGNDDHTLDLICKDEMQAETWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS S H   +   KS+R  QSCI SP  YMRR+ NLGL  +  T+ S+V SL+GSP 
Sbjct  121  KAVISRSRHG-LVDDMKSERRAQSCILSPVGYMRRKHNLGL-SVKKTRSSQVSSLSGSPT  178

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
            +SFSE   S      S +     S+SS+HN +D + + S  + PD L+++       +  
Sbjct  179  QSFSEN-YSSDGLSCSSNILFPPSLSSVHNEMDNVITNSSSLEPDYLSQKRASCDGTDIH  237

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWGE  898
             +ML     S ++S     + LRDVFIWGE
Sbjct  238  NDMLTPSVPSTHKSGLLGKHVLRDVFIWGE  267



>ref|XP_006372478.1| regulator of chromosome condensation (RCC1) family protein [Populus 
trichocarpa]
 gb|ERP50275.1| regulator of chromosome condensation (RCC1) family protein [Populus 
trichocarpa]
Length=973

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 183/270 (68%), Gaps = 5/270 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L     DR VEQAI+A+KKGAHLLK  R GK KFCPFRLS DEK+LIWYSG++EK
Sbjct  1    MGEESLTTVPFDRTVEQAILAMKKGAHLLKCGRRGKLKFCPFRLSTDEKYLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQ--RSLDLICKDKMQAESWFLGLRA  454
             LRLS V  I+ GQ+T+QLQP++E+Q  SL+Y NG   RSLDLICKDK QA+SWF+GLRA
Sbjct  61   QLRLSLVVKIVTGQRTRQLQPDKENQSFSLIYTNGDRARSLDLICKDKAQADSWFIGLRA  120

Query  455  VISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRS  634
            VIS  H  R +   K+ RG QSC++SPA ++RR+ NLG+   D T+LS+VRSL+GSP +S
Sbjct  121  VISRCHRSRPICVLKNHRGAQSCVNSPAGFIRRKHNLGILE-DDTELSQVRSLSGSPTQS  179

Query  635  FSERgcsdglscssdsffselsms-smHNALDAINSGSPYVGPDDLNKRTVDFGQGETQA  811
             S+RG SDGLS SSDS F   S    M N  D + S  P V P +L K   D    E Q 
Sbjct  180  LSDRGISDGLSLSSDSLFFSGSSLPQMQNVEDLLVSYIPNVEPQNLKKNGSDTAYSEFQK  239

Query  812  NMLNLLETSVYESTQSANY-ALRDVFIWGE  898
            N  + +    + S ++     L+DV IWGE
Sbjct  240  NTCHRVIGLNHGSPRTEKKDILKDVLIWGE  269



>ref|XP_004231705.1| PREDICTED: uncharacterized protein LOC101256142 [Solanum lycopersicum]
Length=811

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 170/270 (63%), Gaps = 31/270 (11%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA   SDRAVEQAI+ALKKGA LLKY R GKPKFCP RLS DEKFLIWYSGEKE 
Sbjct  1    MSEEHLAIVPSDRAVEQAIIALKKGA-LLKYGRRGKPKFCPLRLSADEKFLIWYSGEKEN  59

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L LS+VTNII GQ T    KQL+ E +SQCISL+Y N   SLDLICKDK+QA +WFLGL
Sbjct  60   KLSLSAVTNIIRGQNTVNQQKQLKAEMDSQCISLIYGNDDHSLDLICKDKVQAATWFLGL  119

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RAVIS S H   +   K+KRGVQSCISSP  Y+RR+ NLG + +  ++ S+VRS + SP 
Sbjct  120  RAVISRSRHG-LVDHMKNKRGVQSCISSPVGYLRRKHNLG-FSLKKSRSSQVRSFSRSPT  177

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
            RSFS++   +     S S    L +SS+HN +D + + S    P       VD       
Sbjct  178  RSFSDK--CNADGGLSCSSDIFLPLSSVHNGMDNVIANSSSDDPRQKRATCVD-------  228

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWGE  898
                            +  Y LRDVFIWGE
Sbjct  229  ---------------TAIQYVLRDVFIWGE  243



>ref|XP_011038333.1| PREDICTED: uncharacterized protein LOC105135242 isoform X1 [Populus 
euphratica]
Length=1082

 Score =   242 bits (617),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 183/270 (68%), Gaps = 5/270 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L     DR VEQAI+A+KKGAHLLK  R GK KFCPFRLS DEK+LIWYSG++EK
Sbjct  1    MGEESLTTVPFDRTVEQAILAMKKGAHLLKCGRRGKLKFCPFRLSTDEKYLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQ--RSLDLICKDKMQAESWFLGLRA  454
             LRLS V  I+ GQ+T+QLQP++E+Q  SL+Y NG   RSLDLICKDK QA+SWF+GLRA
Sbjct  61   QLRLSLVVKIVTGQRTRQLQPDKENQSFSLIYTNGDRARSLDLICKDKAQADSWFIGLRA  120

Query  455  VISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRS  634
            VIS  H  R +   KS RG QSC+SSPA ++RR+ +LG+   D T++++VRSL+GSP +S
Sbjct  121  VISRCHRSRPICVLKSHRGAQSCVSSPAGFIRRKHHLGILE-DDTEMAQVRSLSGSPTQS  179

Query  635  FSERgcsdglscssdsffselsms-smHNALDAINSGSPYVGPDDLNKRTVDFGQGETQA  811
             S+RG SDGLS SSDS F   S    M N  D + S  P V P +L K   D    E Q 
Sbjct  180  LSDRGISDGLSLSSDSLFFSGSSLPQMQNVEDLLVSYIPNVEPQNLKKNGSDTAFSEFQK  239

Query  812  NMLNLLETSVYESTQSANY-ALRDVFIWGE  898
            N  + L    + S ++     L+DV IWGE
Sbjct  240  NTCHKLIGLNHGSPRTEKKDILKDVLIWGE  269



>ref|XP_009765137.1| PREDICTED: uncharacterized protein LOC104216716 [Nicotiana sylvestris]
Length=865

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 177/270 (66%), Gaps = 7/270 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MG++ LA    DRAVEQAI ALKKGAHLL Y R GKPKFCP +LS DEKFLIWYSGEKE 
Sbjct  1    MGDEHLAILPCDRAVEQAITALKKGAHLLMYGRRGKPKFCPMKLSTDEKFLIWYSGEKEN  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLS+VT+II GQ T    KQLQ + ESQCISL+Y N   +LDLICKD+MQAE+W LGL
Sbjct  61   QLRLSAVTDIIRGQNTVIQHKQLQTDMESQCISLIYGNDDHTLDLICKDEMQAETWLLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS S H   +   KS+R  QSCI SP  YMRR+ NLGL  +  T+ S+V SL+GSP 
Sbjct  121  KAVISRSQHG-LVDDMKSERKTQSCIRSPVGYMRRKHNLGL-SVKKTRSSQVSSLSGSPT  178

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
            +SFSE   S      S   F   S+SS+HN +D + + S  +  D L+++       +  
Sbjct  179  QSFSEN-YSSDGLSWSSHIFLPSSLSSVHNEMDNVITNSLSLESDYLSQKRASCDGTDIH  237

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWGE  898
             +ML     S +ES     + LRDVFIWGE
Sbjct  238  NDMLTPSVPSTHESRLLGKHVLRDVFIWGE  267



>emb|CBI27342.3| unnamed protein product [Vitis vinifera]
Length=925

 Score =   239 bits (609),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ LA    DRAVEQAIV LKKGA+LL+  R GKPKFCPFRLS DEKFLIWYSG++EK
Sbjct  1    MGEESLATVPFDRAVEQAIVTLKKGAYLLRCGRRGKPKFCPFRLSTDEKFLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLSS+T II GQ+T    +QLQ ERE +  SLVYANG+RSLDLICKDK QA+SWFLGL
Sbjct  61   QLRLSSITKIIPGQRTVNFQRQLQEERECRSFSLVYANGERSLDLICKDKAQADSWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R L T ++  GVQ+C +SPA Y RR+ NLGL   D+ K S+VRSL GSP 
Sbjct  121  KAVISRCQHPRQLSTFRNCVGVQTCFNSPAGYFRRKHNLGLLE-DTPKFSQVRSLCGSPT  179

Query  629  RSFSER  646
            +S SER
Sbjct  180  QSLSER  185



>gb|KHF97252.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
Length=1108

 Score =   239 bits (611),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 180/263 (68%), Gaps = 9/263 (3%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR VEQA++A+KKGAHLLK  R GKPK CPFRLS DEK LIWYSG++E+ LRLSSV  I+
Sbjct  14   DRHVEQAVLAMKKGAHLLKCGRRGKPKLCPFRLSADEKHLIWYSGQEERQLRLSSVIKIV  73

Query  314  HGQQT----KQLQPERESQCISLV-YANGQRSLDLICKDKMQAESWFLGLRAVISSSHHK  478
             GQ+T    +Q QP RE Q +SL+ YANG+RSLDLICKDK QA++WF+GLRA IS SH  
Sbjct  74   SGQKTVNFRRQYQPHREQQSLSLIYYANGERSLDLICKDKAQADAWFVGLRAAISRSHSC  133

Query  479  RFLGTPKS-KRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcs  655
            R +   ++  RG QSC+SSPA ++RR+ NLGL   D  + S+VRSL GSP  S SER  S
Sbjct  134  RSVTALRNCSRGAQSCLSSPAGFIRRKHNLGLVE-DRNQFSQVRSLCGSPSLSLSERCFS  192

Query  656  dglscssdsffs-elsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLE  832
            DGLS SSDSF+S E + S M N  D +   SPYV PD   +  VD+   E + N  +   
Sbjct  193  DGLSYSSDSFYSWESNWSHMQNVTDTLLPTSPYVQPDSAKQWEVDYAAPEFRENTSHRFA  252

Query  833  TSVYESTQ-SANYALRDVFIWGE  898
            T  + STQ   N  L+DV IWGE
Sbjct  253  TPTHYSTQIQKNEVLKDVMIWGE  275



>ref|XP_011043875.1| PREDICTED: uncharacterized protein LOC105139209 [Populus euphratica]
Length=1066

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 181/270 (67%), Gaps = 5/270 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L     DR VEQAI+A+KKGA LLK  R GKPKFCPFRLS DEK+LIWYSG++EK
Sbjct  1    MGEESLTTVPFDRTVEQAILAMKKGAQLLKCGRRGKPKFCPFRLSTDEKYLIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQ--RSLDLICKDKMQAESWFLGLRA  454
             LRLS VT I+ GQ+T+QLQP++E+Q  SL+Y +G   RSLDLICKD  QA+SWF+GLRA
Sbjct  61   QLRLSLVTKIVTGQRTRQLQPDKENQSFSLLYTDGDRSRSLDLICKDNAQADSWFIGLRA  120

Query  455  VISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRS  634
            V+S  HH R     K+ R  QSC++SPA ++RR+ NLG+   D T++S+V SL GSP +S
Sbjct  121  VMSKCHHARPFCALKNHRVAQSCVNSPAGFIRRKYNLGILE-DDTEMSQVHSLHGSPTQS  179

Query  635  FSERgcsdglscssdsffselsmssmHNAL-DAINSGSPYVGPDDLNKRTVDFGQGETQA  811
             S+RG +DGLS SSDS     +   +   + D +   +P   P ++ K   D G  E Q 
Sbjct  180  ISDRGFADGLSLSSDSLCFSEASLPLLQTVEDFLIPCTPNAEPQNIKKNGSDNGFAEFQK  239

Query  812  NMLNLLETSVYESTQSA-NYALRDVFIWGE  898
            NM   +  S + S ++  N  L+DV IWGE
Sbjct  240  NMCRRIIGSNHGSQRTEKNDVLKDVLIWGE  269



>ref|XP_006350488.1| PREDICTED: uncharacterized protein LOC102583534 [Solanum tuberosum]
Length=888

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 170/268 (63%), Gaps = 30/268 (11%)
 Frame = +2

Query  101  MGEQFLA-PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGE+ LA    SDRAVEQAI+ALKKG  LLKY R GKPKFCP RLS DEKFLIWYSGEKE
Sbjct  1    MGEEHLAIVPPSDRAVEQAIIALKKGT-LLKYGRRGKPKFCPLRLSADEKFLIWYSGEKE  59

Query  278  KHLRLSSVTNIIHGQQT-KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRA  454
              L LS+VT+II GQ T  QL+ E +SQCISL+Y N   SLDLICKDK+QA +WFLGLRA
Sbjct  60   NQLSLSAVTDIIRGQNTVNQLKAEMDSQCISLIYGNDDHSLDLICKDKVQAATWFLGLRA  119

Query  455  VISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRS  634
            VIS S H   +   KSKRGVQSCISSP  Y+RR+ NLG + +  ++ S+VRS + SP +S
Sbjct  120  VISRSRHG-LVEHMKSKRGVQSCISSPVGYLRRKHNLG-FSLKKSRFSQVRSFSRSPTQS  177

Query  635  FSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQAN  814
            FS++         S S    L +SS+HN +D + + S     DDL ++         Q  
Sbjct  178  FSDK---CYTDGLSCSSDIFLPLSSVHNGMDDVIANSS---SDDLRRKRATCDDTTIQ--  229

Query  815  MLNLLETSVYESTQSANYALRDVFIWGE  898
                             Y LRDVFIWGE
Sbjct  230  -----------------YVLRDVFIWGE  240



>ref|XP_008227901.1| PREDICTED: uncharacterized protein LOC103327368 [Prunus mume]
Length=1071

 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 177/272 (65%), Gaps = 11/272 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MG+  L+  A DRAV+QAIV++KKGA+LLKY + GKPKFCPFRLS DEKFLIWYSG++E+
Sbjct  1    MGDHSLSTAAFDRAVQQAIVSMKKGAYLLKYGQRGKPKFCPFRLSTDEKFLIWYSGKEER  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LSSVT II GQ++    +QL+PERE Q  SLVYA G+RSLDLICKD+ Q E W LGL
Sbjct  61   QLKLSSVTKIIPGQRSVSFRRQLEPERECQSFSLVYAQGERSLDLICKDEAQCEYWILGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+IS   H R L + +S R VQSC++SPA  +RR+QNLG+   D+T+ S+VRS+  SP 
Sbjct  121  RALISRCCHPRPLSSLRSFRQVQSCLNSPAGPLRRKQNLGVMD-DATEFSQVRSVCASPT  179

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQG-E  802
             S SER         S   + SE  +SSM N  D     SP++  D L +R +    G E
Sbjct  180  LSLSERCFSDGLSYSSDSFYSSERVLSSMQNVTDISVPDSPHIESDHLKRRRIYSDAGYE  239

Query  803  TQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                +     TS  E     +  L+DV IWGE
Sbjct  240  PHRFVSYAFGTSRIEK----DNILKDVMIWGE  267



>ref|XP_010062322.1| PREDICTED: uncharacterized protein LOC104449763 [Eucalyptus grandis]
Length=1069

 Score =   231 bits (589),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 177/272 (65%), Gaps = 7/272 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+FL   ++DRAVEQAI+A+KKGA+LLK   M +P+ CPFR+S DEKF+IWYSG++EK
Sbjct  1    MGEEFLERVSTDRAVEQAIMAVKKGAYLLKCEGMRRPRVCPFRISVDEKFMIWYSGQEEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLSSVT +I GQ+T    KQLQP+RE+Q  SL+YA+G+RS+DLICKD  QA+SW+LGL
Sbjct  61   QLRLSSVTEVIRGQRTVNFQKQLQPDREAQSFSLIYADGKRSIDLICKDHAQADSWYLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            + +IS   H R   + +S  GVQ+C++SPA +MRR+ NLGL   D+    +VRSL GSP 
Sbjct  121  KTIISKCQHSRPFASFRSPSGVQTCVNSPAGFMRRKYNLGLLE-DTAGFCQVRSLCGSPA  179

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             S S+R       + S   + SE S S +H+     N         +L+K    +G  + 
Sbjct  180  LSLSKRYFSEGSSNSSDSFYSSESSTSQVHDITYYNNPEFLSAESKNLSKSESSYGGRDI  239

Query  806  QANMLNLLETSVYESTQ-SANYALRDVFIWGE  898
            Q ++     +  Y ST    N  L+D+FIWGE
Sbjct  240  QKDLPRQFASPDYSSTHVQPNKNLKDIFIWGE  271



>ref|XP_010908615.1| PREDICTED: uncharacterized protein LOC105034955 [Elaeis guineensis]
Length=1098

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E F     SDR +EQAI+ALKKGAHLLK  R GKP+FCPFRLS DEK LIWYSG+KEK
Sbjct  1    MAENFARRTPSDRGIEQAIIALKKGAHLLKCGRRGKPRFCPFRLSTDEKILIWYSGDKEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+L +V+ ++ GQQT    +  QPE+ESQ  SL+Y NG+RSLDLICKDK QAESWF+GL
Sbjct  61   HLKLIAVSKVVLGQQTVNFLRHCQPEKESQSFSLIYQNGERSLDLICKDKEQAESWFIGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +A++S SHH R L   ++ RG  SC++SP  ++R +  LGL   DS K SKVRSL GSP 
Sbjct  121  KALVSGSHHPRTLANLRNSRGSYSCVNSPIGHVRTKHKLGLL-QDSVKFSKVRSLYGSPS  179

Query  629  RSFSER  646
            +S  ER
Sbjct  180  QSLLER  185



>ref|XP_009631452.1| PREDICTED: uncharacterized protein LOC104121219 isoform X1 [Nicotiana 
tomentosiformis]
Length=995

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 168/254 (66%), Gaps = 7/254 (3%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
            +AI ALKKGAHLL Y R GKPKFCP RLS DEKFLIWYSGEKE  LRLS+VT+II GQ T
Sbjct  31   KAITALKKGAHLLTYGRRGKPKFCPLRLSTDEKFLIWYSGEKENQLRLSAVTDIIRGQNT  90

Query  329  ----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
                KQLQ + ESQCISL+Y N   +LDLICKD+MQAE+WFLGL+AVIS S H   +   
Sbjct  91   VIQQKQLQADMESQCISLIYGNDDHTLDLICKDEMQAETWFLGLKAVISRSRHG-LVDDM  149

Query  497  KSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdglscss  676
            KS+R  QSCI SP  YMRR+ NLGL  +  T+ S+V SL+GSP +SFSE   S      S
Sbjct  150  KSERRAQSCILSPVGYMRRKHNLGL-SVKKTRSSQVSSLSGSPTQSFSEN-YSSDGLSCS  207

Query  677  dsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSVYESTQ  856
             +     S+SS+HN +D + + S  + PD L+++       +   +ML     S ++S  
Sbjct  208  SNILFPPSLSSVHNEMDNVITNSSSLEPDYLSQKRASCDGTDIHNDMLTPSVPSTHKSGL  267

Query  857  SANYALRDVFIWGE  898
               + LRDVFIWGE
Sbjct  268  LGKHVLRDVFIWGE  281



>ref|XP_009631454.1| PREDICTED: uncharacterized protein LOC104121219 isoform X3 [Nicotiana 
tomentosiformis]
Length=965

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 167/253 (66%), Gaps = 7/253 (3%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT-  328
            AI ALKKGAHLL Y R GKPKFCP RLS DEKFLIWYSGEKE  LRLS+VT+II GQ T 
Sbjct  2    AITALKKGAHLLTYGRRGKPKFCPLRLSTDEKFLIWYSGEKENQLRLSAVTDIIRGQNTV  61

Query  329  ---KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
               KQLQ + ESQCISL+Y N   +LDLICKD+MQAE+WFLGL+AVIS S H   +   K
Sbjct  62   IQQKQLQADMESQCISLIYGNDDHTLDLICKDEMQAETWFLGLKAVISRSRHG-LVDDMK  120

Query  500  SKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdglscssd  679
            S+R  QSCI SP  YMRR+ NLGL  +  T+ S+V SL+GSP +SFSE   S      S 
Sbjct  121  SERRAQSCILSPVGYMRRKHNLGL-SVKKTRSSQVSSLSGSPTQSFSEN-YSSDGLSCSS  178

Query  680  sffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSVYESTQS  859
            +     S+SS+HN +D + + S  + PD L+++       +   +ML     S ++S   
Sbjct  179  NILFPPSLSSVHNEMDNVITNSSSLEPDYLSQKRASCDGTDIHNDMLTPSVPSTHKSGLL  238

Query  860  ANYALRDVFIWGE  898
              + LRDVFIWGE
Sbjct  239  GKHVLRDVFIWGE  251



>ref|XP_008794532.1| PREDICTED: uncharacterized protein LOC103710544 [Phoenix dactylifera]
Length=1095

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 136/186 (73%), Gaps = 5/186 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E F     SDR +EQ I+ALKKGAHLLK  R GKPKFCPFRLS DEK LIWYSGEKEK
Sbjct  1    MAENFARRTPSDRGIEQGILALKKGAHLLKCGRRGKPKFCPFRLSTDEKILIWYSGEKEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+L +V+ ++ GQQT    +  QPE+ES+  SL+Y NG+RSLDLICKDK QAESWFLGL
Sbjct  61   HLKLIAVSKVVLGQQTVNFLRHCQPEKESRSFSLIYQNGERSLDLICKDKEQAESWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +A++S+SHH R L   ++ RG  SC++SP  ++R +  LG +  DS K SKV SL GSP 
Sbjct  121  KALVSASHHPRTLANLRNSRGAYSCVNSPIGHVRTKHKLG-FLQDSVKFSKVHSLYGSPS  179

Query  629  RSFSER  646
            +S  ER
Sbjct  180  QSLLER  185



>ref|XP_007146986.1| hypothetical protein PHAVU_006G086900g [Phaseolus vulgaris]
 gb|ESW18980.1| hypothetical protein PHAVU_006G086900g [Phaseolus vulgaris]
Length=1072

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 172/273 (63%), Gaps = 12/273 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA    DRA+EQAIV++KKGA+LLK  R GKPK CPFRLSQDE+ LIWYSG++EK
Sbjct  3    MEEESLATVPFDRAIEQAIVSIKKGAYLLKCGRRGKPKLCPFRLSQDERNLIWYSGQQEK  62

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HLRLS VT I+ GQ+     +Q +PE+E    SL+YANG+RSLDLICKDK QA +WF+GL
Sbjct  63   HLRLSVVTKIVQGQENIRSQRQNEPEKECHSFSLIYANGERSLDLICKDKAQAATWFVGL  122

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R   + +S +GVQSC+SSPA  +RR++NLGL   ++++ ++V SL  SP 
Sbjct  123  KAVISRCQHPRAFSSLRSCKGVQSCVSSPAGILRRKKNLGLLD-ETSQFTQVHSLCASPT  181

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPD---DLNKRTVDFGQ  796
             S SER         S + + S   +SS H   D     SPY+ P+   ++    +D   
Sbjct  182  LSLSERCFSDGLSCTSDNLYSSTSFISSTHGVTDNSVPCSPYIDPEVRSNIESTRIDKEH  241

Query  797  GETQANMLNLLETSVYESTQSANYALRDVFIWG  895
             +  +       TSV+    +    L+DV IWG
Sbjct  242  KKNLSYRYLTHSTSVHLGKSN---VLKDVMIWG  271



>ref|XP_006602026.1| PREDICTED: uncharacterized protein LOC100797223 isoform X1 [Glycine 
max]
 ref|XP_006602027.1| PREDICTED: uncharacterized protein LOC100797223 isoform X2 [Glycine 
max]
 ref|XP_006602028.1| PREDICTED: uncharacterized protein LOC100797223 isoform X3 [Glycine 
max]
Length=1070

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 166/270 (61%), Gaps = 6/270 (2%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA    DRA+EQAIV++KKGA+LLK  R GKPK CPFRLSQDE+ LIWYSG++EK
Sbjct  3    MEEESLAAVPFDRAIEQAIVSIKKGAYLLKCRRRGKPKLCPFRLSQDERNLIWYSGQQEK  62

Query  281  HLRLSSVTNIIHGQQ----TKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HLRLS VT I+ GQ+     KQ + E+E    SL+YANG+RSLDLICKDK QA SWF+GL
Sbjct  63   HLRLSVVTKIVQGQEHIRSQKQNESEKECHSFSLIYANGERSLDLICKDKAQAASWFVGL  122

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R   + +S +GVQSC SSPA  +RR++NLGL   D+++ ++V S+  SP 
Sbjct  123  KAVISRCQHPRAFSSLRSCKGVQSCASSPAGILRRKKNLGLLD-DTSQFTQVHSVCASPT  181

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             S SER         S + + S   +S+ H   D     SPY+ PD+ +         E 
Sbjct  182  LSLSERCFSDGLSCTSDNFYSSSSFLSNTHGVTDNSVPSSPYIDPDNHSNIESTRIDKEH  241

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWG  895
            + N+               N  L+DV IWG
Sbjct  242  KKNLSYRYLMHSTSPHVGKNNVLKDVMIWG  271



>ref|XP_006591312.1| PREDICTED: uncharacterized protein LOC100794953 [Glycine max]
Length=1074

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 170/273 (62%), Gaps = 12/273 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA    DRA+EQAIV++KKGA+LLK  R GKPK CPFRLSQDE+ LIWYSG++EK
Sbjct  3    MEEESLAAVPFDRAIEQAIVSIKKGAYLLKCGRRGKPKLCPFRLSQDERNLIWYSGQQEK  62

Query  281  HLRLSSVTNIIHGQQ----TKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HLRLS VT I+ GQ+     +Q + E+E    SL+ ANG+RSLDLICKDK QA SWF+ L
Sbjct  63   HLRLSVVTKIVQGQEHIRSQRQNESEKECHSFSLICANGERSLDLICKDKAQAASWFVAL  122

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R   + +S +GVQSC+SSPA  +RR++NLGL   D+++ ++V S+  SP 
Sbjct  123  KAVISRCQHPRAFSSLRSCKGVQSCVSSPAGILRRKKNLGLLD-DTSQFTQVHSVCASPT  181

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPD---DLNKRTVDFGQ  796
             S SER         S + + S   +SS H   D+  + SPY+ PD   ++    +D   
Sbjct  182  MSLSERCFSDGLSCTSDNFYSSASFLSSTHGVTDSSVASSPYIDPDIHGNIESTRID---  238

Query  797  GETQANMLNLLETSVYESTQSANYALRDVFIWG  895
             E + N+ +             +  L+DV IWG
Sbjct  239  KEHKKNLSDSYLMHFTTPHVGKSNVLKDVMIWG  271



>gb|KHN24172.1| Putative E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=1074

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 170/273 (62%), Gaps = 12/273 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA    DRA+EQAIV++KKGA+LLK  R GKPK CPFRLSQDE+ LIWYSG++EK
Sbjct  3    MEEESLAAVPFDRAIEQAIVSIKKGAYLLKCGRRGKPKLCPFRLSQDERNLIWYSGQQEK  62

Query  281  HLRLSSVTNIIHGQQ----TKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HLRLS VT I+ GQ+     +Q + E+E    SL+ ANG+RSLDLICKDK QA SWF+ L
Sbjct  63   HLRLSVVTKIVQGQEHIRSQRQNESEKECHSFSLICANGERSLDLICKDKAQAASWFVAL  122

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS   H R   + +S +GVQSC+SSPA  +RR++NLGL   D+++ ++V S+  SP 
Sbjct  123  KAVISRCQHPRAFSSLRSCKGVQSCVSSPAGILRRKKNLGLLD-DTSQFTQVHSVCASPT  181

Query  629  RSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPD---DLNKRTVDFGQ  796
             S SER         S + + S   +SS H   D+  + SPY+ PD   ++    +D   
Sbjct  182  MSLSERCFSDGLSCTSDNFYSSASFLSSTHGVTDSSVASSPYIDPDIHGNIESTRID---  238

Query  797  GETQANMLNLLETSVYESTQSANYALRDVFIWG  895
             E + N+ +             +  L+DV IWG
Sbjct  239  KEHKKNLSDSYLMHFTTPHVGKSNVLKDVMIWG  271



>ref|XP_006391327.1| hypothetical protein EUTSA_v10018066mg [Eutrema salsugineum]
 gb|ESQ28613.1| hypothetical protein EUTSA_v10018066mg [Eutrema salsugineum]
Length=1001

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 176/270 (65%), Gaps = 13/270 (5%)
 Frame = +2

Query  101  MGEQFLAPGAS-DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ ++     DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG++E
Sbjct  1    MGEQQISASVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ QP+R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQPDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL GSP
Sbjct  121  LRAVITKHHNARSSANLRTSRGAQSCINSPAGFIRRKQNLGLLE-ETPDFTQIRSLCGSP  179

Query  626  DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
                 ER  S+GLSCSSDSF+S  S      A D     SP+    D + R  D  +  +
Sbjct  180  STLLEERCLSNGLSCSSDSFYSVESA-----ASDGFGPVSPHY-ETDYSLRNSDCDRIGS  233

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWG  895
            Q  + +   + + ++T  +N  L+D+ IWG
Sbjct  234  QRFVASPPPSIITQTTTRSN-VLKDIMIWG  262



>ref|XP_008454367.1| PREDICTED: uncharacterized protein LOC103494787 [Cucumis melo]
Length=1090

 Score =   213 bits (543),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 134/269 (50%), Positives = 171/269 (64%), Gaps = 12/269 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L+    DRAVEQAI+++KKGA+LLK  R GKPKFCPFRLS DEKFL+WYSG +EK
Sbjct  1    MGEESLSIILHDRAVEQAILSMKKGAYLLKSRRRGKPKFCPFRLSMDEKFLVWYSGNQEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLS V  II G+ +     QLQ  ++ +  SL+YAN +RSL L CKDK QA+ WFLGL
Sbjct  61   QLRLSLVVKIIPGKMSPSLVNQLQTTKKLESFSLIYANCERSLVLTCKDKAQADCWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
             ++IS +HH R L + K +RG+ SC +SPA ++RR+ NLGL   DS    +VRSL GSP 
Sbjct  121  SSIISRNHHPRPLTSLKDQRGIVSCANSPAGFIRRKYNLGLLE-DSADFPQVRSLCGSPT  179

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
             S SER  SDGLS S DSF+     S      D    G+P   PD LN+ ++D  +   +
Sbjct  180  LSLSERCLSDGLSHSFDSFYPSDGQSEG----DISAWGTPLAEPDVLNRGSLD--EPVYE  233

Query  809  ANMLNLLETSVYESTQ-SANYALRDVFIW  892
             N L+     V+ S     N  L+DV IW
Sbjct  234  KNALSRFVAPVHTSPYIEKNNILKDVMIW  262



>ref|XP_002888466.1| hypothetical protein ARALYDRAFT_475695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64725.1| hypothetical protein ARALYDRAFT_475695 [Arabidopsis lyrata subsp. 
lyrata]
Length=1005

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSGE+E
Sbjct  1    MGEQQISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGEEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA +MRR+QNLGL   ++  L+++RSL GSP
Sbjct  121  LRAVITKHHNIRNSANLRTSRGAQSCINSPAGFMRRKQNLGLLE-ETPDLTQIRSLCGSP  179

Query  626  DRSFSER  646
                 ER
Sbjct  180  STLLEER  186



>ref|XP_007216689.1| hypothetical protein PRUPE_ppa026859mg, partial [Prunus persica]
 gb|EMJ17888.1| hypothetical protein PRUPE_ppa026859mg, partial [Prunus persica]
Length=995

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 164/255 (64%), Gaps = 11/255 (4%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT-  328
            AIV++KKGA+LLKY + GKPKFCPFRLS DEKFLIWYSG++E+ L+LS VT II GQ++ 
Sbjct  1    AIVSMKKGAYLLKYGQRGKPKFCPFRLSTDEKFLIWYSGKEERQLKLSLVTKIIPGQRSV  60

Query  329  ---KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
               +QL+PERE Q  SLVYA+G+RSLDLICKD+ Q E W LGLRA+IS   H R L +  
Sbjct  61   SFRRQLEPERECQSFSLVYAHGERSLDLICKDEAQCEYWILGLRALISRCRHPRTLSSLG  120

Query  500  SKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERg-csdglscss  676
            S R VQSC++SPA  +RR+QNLG+   D+T+ S+VRS+  SP  S SER         S 
Sbjct  121  SFRQVQSCLNSPAGPLRRKQNLGVMD-DATEFSQVRSVCASPTLSLSERCFSDGLSYSSD  179

Query  677  dsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQG-ETQANMLNLLETSVYEST  853
              + SE  +SSM N  D     SP++  D L +R +    G E    +     TS  E  
Sbjct  180  SFYSSERVLSSMKNVTDISVPDSPHIESDHLKRRRIYSDAGYEPHRFVSYAFGTSRIEK-  238

Query  854  QSANYALRDVFIWGE  898
               +  L+DV IWGE
Sbjct  239  ---DNILKDVMIWGE  250



>ref|NP_176767.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain [Arabidopsis thaliana]
 gb|AAF06053.1|AC009513_9 Contains PF|00169 Pleckstrin homology domain, 6 PF|00415 Regulator 
of chromosome condensation (RCC1) domains and a PF|01363 
FYVE Zinc finger domain [Arabidopsis thaliana]
 gb|AEE34441.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain [Arabidopsis thaliana]
Length=1006

 Score =   211 bits (536),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 134/187 (72%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFLAPGAS-DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ ++     DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSGE+E
Sbjct  1    MGEQQISVTVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGEEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     +S RG QSCI+SPA +MRR+QNLGL   ++  ++++RSL GSP
Sbjct  121  LRAVITKHHNIRNSVNHRSSRGAQSCINSPAGFMRRKQNLGLLE-ETPDVTQIRSLCGSP  179

Query  626  DRSFSER  646
                 ER
Sbjct  180  STLLEER  186



>ref|XP_009124153.1| PREDICTED: uncharacterized protein LOC103849089 isoform X2 [Brassica 
rapa]
Length=1000

 Score =   210 bits (534),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 132/185 (71%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG+ E
Sbjct  1    MGEQHISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQDE  60

Query  278  KHLRLSSVTNIIHGQQT--KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLR  451
            + LRLSSV  I+ GQ T  KQ QP+R+ Q  SLVYANG+ +LDLICKDK QA+SWF GLR
Sbjct  61   RQLRLSSVITIVRGQITFEKQAQPDRKEQSFSLVYANGEYTLDLICKDKAQADSWFKGLR  120

Query  452  AVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDR  631
            AVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL  SP  
Sbjct  121  AVITKHHNARSSVNLRTSRGAQSCINSPAGFIRRKQNLGLVE-ETPDFTQIRSLCASPST  179

Query  632  SFSER  646
               ER
Sbjct  180  LLEER  184



>ref|XP_010511515.1| PREDICTED: uncharacterized protein LOC104787607 [Camelina sativa]
Length=1001

 Score =   210 bits (534),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 173/277 (62%), Gaps = 25/277 (9%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG++E
Sbjct  1    MGEQQISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL GSP
Sbjct  121  LRAVITKHHNVRTSANLRTSRGAQSCINSPAGFIRRKQNLGLLE-ETPDFTQIRSLCGSP  179

Query  626  DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDF-----  790
                 ER  S+GLSCSSDSF           A DAI+  S Y    D + R  DF     
Sbjct  180  STLLEERCLSNGLSCSSDSFA----------ASDAIDPVSSYY-ETDYDTRNSDFESTGS  228

Query  791  --GQGETQANMLNLLETSVYESTQSANYALRDVFIWG  895
               +  +Q  + +   + + +    +N  L+D+ IWG
Sbjct  229  ELCKNSSQRFVASPPPSIITQPVTRSN-VLKDIMIWG  264



>ref|XP_009400323.1| PREDICTED: uncharacterized protein LOC103984534 [Musa acuminata 
subsp. malaccensis]
Length=1047

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 174/277 (63%), Gaps = 14/277 (5%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            + +M E F     S R VEQAI ALKKGAHLLK  R GKPKFCPFRLS DEK LIWYSGE
Sbjct  1    MSEMAENFGRRTPSVREVEQAITALKKGAHLLKCGRRGKPKFCPFRLSTDEKSLIWYSGE  60

Query  272  KEKHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            KEKHL L+SV+ ++ GQQT    +Q Q +++ Q  SLVY NGQRSLDLICKDK QAESW 
Sbjct  61   KEKHLNLNSVSKLVPGQQTANFLRQNQADKKIQSFSLVYENGQRSLDLICKDKEQAESWC  120

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAG  619
            LGL A++S+SH  R L   +S R   SC++SPA Y      LG+    S KL+KV SL G
Sbjct  121  LGLTALVSTSHQPRSLAHVRSSRWAHSCVNSPAKYAATNHRLGIL-QGSAKLAKVHSLYG  179

Query  620  SPDRSFSERgcsdglscssds--ffselsmssmHNALDAINSGSPYV---GPDDLNKRTV  784
            SP RS  ++  SD +  SSD      + ++S + + LD I    P+V   G +D  +  +
Sbjct  180  SPARSVLDKHLSDRMLGSSDEFYSPRQRTLSDIQSYLDKILPRLPHVVSYGDEDKIESNL  239

Query  785  DFGQGETQANMLNLLETSVYESTQ-SANYALRDVFIW  892
              GQ   + + ++ L +S +ES +   N  L+DVFIW
Sbjct  240  SKGQ---RMHPVSKLSSSDHESPKLYVNDGLKDVFIW  273



>gb|KFK41026.1| hypothetical protein AALP_AA2G075500 [Arabis alpina]
Length=985

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 133/180 (74%), Gaps = 6/180 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK+ R G PKFCPFRLS DEK+LIWYSG++E
Sbjct  1    MGEQQISATVPRDRTDEQAILALKKGAQLLKFRRRGNPKFCPFRLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + L+LSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLKLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R   T ++ RG QSCI+SPA ++RR+QNLGL   +S   +++RS+ GSP
Sbjct  121  LRAVITKHHNIRNSATLRASRGAQSCINSPAGFIRRKQNLGLLE-ESPDFTQIRSVCGSP  179



>emb|CDY31624.1| BnaA06g20390D [Brassica napus]
Length=983

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG+ E
Sbjct  1    MGEQHISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQDE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ QP+R+ Q  SLVYANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPKFEKQAQPDRKEQSFSLVYANGEYTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL  SP
Sbjct  121  LRAVITKHHNARSSVNLRTSRGAQSCINSPAGFIRRKQNLGLVE-ETPDFTQIRSLCASP  179

Query  626  DRSFSER  646
                 ER
Sbjct  180  STLLEER  186



>ref|XP_009124152.1| PREDICTED: uncharacterized protein LOC103849089 isoform X1 [Brassica 
rapa]
Length=1002

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG+ E
Sbjct  1    MGEQHISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQDE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ QP+R+ Q  SLVYANG+ +LDLICKDK QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPKFEKQAQPDRKEQSFSLVYANGEYTLDLICKDKAQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL  SP
Sbjct  121  LRAVITKHHNARSSVNLRTSRGAQSCINSPAGFIRRKQNLGLVE-ETPDFTQIRSLCASP  179

Query  626  DRSFSER  646
                 ER
Sbjct  180  STLLEER  186



>ref|XP_010470464.1| PREDICTED: uncharacterized protein LOC104750376 [Camelina sativa]
Length=1001

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG++E
Sbjct  1    MGEQQISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QAESWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQAESWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++   +++RSL GSP
Sbjct  121  LRAVITKHHNVRTSTNLRTSRGAQSCINSPAGFIRRKQNLGLLE-ETPDYTQIRSLCGSP  179

Query  626  DRSFSER  646
                 ER
Sbjct  180  STLLEER  186



>ref|XP_009410703.1| PREDICTED: uncharacterized protein LOC103992609 [Musa acuminata 
subsp. malaccensis]
Length=1060

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 171/282 (61%), Gaps = 26/282 (9%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E F     S R VEQAI ALKKGAHLLK  R GKPKFCPFR+S DEK LIWYSGEKEK
Sbjct  1    MAENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKFCPFRISTDEKILIWYSGEKEK  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL L +V+ +I GQQT    +Q Q ++++Q  SLVY NGQRSLDLICKDK QAESW LGL
Sbjct  61   HLNLDAVSKVISGQQTVNFLRQNQADKKNQSFSLVYENGQRSLDLICKDKEQAESWRLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
             A++S+SH  R L   +S R   +C +SP  Y+     LGL    S KL+KVRSL G+P 
Sbjct  121  TALVSASHQPRILANIRSSRWAHTCANSPVGYIATNHKLGLL-QGSAKLAKVRSLYGTPA  179

Query  629  RSFSERgcsdglscssds--ffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGE  802
            RS  ++  SD +  +SD      + ++S + + LD I    P+V         V +G+ E
Sbjct  180  RSLLDKHLSDRMMNTSDEFYSPRQRTLSDIQSYLDKILPRLPHV---------VSYGEKE  230

Query  803  TQANML---------NLLETSVYESTQ-SANYALRDVFIWGE  898
             + + L         + L +S +ES +   N  L+D F+WG+
Sbjct  231  KKDSNLSKGQRMFPISKLSSSEHESPKIYVNDGLKDAFMWGK  272



>emb|CDX87989.1| BnaC03g54070D [Brassica napus]
Length=1002

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 158/270 (59%), Gaps = 15/270 (6%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFC F+LS DEK+LIWYSG+ E
Sbjct  1    MGEQHISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCHFKLSMDEKYLIWYSGQDE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ QP+R+ Q  SLVYANG+ +LDLICKDK QA SWF G
Sbjct  61   RQLRLSSVITIVRGQITPKFQKQAQPDRKEQSFSLVYANGEYTLDLICKDKAQAGSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++ R+QNLGL   ++   +++RSL  SP
Sbjct  121  LRAVITKHHNARSSVNLRTSRGAQSCINSPAGFIHRKQNLGLLE-ETPDFTQIRSLCASP  179

Query  626  DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
                 ER      S  S                D +   SPY    D N R  D  Q  +
Sbjct  180  STLLEERCLWLSGSSDSFYSMESAGS-------DGLGPVSPYY-EADYNSRRSDCDQTGS  231

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWG  895
            + ++      +V + T  +N  L+DV IWG
Sbjct  232  ELSIYVSPSHTVTQPTARSN-VLKDVMIWG  260



>ref|XP_004152369.1| PREDICTED: uncharacterized protein LOC101216037 [Cucumis sativus]
 gb|KGN52791.1| hypothetical protein Csa_4G001580 [Cucumis sativus]
Length=1088

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 169/269 (63%), Gaps = 12/269 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            MGE+ L+    DRAVEQAI+++KKGA+LLK  R GKPKFCPFRLS DEKFL+WYSG +EK
Sbjct  1    MGEESLSIILHDRAVEQAILSMKKGAYLLKSRRRGKPKFCPFRLSMDEKFLVWYSGNQEK  60

Query  281  HLRLSSVTNIIHGQQ----TKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRLS V  II G+       QLQ  ++ +  SL+Y+N +RSL L CKDK QA+ WFLGL
Sbjct  61   QLRLSLVVKIIPGKMLPSLVNQLQITKKLESFSLIYSNCERSLVLTCKDKAQADCWFLGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
             ++IS +HH R +   K +RG+ SC +SPA ++RR+ NLGL   DS    +VRSL GSP 
Sbjct  121  SSIISRNHHPRPVTILKDQRGIVSCANSPAGFIRRKYNLGLLE-DSADFPQVRSLCGSPT  179

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
             S SER  SDGLS S DSF+     S      D    G+P   PD LN+ ++D  +   +
Sbjct  180  LSLSERCLSDGLSHSFDSFYPSDGQSEG----DISAWGTPVAEPDVLNRGSLD--ETIYE  233

Query  809  ANMLNLLETSVYESTQ-SANYALRDVFIW  892
             N L+     V+ S     N  L+DV IW
Sbjct  234  KNALSRFVAPVHTSPYIEKNNILKDVMIW  262



>ref|XP_006300666.1| hypothetical protein CARUB_v10019706mg, partial [Capsella rubella]
 gb|EOA33564.1| hypothetical protein CARUB_v10019706mg, partial [Capsella rubella]
Length=1037

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 134/187 (72%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG++E
Sbjct  36   MGEQQISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQEE  95

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK QA+SWF G
Sbjct  96   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG  155

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL   ++  ++++RSL GSP
Sbjct  156  LRAVITKHHNIRSSANLRTSRGAQSCINSPAGFIRRKQNLGLLE-ETPDITQIRSLCGSP  214

Query  626  DRSFSER  646
                 ER
Sbjct  215  STLLEER  221



>ref|XP_010528597.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104805657 
[Tarenaya hassleriana]
Length=1031

 Score =   208 bits (529),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 173/269 (64%), Gaps = 20/269 (7%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR  EQAI+ALKKGAHLLK  R GKPKFCPFRLS DEK+LIWYSG++E+ LRLSS   I 
Sbjct  13   DRTAEQAILALKKGAHLLKCRRRGKPKFCPFRLSMDEKYLIWYSGQEERQLRLSSAVKIA  72

Query  314  HGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T    +QLQ +RE Q  SL+YANG+ +LDLICKDK QA+SW  GLRAVI+   +  
Sbjct  73   RGQRTANFQRQLQLDREEQSFSLIYANGEHTLDLICKDKTQADSWIKGLRAVITKHQNFG  132

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP----DRSFSERg  649
              G  ++ RG QSCI+SPA ++RR+QNLGL   ++ + S++RSL GSP    +    ER 
Sbjct  133  TNGNLRTSRGAQSCINSPAGFIRRKQNLGLLE-ETAEFSQIRSLCGSPSPLLEXXXXERC  191

Query  650  csdglscssds-ffselsmssmHNALDAINSGSPYVGPD------DLNKRTVDFGQGETQ  808
             S+GLSCSSDS +  E S+S  + A D     SPY   +      +L+   ++F +  +Q
Sbjct  192  LSNGLSCSSDSFYSVESSLSKTYAASDVFGPTSPYRDAEYNVKNWELDYTGLEFSKHSSQ  251

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWG  895
                  L + V     + + AL+D+ IWG
Sbjct  252  ----RFLPSPVITPQIAKSNALKDIMIWG  276



>ref|XP_003600638.1| RCC1 and BTB domain-containing protein [Medicago truncatula]
 gb|AES70889.1| regulator of chromosome condensation (RCC1) family protein [Medicago 
truncatula]
Length=1032

 Score =   206 bits (523),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/270 (47%), Positives = 171/270 (63%), Gaps = 9/270 (3%)
 Frame = +2

Query  107  EQFLAPGA--SDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            E+   PG    DRA+EQAIV++KKGA+LLK    GKPK CPFRLS DE+ LIW SG++EK
Sbjct  4    EEVSLPGTLPFDRALEQAIVSIKKGAYLLKCGGRGKPKLCPFRLSPDERNLIWCSGQQEK  63

Query  281  HLRLSSVTNIIHGQ----QTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HLRLS VT I+ G+      +Q + E+E    SL+YANG+ SLDLICKDK QA +WF+GL
Sbjct  64   HLRLSGVTKIVQGEGNIRSQRQNETEKECHSFSLIYANGEHSLDLICKDKAQAATWFVGL  123

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            +AVIS     +   + +S +GVQSC+SSP+  +RR++NLGL   D+++ ++V S+  SP 
Sbjct  124  KAVISRCQQPKAFSSLRSCKGVQSCVSSPSGILRRKKNLGLLD-DTSQFTQVHSVCASPT  182

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPD-DLNKRTVDFGQGET  805
             S SER  SDGLS  S+ + S  S+SS+H   D     SPY+ PD   N +T  F + E 
Sbjct  183  LSLSERCFSDGLSYKSEFYSSVSSLSSIHGMTDNSVPSSPYINPDIHSNIKTSRF-EKEY  241

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWG  895
            +  + +        S    N  L+DV +WG
Sbjct  242  KKELSSNRSIMPPASALVGNNVLKDVMVWG  271



>ref|XP_004503095.1| PREDICTED: uncharacterized protein LOC101491261 [Cicer arietinum]
Length=1060

 Score =   205 bits (521),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 172/267 (64%), Gaps = 14/267 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            P   DRA+EQAIV++KKGA+LLK    GKPK CPFRLS DE+ LIW SG++EKHLRLS V
Sbjct  8    PLPFDRALEQAIVSIKKGAYLLKCGGRGKPKLCPFRLSPDERNLIWCSGQQEKHLRLSGV  67

Query  302  TNII--HGQQTKQLQPERESQC--ISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            T I+  HG    Q + E E +C   SL+YANG+R+LDLICKDK QA SWF+GL+AVIS  
Sbjct  68   TKIVQGHGNIRSQRRNETEKECHSFSLIYANGERTLDLICKDKAQAASWFVGLKAVISRC  127

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERg  649
               +   + +S +GVQSC+SSPA  +RR++NLGL   D+++  +V S+  SP  S SER 
Sbjct  128  QQPKAFSSLRSCKGVQSCVSSPAGILRRKKNLGLLD-DTSQFIQVHSVCASPTLSLSERC  186

Query  650  csdglscssdsffselsmssmHNALDAINSGSPYVGPDDL-NKRTVDFGQGETQANM---  817
             SDG+S +SD + S  S+SS H   D     SPY+  D   N +T  FG+ E + ++   
Sbjct  187  FSDGMSYTSDFYSSASSLSSTHGRTDTSVPCSPYIDQDTRSNIKTTLFGK-EYKKDLSYR  245

Query  818  -LNLLETSVYESTQSANYALRDVFIWG  895
             +  L TS +      N  L+DV IWG
Sbjct  246  SIMQLPTSPHIGN---NNVLKDVMIWG  269



>ref|XP_009367145.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Pyrus 
x bretschneideri]
Length=1037

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 166/271 (61%), Gaps = 9/271 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E  L+  A D+AV+QA+V++K+GA+LLKY R GKPKFCPFRLS DEKFLIW S ++E+
Sbjct  1    MDEHSLSTVAFDKAVQQAVVSMKRGAYLLKYGRRGKPKFCPFRLSTDEKFLIWCSRKEER  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LSSVT II GQ T  LQ    PER+ Q  S+VYA  + SLDL+CKD++Q + W LGL
Sbjct  61   QLKLSSVTKIIPGQWTVSLQGKLEPERKGQSFSIVYALSECSLDLMCKDEIQCDLWILGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+IS   H R      S R VQSC++SPA   RRRQ LG+   D  + S+VRS+  SP 
Sbjct  121  RALISLHRHPRPHNNLGSFRQVQSCLNSPAGLFRRRQTLGIVD-DGNEFSQVRSVCRSPT  179

Query  629  RSFSERgcsd-glscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             + SER  SD     S   F SE  +S+M N +D     SPY+G D L +R +D    + 
Sbjct  180  LTPSERCISDGISFSSDSFFSSESVVSNMQNVMDISVPDSPYIGSDYLKRRRID---SDA  236

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWGE  898
                   +  +   S    +  L+DV IWGE
Sbjct  237  DCEPPRFVSYAYGTSRIEKDNILKDVMIWGE  267



>ref|XP_009367146.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Pyrus 
x bretschneideri]
Length=1060

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 166/271 (61%), Gaps = 9/271 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E  L+  A D+AV+QA+V++K+GA+LLKY R GKPKFCPFRLS DEKFLIW S ++E+
Sbjct  1    MDEHSLSTVAFDKAVQQAVVSMKRGAYLLKYGRRGKPKFCPFRLSTDEKFLIWCSRKEER  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LSSVT II GQ T  LQ    PER+ Q  S+VYA  + SLDL+CKD++Q + W LGL
Sbjct  61   QLKLSSVTKIIPGQWTVSLQGKLEPERKGQSFSIVYALSECSLDLMCKDEIQCDLWILGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+IS   H R      S R VQSC++SPA   RRRQ LG+   D  + S+VRS+  SP 
Sbjct  121  RALISLHRHPRPHNNLGSFRQVQSCLNSPAGLFRRRQTLGIVD-DGNEFSQVRSVCRSPT  179

Query  629  RSFSERgcsd-glscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             + SER  SD     S   F SE  +S+M N +D     SPY+G D L +R +D    + 
Sbjct  180  LTPSERCISDGISFSSDSFFSSESVVSNMQNVMDISVPDSPYIGSDYLKRRRID---SDA  236

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWGE  898
                   +  +   S    +  L+DV IWGE
Sbjct  237  DCEPPRFVSYAYGTSRIEKDNILKDVMIWGE  267



>emb|CAC84086.1| ZR1 protein [Medicago sativa]
Length=1035

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 164/259 (63%), Gaps = 7/259 (3%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DRAVEQAIV++KKGA+LLK    GKPK CPFRLS DE+ L+W SG++EKHLRLS VT I+
Sbjct  15   DRAVEQAIVSIKKGAYLLKCGNRGKPKLCPFRLSPDERNLVWCSGKQEKHLRLSGVTKIV  74

Query  314  HGQ----QTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             G+      +Q   E+E    SL+YANG+  LDLICKDK QA +WF+GL+AVIS     +
Sbjct  75   QGEGNIRSQRQNGTEKECHSSSLIYANGEHPLDLICKDKAQAATWFVGLKAVISRCQQPK  134

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdg  661
               + +S +GVQ C+SSP+  +RR++NLGL   D+++ ++V S+  SP  S SER  SDG
Sbjct  135  AFSSLRSCKGVQGCVSSPSGILRRKKNLGLLD-DASQFTQVHSVCASPTLSLSERCFSDG  193

Query  662  lscssdsffselsmssmHNALDAINSGSPYVGPD-DLNKRTVDFGQGETQANMLNLLETS  838
            LS  SD + S  S+SS+H   D     SPY+ PD   N +T  F + E +  + +     
Sbjct  194  LSYKSDFYSSASSLSSIHGITDNSVPSSPYINPDIHSNIKTSRF-EKEYKKELSSNRSIM  252

Query  839  VYESTQSANYALRDVFIWG  895
               S    N  L+DV IWG
Sbjct  253  PPASALVGNNVLKDVMIWG  271



>gb|KFK41025.1| hypothetical protein AALP_AA2G075500 [Arabis alpina]
Length=1014

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 133/209 (64%), Gaps = 35/209 (17%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK+ R G PKFCPFRLS DEK+LIWYSG++E
Sbjct  1    MGEQQISATVPRDRTDEQAILALKKGAQLLKFRRRGNPKFCPFRLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT---------------------------------KQLQPERESQ  358
            + L+LSSV  I+ GQ T                                 KQ Q +R+ Q
Sbjct  61   RQLKLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLPNFQKQAQSDRKEQ  120

Query  359  CISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPA  538
              SL+YANG+ +LDLICKDK QA+SWF GLRAVI+  H+ R   T ++ RG QSCI+SPA
Sbjct  121  SFSLIYANGEHTLDLICKDKAQADSWFKGLRAVITKHHNIRNSATLRASRGAQSCINSPA  180

Query  539  SYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
             ++RR+QNLGL   +S   +++RS+ GSP
Sbjct  181  GFIRRKQNLGLLE-ESPDFTQIRSVCGSP  208



>ref|XP_010415137.1| PREDICTED: uncharacterized protein LOC104701184 [Camelina sativa]
Length=1001

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +2

Query  101  MGEQFL-APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            MGEQ + A    DR  EQAI+ALKKGA LLK  R G PKFCPF+LS DEK+LIWYSG++E
Sbjct  1    MGEQKISATVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGQEE  60

Query  278  KHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            + LRLSSV  I+ GQ T    KQ Q +R+ Q  SL+YANG+ +LDLICKDK+QA+SWF G
Sbjct  61   RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKVQADSWFKG  120

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGL  571
            LRAVI+  H+ R     ++ RG QSCI+SPA ++RR+QNLGL
Sbjct  121  LRAVITKHHNVRTSTNLRTSRGAQSCINSPAGFIRRKQNLGL  162



>ref|XP_008381523.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444373 
[Malus domestica]
Length=1152

 Score =   197 bits (501),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 121/271 (45%), Positives = 165/271 (61%), Gaps = 9/271 (3%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E  L+  A +RA++QA+V++K+GA+LLKY R GKPKFCPFRLS DEKFLIW S ++E+
Sbjct  1    MDEHSLSTVAFBRAIQQAVVSMKRGAYLLKYGRRGKPKFCPFRLSTDEKFLIWCSRKZER  60

Query  281  HLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LSSV  II GQ T     +L+PER+ Q  S+VYA+ + SLDL+CKD++Q + W LGL
Sbjct  61   QLKLSSVXKIIPGQWTVSLRGKLEPERKGQSFSIVYAHSECSLDLMCKDEIQCDLWILGL  120

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPD  628
            RA+ S   H R L    S   VQSC++SPA   RRRQ L +   D  + S+V S+ GSP 
Sbjct  121  RALTSLHXHPRPLNNLGSFXQVQSCLNSPAGLFRRRQTLXIVD-DDNEFSQVXSVCGSPT  179

Query  629  RSFSERgcsd-glscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGET  805
             + SER  SD     S     SE  +S+M N +D     SPY G D L +R + +   + 
Sbjct  180  LTLSERCISDGISFSSDSFXSSESVLSNMQNVMDISVPDSPYXGSDYLKRRRI-YSDADC  238

Query  806  QANMLNLLETSVYESTQSANYALRDVFIWGE  898
            + +    +  +   S    +  L+DV IWGE
Sbjct  239  EPH--RFVSYAYGTSRIEKDNILKDVMIWGE  267



>ref|XP_004156895.1| PREDICTED: uncharacterized protein LOC101227493 [Cucumis sativus]
Length=1077

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 169/287 (59%), Gaps = 22/287 (8%)
 Frame = +2

Query  77   RSPDPLGK---MGEQFLAPGASDRAVEQ-------AIVALKKGAHLLKYSRMGKPKFCPF  226
            R P+ +GK     + F+    +  A E        AI+++KKGA+LLK  R GKPKFCPF
Sbjct  3    RYPESVGKRVPTTKSFVFGAIAKEATETGTWFKFIAILSMKKGAYLLKSRRRGKPKFCPF  62

Query  227  RLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQ----TKQLQPERESQCISLVYANGQRS  394
            RLS DEKFL+WYSG +EK LRLS V  II G+       QLQ  ++ +  SL+Y+N +RS
Sbjct  63   RLSMDEKFLVWYSGNQEKQLRLSLVVKIIPGKMLPSLVNQLQITKKLESFSLIYSNCERS  122

Query  395  LDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLY  574
            L L CKDK QA+ WFLGL ++IS +HH R +   K +RG+ SC +SPA ++RR+ NLGL 
Sbjct  123  LVLTCKDKAQADCWFLGLSSIISRNHHPRPVTILKDQRGIVSCANSPAGFIRRKYNLGLL  182

Query  575  PMDSTKLSKVRSLAGSPDRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYV  754
              DS    +VRSL GSP  S SER  SDGLS S DSF+     S      D    G+P  
Sbjct  183  E-DSADFPQVRSLCGSPTLSLSERCLSDGLSHSFDSFYPSDGQSEG----DISAWGTPVA  237

Query  755  GPDDLNKRTVDFGQGETQANMLNLLETSVYESTQ-SANYALRDVFIW  892
             PD LN+ ++D  +   + N L+     V+ S     N  L+DV IW
Sbjct  238  EPDVLNRGSLD--ETIYEKNALSRFVAPVHTSPYIEKNNILKDVMIW  282



>gb|KDO57314.1| hypothetical protein CISIN_1g001683mg [Citrus sinensis]
Length=1030

 Score =   191 bits (484),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 143/226 (63%), Gaps = 7/226 (3%)
 Frame = +2

Query  239  DEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK----QLQPERESQCISLVYANGQRSLDLI  406
            DEKFLIWYSG+KEK LRL+SVT II GQ+T     Q QP+R+ Q  S++YANG+RSLDLI
Sbjct  2    DEKFLIWYSGQKEKQLRLNSVTKIIMGQRTVNFQCQPQPDRKQQSFSIIYANGERSLDLI  61

Query  407  CKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
            CKDK+QAESWFLGLRA ISS    R     + KRGVQSC+SSPASY+RR+ NLGL   D+
Sbjct  62   CKDKVQAESWFLGLRAAISSCRRSRTFSCLREKRGVQSCVSSPASYIRRKHNLGLLE-DA  120

Query  587  TKLSKVRSLAGSPDRSFSERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPD  763
            T+LS+VRSL GSP  S SER         S   + SE S S + N  + I   SP++  +
Sbjct  121  TELSQVRSLCGSPSLSLSERCFSDGLSYSSDSFYSSESSSSQIQNLSNIITPSSPHMETE  180

Query  764  DLNKRTVDFGQGETQANMLNLLETSVYESTQ-SANYALRDVFIWGE  898
            +  K  +++       N  + L T  Y S        L+DV IWGE
Sbjct  181  NFMKWELNYADTRCPKNESHRLVTPTYGSPLIERKDILKDVMIWGE  226



>ref|XP_006855611.1| hypothetical protein AMTR_s00044p00073920 [Amborella trichopoda]
 gb|ERN17078.1| hypothetical protein AMTR_s00044p00073920 [Amborella trichopoda]
Length=1128

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 11/181 (6%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR +EQAI++LKKGAHLLKY   G+PKFCPFRLS DEK LIW+SG++EK L+LSS++ II
Sbjct  11   DRDIEQAIISLKKGAHLLKYGSRGRPKFCPFRLSTDEKVLIWFSGKEEKQLKLSSISKII  70

Query  314  HGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T    +Q QPE+E +  SL+Y NGQ SLDLICKDK QAE+WF+GL+A++S S H +
Sbjct  71   PGQRTERFQRQPQPEKEYRSCSLIYGNGQ-SLDLICKDKEQAEAWFVGLQALVSRSRHFK  129

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGL------YPMDSTKLSKVRSLAGSPDRSFSE  643
                  S  GV S  +SPAS++RR+QN G       +  D+ +  KV SL GSP  S  E
Sbjct  130  ISTKSCSDGGVHSYSNSPASHVRRKQNSGFQEDSAKHSQDTIRPVKVPSLYGSPSGSSKE  189

Query  644  R  646
            +
Sbjct  190  K  190



>ref|XP_010316560.1| PREDICTED: uncharacterized protein LOC101267670 isoform X2 [Solanum 
lycopersicum]
Length=994

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 121/183 (66%), Gaps = 4/183 (2%)
 Frame = +2

Query  350  ESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCIS  529
            E+QCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVIS +HH R + + KSKRG  SCIS
Sbjct  2    ENQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVISRTHHHRMVDSLKSKRGTHSCIS  61

Query  530  SPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdglscssdsffselsmss  709
            SPA YMRR+QNLGL    + +LS+VRSLAGSP +SFSER         S S  S  S SS
Sbjct  62   SPAGYMRRKQNLGL-SAKTIRLSQVRSLAGSPTQSFSER---CFTDGLSCSSESFFSESS  117

Query  710  mHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFI  889
            + N +D   S S Y  PDDL++        E Q +ML  L  S  ES       LRDVFI
Sbjct  118  LSNVMDNFTSCSSYFEPDDLSQTRASCAGTEIQTDMLAPLLPSSNESRPFGKNILRDVFI  177

Query  890  WGE  898
            WGE
Sbjct  178  WGE  180



>gb|KHN08772.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=1040

 Score =   171 bits (433),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 143/266 (54%), Gaps = 28/266 (11%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M E+ LA    DRA+EQAIV++KKGA+LLK  R GKPK CPFRLSQ              
Sbjct  3    MEEESLAAVPFDRAIEQAIVSIKKGAYLLKCRRRGKPKLCPFRLSQ--------------  48

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
                      I  Q  KQ + E+E    SL+YANG+RSLDLICKDK QA SWF+GL+AVI
Sbjct  49   ----------IRSQ--KQNESEKECHSFSLIYANGERSLDLICKDKAQAASWFVGLKAVI  96

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFS  640
            S   H R   + +S +GVQSC SSPA  +RR++NLGL   D+++ ++V S+  SP  S S
Sbjct  97   SRCQHPRAFSSLRSCKGVQSCASSPAGILRRKKNLGLLD-DTSQFTQVHSVCASPTLSLS  155

Query  641  ERg-csdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANM  817
            ER         S + + S   +S+ H   D     SPY+ PD+ +         E + N+
Sbjct  156  ERCFSDGLSCTSDNFYSSSSFLSNTHGVTDNSVPSSPYIDPDNHSNIESTRIDKEHKKNL  215

Query  818  LNLLETSVYESTQSANYALRDVFIWG  895
                           N  L+DV IWG
Sbjct  216  SYRYLMHSTSPHVGKNNVLKDVMIWG  241



>ref|XP_009591086.1| PREDICTED: uncharacterized protein LOC104088155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009591087.1| PREDICTED: uncharacterized protein LOC104088155 isoform X2 [Nicotiana 
tomentosiformis]
Length=1001

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = +2

Query  350  ESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCIS  529
            ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVIS +HH R +   KS++G  SCIS
Sbjct  2    ESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVISRTHHHRVVDPLKSRKGTHSCIS  61

Query  530  SPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdglscssdsffselsmss  709
            SPA YMRR+QNLGL    + + S+VRSLAGSP  SFSER  +DGLSCSSDSFFSE S+SS
Sbjct  62   SPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFSERCFTDGLSCSSDSFFSESSLSS  120

Query  710  mHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFI  889
            +HN ++ +   S Y   D+L ++       E Q ++L     S +ES       LRDVFI
Sbjct  121  VHNVIENVTCSS-YFESDNLTQKRASCAGTENQTDILAPFIPSTHESRPFGRNVLRDVFI  179

Query  890  WGE  898
            WGE
Sbjct  180  WGE  182



>gb|KCW69452.1| hypothetical protein EUGRSUZ_F02909 [Eucalyptus grandis]
Length=885

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 107/143 (75%), Gaps = 5/143 (3%)
 Frame = +2

Query  230  LSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSL  397
            L QDEKF+IWYSG++EK LRLSSVT +I GQ+T    KQLQP+RE+Q  SL+YA+G+RS+
Sbjct  4    LFQDEKFMIWYSGQEEKQLRLSSVTEVIRGQRTVNFQKQLQPDREAQSFSLIYADGKRSI  63

Query  398  DLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYP  577
            DLICKD  QA+SW+LGL+ +IS   H R   + +S  GVQ+C++SPA +MRR+ NLGL  
Sbjct  64   DLICKDHAQADSWYLGLKTIISKCQHSRPFASFRSPSGVQTCVNSPAGFMRRKYNLGLLE  123

Query  578  MDSTKLSKVRSLAGSPDRSFSER  646
             D+    +VRSL GSP  S S+R
Sbjct  124  -DTAGFCQVRSLCGSPALSLSKR  145



>ref|XP_009790765.1| PREDICTED: uncharacterized protein LOC104238167 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790766.1| PREDICTED: uncharacterized protein LOC104238167 isoform X2 [Nicotiana 
sylvestris]
Length=1001

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = +2

Query  350  ESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCIS  529
            ESQCISL+Y NG+R+LDLICKDKMQAE+WF+GLRAVIS +HH R     KS++G  SCIS
Sbjct  2    ESQCISLIYGNGERTLDLICKDKMQAETWFVGLRAVISRTHHHRVADPLKSRKGAHSCIS  61

Query  530  SPASYMRRRQNLGLYPMDSTKLSKVRSLAGSPDRSFSERgcsdglscssdsffselsmss  709
            SPA YMRR+QNLGL    + + S+VRSLAGSP  SFSER  +DGLSCSSDSFFSE S+SS
Sbjct  62   SPAGYMRRKQNLGL-SAKTIRSSQVRSLAGSPTHSFSERCFTDGLSCSSDSFFSESSLSS  120

Query  710  mHNALDAINSGSPYVGPDDLNKRTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFI  889
            +HN ++ +   S Y   D+L ++       E Q ++L     S +ES       LRDVFI
Sbjct  121  VHNVIENVTRSS-YFESDNLTQKRASCAGTENQTDILAPFMLSTHESRPFGRNVLRDVFI  179

Query  890  WGE  898
            WGE
Sbjct  180  WGE  182



>ref|XP_010269341.1| PREDICTED: uncharacterized protein LOC104606031 isoform X2 [Nelumbo 
nucifera]
Length=1101

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 156/280 (56%), Gaps = 41/280 (15%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+
Sbjct  15   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS SH
Sbjct  75   RIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRSH  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL-------------GLYPMDSTKLSKVRSL  613
            H+++    +S  GV S  +SP +Y RR   L             G+ P+      ++ S 
Sbjct  133  HRKWRTESRSD-GVSSGANSPRTYTRRSSPLSSPFGSGDSMQKDGIDPL------RLHSP  185

Query  614  AGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKR  778
             GSP     D++FS+      +   +          S   ++ +++SG    G D LN  
Sbjct  186  YGSPPKNGMDKTFSD------VILYAVPPKGFFPSDSASGSIHSLSSG----GSDGLNGH  235

Query  779  TVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                     + ++ + + +S   S      AL DVFIWGE
Sbjct  236  MKGMAMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  275



>ref|XP_009350077.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Pyrus x bretschneideri]
Length=1108

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +MG      G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMGSDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_009399981.1| PREDICTED: uncharacterized protein LOC103984245 [Musa acuminata 
subsp. malaccensis]
Length=1100

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 154/275 (56%), Gaps = 31/275 (11%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  14   GHAERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESTLIWFSGKEEKHLKLSHVS  73

Query  305  NIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T       QPE+E Q  SL+Y++  RSLDLICKDK +AE WF GL+ +I  SH
Sbjct  74   RIMPGQRTAIFQRYPQPEKECQSFSLIYSD--RSLDLICKDKDEAEVWFAGLKTLIPRSH  131

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM--------DSTKLSKVRSLAGSP-  625
            H+ +    +S  G  S  +SP +Y RR   L   P         D +   +VRS  GSP 
Sbjct  132  HRSWRTESRSD-GASSGTNSPRTYTRRSSPLN-SPFGSSDSMQKDGSDTFRVRSPYGSPT  189

Query  626  ----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFG  793
                D+SFSE      +   +    S     S   +L +++SG      D++N       
Sbjct  190  KNGLDKSFSE------VVSYAVPPKSFFPSDSATGSLHSLSSGC----SDNINGHARAIA  239

Query  794  QGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                + ++ + + +S   S      AL DVFIWGE
Sbjct  240  TDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  274



>ref|XP_008385699.1| PREDICTED: uncharacterized protein LOC103448227 [Malus domestica]
Length=1108

 Score =   168 bits (426),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 111/160 (69%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +MG      G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMGSDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+L+ V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF G
Sbjct  66   KHLKLNHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>gb|AET00240.2| regulator of chromosome condensation (RCC1) family protein [Medicago 
truncatula]
Length=1117

 Score =   168 bits (426),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            L KM       GA +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  19   LLKMNSDLSRTGAVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGK  78

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF
Sbjct  79   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWF  136

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  137  SGLKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  177



>ref|XP_010227233.1| PREDICTED: uncharacterized protein LOC100842512 [Brachypodium 
distachyon]
Length=1052

 Score =   168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 117/167 (70%), Gaps = 6/167 (4%)
 Frame = +2

Query  137  RAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIH  316
            R VEQAIVALKKGAHLLK  + GKPKFCPFRLS DEK L+WYS ++EKHL L+SV+ +I 
Sbjct  12   RGVEQAIVALKKGAHLLKCGKRGKPKFCPFRLSSDEKTLVWYSKDREKHLSLNSVSTVIL  71

Query  317  GQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRF  484
            GQ+T    +Q  PE+E Q +SL+Y NG+ SLDLIC+D+ QAE W LGL A+IS+      
Sbjct  72   GQKTINFLRQRWPEKEYQSLSLIYRNGECSLDLICRDRDQAECWHLGLTALISAHSPFSS  131

Query  485  LGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            +G+ KS R + SC ++P SY++R+  L     D+ +  +V    GSP
Sbjct  132  VGS-KSGRQITSCTNTPRSYIQRKSKLSAV-HDTPRHKQVYPSYGSP  176



>ref|XP_002313993.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE87948.2| zinc finger family protein [Populus trichocarpa]
Length=1104

 Score =   168 bits (425),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 14/171 (8%)
 Frame = +2

Query  65   LLGNRSPDPLGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDE  244
            L G+R    LG+ G         +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE
Sbjct  2    LRGDRMASDLGRTG-------PVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDE  54

Query  245  KFLIWYSGEKEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICK  412
              LIW+SG++EKHLRLS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICK
Sbjct  55   SVLIWFSGKEEKHLRLSHVSKIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICK  112

Query  413  DKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            DK +AE WF GL+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  113  DKDEAEVWFSGLKALISRSHHQKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_010276611.1| PREDICTED: uncharacterized protein LOC104611308 [Nelumbo nucifera]
Length=1101

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 156/280 (56%), Gaps = 41/280 (15%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+
Sbjct  16   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS SH
Sbjct  76   RIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRSH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL-------------GLYPMDSTKLSKVRSL  613
            H+++    +S  GV S  +SP +Y RR   L             G+ P+      ++ S 
Sbjct  134  HRKWRTESRSD-GVSSEANSPRTYTRRSSPLSSPFGSGDSLQKDGMDPL------RLHSP  186

Query  614  AGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKR  778
             GSP     D++FS+      +   +          S   ++ +++SG    G D LN  
Sbjct  187  YGSPPKNGMDKTFSD------VILYAVPPKGFFHPDSASGSVHSLSSG----GSDGLNGH  236

Query  779  TVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                     + ++ + + +S   S      AL DVFIWGE
Sbjct  237  MKSMTMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  276



>gb|KDP36001.1| hypothetical protein JCGZ_08396 [Jatropha curcas]
Length=1097

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+
Sbjct  9    GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVS  68

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  69   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  126

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+ S  +SP +Y RR   L
Sbjct  127  HRKWRTESRSD-GIPSGANSPRTYTRRSSPL  156



>ref|XP_011090167.1| PREDICTED: uncharacterized protein LOC105170925 [Sesamum indicum]
Length=1108

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGAHLLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS 
Sbjct  16   AGGTVERDIEQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESLLIWFSGKEEKHLKLSH  75

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  76   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKEEAEVWFSGLKALISR  133

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  134  GHQRKWRTESRSD-GISSGATSPRTYTRRSSPL  165



>ref|XP_010539249.1| PREDICTED: uncharacterized protein LOC104813389 [Tarenaya hassleriana]
Length=1069

 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 106/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW SG++EKHL+LS ++
Sbjct  9    GTVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKHLKLSHIS  68

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A++SSSH
Sbjct  69   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGLKALVSSSH  126

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+R     +S  G  S  SSP +Y RR   L
Sbjct  127  HRRRRAQSRSD-GAVSEASSPRTYTRRSSPL  156



>ref|XP_010926966.1| PREDICTED: uncharacterized protein LOC105049105 [Elaeis guineensis]
Length=1098

 Score =   166 bits (419),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  13   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  72

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SH
Sbjct  73   RIMPGQRTAIFQRYPRPEKECQSFSLIYND--RSLDLICKDKDEAEVWFAGLKTLISRSH  130

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  GV S  +SP +Y RR   L
Sbjct  131  HRKWRTESRSD-GVSSGTNSPRTYTRRSSPL  160



>ref|XP_006595771.1| PREDICTED: uncharacterized protein LOC100802464 isoform X2 [Glycine 
max]
Length=1107

 Score =   166 bits (419),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
             G+M       G  +R +EQAI ALKKGA LLKY R G PKFCPFRLS DE  LIW+SG+
Sbjct  4    FGRMASDLSRTGPVERDIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGK  63

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF
Sbjct  64   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWF  121

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  122  SGLKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_008449668.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103491479 
[Cucumis melo]
Length=1103

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQ+I+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  15   GPVERDIEQSIIALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SH
Sbjct  75   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFNGLKTLISRSH  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+QS  +SP +Y RR   L
Sbjct  133  HRKWRTESRSD-GMQSEANSPRTYTRRSSPL  162



>ref|XP_007141489.1| hypothetical protein PHAVU_008G200300g [Phaseolus vulgaris]
 gb|ESW13483.1| hypothetical protein PHAVU_008G200300g [Phaseolus vulgaris]
Length=1106

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 109/159 (69%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EK
Sbjct  6    MASDLSRTGPVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEK  65

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  66   HLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  123

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SHH+++    +S+ G+ S  +SP +Y RR   L
Sbjct  124  KALISRSHHRKWRTESRSE-GIPSEANSPRTYTRRSSPL  161



>ref|XP_010536113.1| PREDICTED: uncharacterized protein LOC104811189 [Tarenaya hassleriana]
Length=1095

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GRMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS  H +R+    +S  G  S  +SP +Y RR   L
Sbjct  123  GLKALISRCHQRRWRTESRSD-GTPSEANSPRTYTRRSSPL  162



>ref|XP_006854768.1| hypothetical protein AMTR_s00063p00100200 [Amborella trichopoda]
 gb|ERN16235.1| hypothetical protein AMTR_s00063p00100200 [Amborella trichopoda]
Length=1097

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGAHLLKY R GKPKFCPFRL+ DE  LIWYSG++EK L+LS V+
Sbjct  11   GPVERDIEQAITALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWYSGKEEKSLKLSHVS  70

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS  H
Sbjct  71   KIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRGH  128

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRR  553
            H+++    +S  G  S  +SP +Y RR
Sbjct  129  HRKWRTESRSD-GASSDTNSPRTYTRR  154



>ref|XP_010269339.1| PREDICTED: uncharacterized protein LOC104606031 isoform X1 [Nelumbo 
nucifera]
Length=1102

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 156/281 (56%), Gaps = 42/281 (15%)
 Frame = +2

Query  125  GASDRAVEQ-AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            G  +R +EQ AI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V
Sbjct  15   GPVERDIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHV  74

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS S
Sbjct  75   SRIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRS  132

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL-------------GLYPMDSTKLSKVRS  610
            HH+++    +S  GV S  +SP +Y RR   L             G+ P+      ++ S
Sbjct  133  HHRKWRTESRSD-GVSSGANSPRTYTRRSSPLSSPFGSGDSMQKDGIDPL------RLHS  185

Query  611  LAGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNK  775
              GSP     D++FS+      +   +          S   ++ +++SG    G D LN 
Sbjct  186  PYGSPPKNGMDKTFSD------VILYAVPPKGFFPSDSASGSIHSLSSG----GSDGLNG  235

Query  776  RTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                      + ++ + + +S   S      AL DVFIWGE
Sbjct  236  HMKGMAMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  276



>ref|XP_004491255.1| PREDICTED: uncharacterized protein LOC101508617 [Cicer arietinum]
Length=1101

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G+ +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  14   GSVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  73

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  74   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  131

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+ S  +SP +Y RR   L
Sbjct  132  HRKWRTESRSD-GIPSEANSPRTYTRRSSPL  161



>ref|XP_010269344.1| PREDICTED: uncharacterized protein LOC104606031 isoform X5 [Nelumbo 
nucifera]
Length=959

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 156/281 (56%), Gaps = 42/281 (15%)
 Frame = +2

Query  125  GASDRAVEQ-AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            G  +R +EQ AI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V
Sbjct  15   GPVERDIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHV  74

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS S
Sbjct  75   SRIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRS  132

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL-------------GLYPMDSTKLSKVRS  610
            HH+++    +S  GV S  +SP +Y RR   L             G+ P+      ++ S
Sbjct  133  HHRKWRTESRSD-GVSSGANSPRTYTRRSSPLSSPFGSGDSMQKDGIDPL------RLHS  185

Query  611  LAGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNK  775
              GSP     D++FS+      +   +          S   ++ +++SG    G D LN 
Sbjct  186  PYGSPPKNGMDKTFSD------VILYAVPPKGFFPSDSASGSIHSLSSG----GSDGLNG  235

Query  776  RTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                      + ++ + + +S   S      AL DVFIWGE
Sbjct  236  HMKGMAMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  276



>ref|XP_010269343.1| PREDICTED: uncharacterized protein LOC104606031 isoform X4 [Nelumbo 
nucifera]
Length=964

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 156/281 (56%), Gaps = 42/281 (15%)
 Frame = +2

Query  125  GASDRAVEQ-AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            G  +R +EQ AI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V
Sbjct  15   GPVERDIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHV  74

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS S
Sbjct  75   SRIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRS  132

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL-------------GLYPMDSTKLSKVRS  610
            HH+++    +S  GV S  +SP +Y RR   L             G+ P+      ++ S
Sbjct  133  HHRKWRTESRSD-GVSSGANSPRTYTRRSSPLSSPFGSGDSMQKDGIDPL------RLHS  185

Query  611  LAGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNK  775
              GSP     D++FS+      +   +          S   ++ +++SG    G D LN 
Sbjct  186  PYGSPPKNGMDKTFSD------VILYAVPPKGFFPSDSASGSIHSLSSG----GSDGLNG  235

Query  776  RTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
                      + ++ + + +S   S      AL DVFIWGE
Sbjct  236  HMKGMAMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGE  276



>ref|XP_007146313.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 ref|XP_007146314.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 gb|ESW18307.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 gb|ESW18308.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
Length=1121

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 9/152 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS+V+
Sbjct  18   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSNVS  77

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I  GQ+T   Q    PE+E Q  SL Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  78   RIKSGQRTPIFQRYPRPEKEYQSFSLFYND--RSLDLICKDKDEAEVWFSGLKALISRSH  135

Query  473  HKRFLGTPKSKR-GVQSCISSPASYMRRRQNL  565
            H+++   P+SK  G+ S  SSP +Y RR   L
Sbjct  136  HRKW--KPESKSDGIPSEASSPRAYTRRSSPL  165



>ref|XP_006575627.1| PREDICTED: uncharacterized protein LOC100806439 isoform X2 [Glycine 
max]
Length=1109

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 112/169 (66%), Gaps = 12/169 (7%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
             G+M       G  +R +EQAI ALKKGA LLKY R G+PK CPFRLS DE  LIW+SG+
Sbjct  4    FGRMASDLSRTGPVERDIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGK  63

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF
Sbjct  64   EEKHLKLSQVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWF  121

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
             GL+A+IS SHH+++    +S  G+ S  +SP +Y RR       PM+S
Sbjct  122  SGLKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSS-----PMNS  164



>gb|KHG00947.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
 gb|KHG25966.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
Length=1105

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHQRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_006575629.1| PREDICTED: uncharacterized protein LOC100806439 isoform X4 [Glycine 
max]
Length=908

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 112/169 (66%), Gaps = 12/169 (7%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
             G+M       G  +R +EQAI ALKKGA LLKY R G+PK CPFRLS DE  LIW+SG+
Sbjct  4    FGRMASDLSRTGPVERDIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGK  63

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF
Sbjct  64   EEKHLKLSQVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWF  121

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
             GL+A+IS SHH+++    +S  G+ S  +SP +Y RR       PM+S
Sbjct  122  SGLKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSS-----PMNS  164



>gb|EPS63615.1| hypothetical protein M569_11169, partial [Genlisea aurea]
Length=1084

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 21/192 (11%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G+ +R +EQAI+ALKKGAHLLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS 
Sbjct  7    AGGSVERDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSH  66

Query  299  VTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T    +  +PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+I+ 
Sbjct  67   VSRIISGQRTPIFHRYPRPEKEYQSFSLIYND--RSLDLICKDKEEAEVWFSGLKALITR  124

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL--------GLYPMDSTKLSKVRSLAGS  622
            SH +++    +S  G+ S  +SP +Y R+   L        G     S KL +  S  GS
Sbjct  125  SHQRKWRTESRSD-GISSGANSPRTYTRQSSPLNSPFVNGEGFQKDGSGKL-QFHSPYGS  182

Query  623  P-----DRSFSE  643
            P     D++FS+
Sbjct  183  PPKNGLDKAFSD  194



>ref|XP_004953476.1| PREDICTED: uncharacterized protein LOC101768432 isoform X2 [Setaria 
italica]
Length=928

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 149/273 (55%), Gaps = 34/273 (12%)
 Frame = +2

Query  128  ASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTN  307
             + R VEQAIVALKKGAHLLK  + GKPKFC  RLS DE+ LIWYS E+EK L L+SV++
Sbjct  12   TTTRGVEQAIVALKKGAHLLKCGKRGKPKFCIVRLSYDERALIWYSKEREKRLSLNSVSS  71

Query  308  IIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHH  475
            ++ GQ+T +L     PE+E   +S++Y NG+ SLDL+CKD+ QAE W+LGL  +IS+   
Sbjct  72   VVLGQKTTKLLRLHWPEKEPHSLSVIYKNGESSLDLVCKDRHQAECWYLGLTTLISAPCT  131

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP-------DRS  634
               L    +   + SC +SP SY+++R  L          +KV SL GSP         S
Sbjct  132  PLLLVNSTNGCQINSCTNSPPSYIQQRSRL-FAVHHGRNFTKVHSLYGSPRLIQNKYSHS  190

Query  635  FSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNK-----RTVDFGQG  799
            +SE                    S    A   ++S    + P+  N+     R +   + 
Sbjct  191  YSE-----------------PFFSPRQRAWSELDSYLEKISPELANRVKNDLRDIKSSEK  233

Query  800  ETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
             T   ++++ +    E + +A+ +L+D+F+WG+
Sbjct  234  ITDQRIMHMPKLKQSEGSNAASDSLKDIFVWGD  266



>ref|XP_008363119.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Malus domestica]
Length=1109

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +MG      G  +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMGSDLSRTGPVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            K L+LS V+ II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF G
Sbjct  66   KLLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_006400502.1| hypothetical protein EUTSA_v10012507mg [Eutrema salsugineum]
 gb|ESQ41955.1| hypothetical protein EUTSA_v10012507mg [Eutrema salsugineum]
Length=1104

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G   R +EQAI +LKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GRMASDLSRAGPVTRDIEQAITSLKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS  H +R+    +S  G  S  +SP +Y RR   L
Sbjct  123  GLKALISRCHQRRWRAESRSD-GTPSEANSPRTYTRRSSPL  162



>ref|XP_011080399.1| PREDICTED: uncharacterized protein LOC105163660 [Sesamum indicum]
Length=1101

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 108/153 (71%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+L+ 
Sbjct  9    AGGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLTH  68

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS 
Sbjct  69   VSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKEEAEVWFSGLKALISR  126

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  127  SHQRKWRTESRSD-GISSGANSPRTYTRRSSPL  158



>ref|XP_007015313.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 3 [Theobroma cacao]
 gb|EOY32932.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 3 [Theobroma cacao]
Length=883

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHQRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_004513412.1| PREDICTED: uncharacterized protein LOC101496615 [Cicer arietinum]
Length=1110

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 106/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  21   GTVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  80

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    P +E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  81   RIISGQRTPIFQRYPRPAKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  138

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G  S  SSP +Y RR   L
Sbjct  139  HRKWRTESRSD-GFPSEASSPRTYTRRSSPL  168



>ref|XP_007015312.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 2 [Theobroma cacao]
 gb|EOY32931.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 2 [Theobroma cacao]
Length=929

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHQRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_007015311.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
 gb|EOY32930.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
Length=1105

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHQRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_006470568.1| PREDICTED: uncharacterized protein LOC102612328 isoform X2 [Citrus 
sinensis]
Length=1106

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G+ +R  EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  16   GSIERDTEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  76   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+ S  +SP +Y RR   L
Sbjct  134  HRKWRTESRSD-GIPSEANSPRTYTRRSSPL  163



>ref|XP_006446270.1| hypothetical protein CICLE_v10014100mg [Citrus clementina]
 gb|ESR59510.1| hypothetical protein CICLE_v10014100mg [Citrus clementina]
Length=1106

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G+ +R  EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  16   GSIERDTEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  76   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+ S  +SP +Y RR   L
Sbjct  134  HRKWRTESRSD-GIPSEANSPRTYTRRSSPL  163



>ref|XP_010269342.1| PREDICTED: uncharacterized protein LOC104606031 isoform X3 [Nelumbo 
nucifera]
Length=1068

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 8/152 (5%)
 Frame = +2

Query  125  GASDRAVEQ-AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            G  +R +EQ AI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V
Sbjct  15   GPVERDIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHV  74

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS S
Sbjct  75   SRIIPGQRTAIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFIGLKALISRS  132

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            HH+++    +S  GV S  +SP +Y RR   L
Sbjct  133  HHRKWRTESRSD-GVSSGANSPRTYTRRSSPL  163



>ref|XP_004953475.1| PREDICTED: uncharacterized protein LOC101768432 isoform X1 [Setaria 
italica]
Length=1053

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 149/273 (55%), Gaps = 34/273 (12%)
 Frame = +2

Query  128  ASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTN  307
             + R VEQAIVALKKGAHLLK  + GKPKFC  RLS DE+ LIWYS E+EK L L+SV++
Sbjct  12   TTTRGVEQAIVALKKGAHLLKCGKRGKPKFCIVRLSYDERALIWYSKEREKRLSLNSVSS  71

Query  308  IIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHH  475
            ++ GQ+T +L     PE+E   +S++Y NG+ SLDL+CKD+ QAE W+LGL  +IS+   
Sbjct  72   VVLGQKTTKLLRLHWPEKEPHSLSVIYKNGESSLDLVCKDRHQAECWYLGLTTLISAPCT  131

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP-------DRS  634
               L    +   + SC +SP SY+++R  L          +KV SL GSP         S
Sbjct  132  PLLLVNSTNGCQINSCTNSPPSYIQQRSRL-FAVHHGRNFTKVHSLYGSPRLIQNKYSHS  190

Query  635  FSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNK-----RTVDFGQG  799
            +SE                    S    A   ++S    + P+  N+     R +   + 
Sbjct  191  YSE-----------------PFFSPRQRAWSELDSYLEKISPELANRVKNDLRDIKSSEK  233

Query  800  ETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
             T   ++++ +    E + +A+ +L+D+F+WG+
Sbjct  234  ITDQRIMHMPKLKQSEGSNAASDSLKDIFVWGD  266



>ref|XP_009767054.1| PREDICTED: uncharacterized protein LOC104218296 [Nicotiana sylvestris]
Length=1101

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS 
Sbjct  8    ASGQVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSH  67

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  68   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  125

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  126  GHQRKWRTESRSD-GISSGATSPRTYTRRSSPL  157



>ref|XP_004291740.1| PREDICTED: uncharacterized protein LOC101306203 [Fragaria vesca 
subsp. vesca]
Length=1109

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQA+ ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAVTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            K L+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KRLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  162



>ref|XP_002527043.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF35343.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1100

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK
Sbjct  1    MASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFSGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+I+ SH +++    +S  G+ S  +SP +Y RR   L
Sbjct  119  KALITRSHQRKWRTESRSD-GIPSEANSPRTYTRRSSPL  156



>ref|XP_003551961.1| PREDICTED: uncharacterized protein LOC100791947 isoform X1 [Glycine 
max]
Length=1106

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 110/152 (72%), Gaps = 9/152 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+L++V+
Sbjct  16   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKRLKLTNVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  76   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSH  133

Query  473  HKRFLGTPKSKR-GVQSCISSPASYMRRRQNL  565
            H+++   P+S+  G+ S  +SP +Y RR   L
Sbjct  134  HRKW--RPESRSDGIPSEANSPRTYTRRSSPL  163



>ref|XP_010673731.1| PREDICTED: uncharacterized protein LOC104890071 [Beta vulgaris 
subsp. vulgaris]
Length=1100

 Score =   163 bits (412),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 110/162 (68%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            + +M       G+ +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  1    MDRMATDLTRNGSVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGK  60

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS ++ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF
Sbjct  61   EEKHLKLSHISRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWF  118

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS SH K++    +S   + S  +SP +Y RR   L
Sbjct  119  SGLKALISRSHQKKWRTESRSD-SIPSEANSPRTYTRRSSPL  159



>ref|XP_002871523.1| ran GTPase binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47782.1| ran GTPase binding protein [Arabidopsis lyrata subsp. lyrata]
Length=1075

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALISHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|NP_568268.3| Regulator of chromosome condensation-like protein with FYVE zinc 
finger domain-containing protein [Arabidopsis thaliana]
 gb|AED91798.1| Regulator of chromosome condensation-like protein with FYVE zinc 
finger domain-containing protein [Arabidopsis thaliana]
Length=1075

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALISHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|XP_008799103.1| PREDICTED: uncharacterized protein LOC103713841 [Phoenix dactylifera]
Length=1100

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 7/148 (5%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+ EKHL+LS V+ I+
Sbjct  14   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKDEKHLKLSHVSRIM  73

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SHH++
Sbjct  74   PGQRTAIFQRYPRPEKECQSFSLIYDD--RSLDLICKDKDEAEVWFAGLKTLISRSHHRK  131

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +    +S  G+ S  +SP +Y RR   L
Sbjct  132  WRTESRSD-GMSSGTNSPRTYTRRSSPL  158



>ref|XP_006362314.1| PREDICTED: uncharacterized protein LOC102578724 [Solanum tuberosum]
Length=1107

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS 
Sbjct  14   AGGQVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSH  73

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  74   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  131

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  132  GHQRKWRTESRSD-GISSGATSPRTYTRRSSPL  163



>ref|XP_004250909.1| PREDICTED: uncharacterized protein LOC101265608 [Solanum lycopersicum]
Length=1101

 Score =   162 bits (411),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS 
Sbjct  8    AGGQVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSH  67

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  68   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  125

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  126  GHQRKWRTESRSD-GISSGATSPRTYTRRSSPL  157



>ref|XP_003545401.1| PREDICTED: uncharacterized protein LOC100802464 isoform X1 [Glycine 
max]
Length=1106

 Score =   162 bits (410),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 107/159 (67%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA LLKY R G PKFCPFRLS DE  LIW+SG++EK
Sbjct  6    MASDLSRTGPVERDIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGKEEK  65

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  66   HLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  123

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  124  KALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  161



>gb|KHN12021.1| Putative E3 ubiquitin-protein ligase HERC1 [Glycine soja]
Length=1101

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 107/159 (67%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA LLKY R G PKFCPFRLS DE  LIW+SG++EK
Sbjct  1    MASDLSRTGPVERDIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  119  KALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  156



>ref|XP_009121854.1| PREDICTED: uncharacterized protein LOC103846644 [Brassica rapa]
Length=1070

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GSMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+I S +H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALI-SRYHQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>emb|CDX97187.1| BnaC09g44380D [Brassica napus]
Length=1058

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GSMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+I S +H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALI-SRYHQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|XP_008227676.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Prunus mume]
Length=1108

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMPSDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQP----ERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q     E+E Q  SL+Y +  RSLDLICKDK +A+ WF G
Sbjct  66   KHLKLSHVSRIITGQRTPIFQRYPRLEKEYQSFSLIYND--RSLDLICKDKDEADVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SHH+++    +S  G+ S ++SP +Y RR   L
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEVNSPRTYTRRSSPL  162



>ref|XP_010491996.1| PREDICTED: uncharacterized protein LOC104769476 [Camelina sativa]
Length=1075

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A++S   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALVSHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|XP_003519514.1| PREDICTED: uncharacterized protein LOC100806439 isoform X1 [Glycine 
max]
Length=1109

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 111/167 (66%), Gaps = 12/167 (7%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA LLKY R G+PK CPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSQVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
            L+A+IS SHH+++    +S  G+ S  +SP +Y RR       PM+S
Sbjct  124  LKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSS-----PMNS  164



>ref|XP_009630183.1| PREDICTED: uncharacterized protein LOC104120162 [Nicotiana tomentosiformis]
Length=1101

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS 
Sbjct  8    ASGQVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSH  67

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  68   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  125

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  126  GHQRKWRIESRSD-GISSGATSPRTYTRRSSPL  157



>ref|XP_010424068.1| PREDICTED: uncharacterized protein LOC104709101 [Camelina sativa]
Length=1027

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  6    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  65

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  66   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  123

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A++S   H+R   T     G  S  +SP +Y RR   L
Sbjct  124  GLKALVSHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  163



>ref|XP_006286948.1| hypothetical protein CARUB_v10000094mg [Capsella rubella]
 gb|EOA19846.1| hypothetical protein CARUB_v10000094mg [Capsella rubella]
Length=1075

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A++S   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALVSHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>gb|KHG19721.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
 gb|KHG29805.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
Length=1106

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIW SG++E
Sbjct  6    RMASDLSRTGPVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS SH +++    +S  G+ S ++SP +Y RR   L
Sbjct  124  LKALISRSHQRKWRTESRSD-GIPSEVNSPRTYTRRSSPL  162



>ref|XP_010519782.1| PREDICTED: bifunctional serine/threonine-protein kinase/NEDD4-like 
E3 ubiquitin-protein ligase [Tarenaya hassleriana]
 ref|XP_010519784.1| PREDICTED: bifunctional serine/threonine-protein kinase/NEDD4-like 
E3 ubiquitin-protein ligase [Tarenaya hassleriana]
Length=1092

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  9    GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVS  68

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  69   RIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFSGLKALISRCH  126

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +R+    +S  G  S  +SP +Y RR   L
Sbjct  127  QRRWRTESRSD-GTPSEANSPRTYTRRSSPL  156



>ref|XP_010453304.1| PREDICTED: uncharacterized protein LOC104735251 [Camelina sativa]
 ref|XP_010453305.1| PREDICTED: uncharacterized protein LOC104735251 [Camelina sativa]
Length=1075

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y++  RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYSD--RSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A++S   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALVSHC-HQRNRRTESRSDGTPSEANSPRTYTRRTSPL  162



>ref|XP_006286943.1| hypothetical protein CARUB_v10000090mg [Capsella rubella]
 gb|EOA19841.1| hypothetical protein CARUB_v10000090mg [Capsella rubella]
Length=1102

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 104/152 (68%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PG   R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V
Sbjct  16   PGPVTRDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHV  75

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  
Sbjct  76   SRIISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRC  133

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H + +    +S  G  S  +SP +Y RR   L
Sbjct  134  HQRNWRTESRSD-GTPSEANSPRTYTRRSSPL  164



>ref|XP_008678946.1| PREDICTED: uncharacterized protein LOC103653921 isoform X1 [Zea 
mays]
Length=1067

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 118/180 (66%), Gaps = 7/180 (4%)
 Frame = +2

Query  104  GEQFLAPGASDRAVE--QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            G ++ +  ++ R VE  Q+IVALKKGAHLLK  + GKPKFC  RLS DE+ LIWYS E+ 
Sbjct  4    GFEWSSSASTTRGVELQQSIVALKKGAHLLKCGKRGKPKFCTVRLSYDERALIWYSKERG  63

Query  278  KHLRLSSVTNIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            K L L+SV++++ GQ+T +L     PE+ES  +S++Y NG+ SLDL+CKD+ QAE W+LG
Sbjct  64   KRLSLNSVSSVVLGQKTTKLLRLHWPEKESHSLSIIYKNGESSLDLVCKDRDQAECWYLG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
            L AVIS+      L    + R + SC +SP SY+++R  L     D     KV SL GSP
Sbjct  124  LTAVISAPCTPLLLIDSTNSRRINSCTNSPPSYIQQRSRL-FAVHDGRNFPKVNSLYGSP  182



>ref|XP_004140201.1| PREDICTED: uncharacterized protein LOC101207486 [Cucumis sativus]
 ref|XP_004156044.1| PREDICTED: uncharacterized LOC101207486 [Cucumis sativus]
 gb|KGN48105.1| hypothetical protein Csa_6G432780 [Cucumis sativus]
Length=1104

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQ+I+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+LS V+
Sbjct  15   GPVERDIEQSIIALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKLLKLSHVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SH
Sbjct  75   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFNGLKTLISRSH  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+QS  +SP +Y RR   L
Sbjct  133  HRKWRTESRSD-GMQSEANSPRTYTRRSSPL  162



>ref|XP_006575628.1| PREDICTED: uncharacterized protein LOC100806439 isoform X3 [Glycine 
max]
Length=1108

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 110/166 (66%), Gaps = 12/166 (7%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA LLKY R G+PK CPFRLS DE  LIW+SG++EK
Sbjct  6    MASDLSRTGPVERDIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEK  65

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  66   HLKLSQVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  123

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
            +A+IS SHH+++    +S  G+ S  +SP +Y RR       PM+S
Sbjct  124  KALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSS-----PMNS  163



>ref|XP_003617281.1| Lateral signaling target protein-like protein [Medicago truncatula]
Length=1124

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 111/169 (66%), Gaps = 14/169 (8%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQ-------DEKF  250
            L KM       GA +R +EQAI ALKKGA LLKY R GKPKFCPFRLS        DE  
Sbjct  19   LLKMNSDLSRTGAVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNVRVALLFDESV  78

Query  251  LIWYSGEKEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDK  418
            LIW+SG++EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK
Sbjct  79   LIWFSGKEEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDK  136

Query  419  MQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +AE WF GL+A+IS SHH+++    +S  G+ S  +SP +Y RR   L
Sbjct  137  DEAEVWFSGLKALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSSPL  184



>gb|KHN38378.1| Putative E3 ubiquitin-protein ligase HERC1 [Glycine soja]
Length=1103

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 110/166 (66%), Gaps = 12/166 (7%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI ALKKGA LLKY R G+PK CPFRLS DE  LIW+SG++EK
Sbjct  1    MASDLSRTGPVERDIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSQVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDS  586
            +A+IS SHH+++    +S  G+ S  +SP +Y RR       PM+S
Sbjct  119  KALISRSHHRKWRTESRSD-GIPSEANSPRTYTRRSS-----PMNS  158



>ref|XP_008450356.1| PREDICTED: uncharacterized protein LOC103491987 [Cucumis melo]
Length=1102

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            + +M +     GA +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  1    MDRMVQDLSKTGAVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGK  60

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK + E WF
Sbjct  61   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKECQSFSLIY--NERSLDLICKDKDETEVWF  118

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS  H++++    +S  G+ S ++SP ++ +R   L
Sbjct  119  SGLKALISRIHNRKWRTESRSD-GMLSEVNSPRTFTQRSSPL  159



>ref|XP_009603791.1| PREDICTED: uncharacterized protein LOC104098693 isoform X1 [Nicotiana 
tomentosiformis]
Length=1101

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS 
Sbjct  8    ASGTVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSH  67

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  68   VSRIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  125

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  GV S  +SP +Y RR   L
Sbjct  126  GHQRKWRTESRSD-GVPSGATSPRTYTRRNSPL  157



>ref|XP_004154652.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226798 
[Cucumis sativus]
Length=1103

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            + +M +     GA +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  1    MDRMVQDLSKTGAVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGK  60

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK + E WF
Sbjct  61   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKECQSFSLIY--NERSLDLICKDKDETEVWF  118

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS  H++++    +S  G+ S ++SP ++ +R   L
Sbjct  119  SGLKALISRIHNRKWRTESRSD-GMLSEVNSPRTFTQRSSPL  159



>ref|XP_004139058.1| PREDICTED: uncharacterized protein LOC101219074 [Cucumis sativus]
Length=1103

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            + +M +     GA +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  1    MDRMVQDLSKTGAVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGK  60

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK + E WF
Sbjct  61   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKECQSFSLIY--NERSLDLICKDKDETEVWF  118

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             GL+A+IS  H++++    +S  G+ S ++SP ++ +R   L
Sbjct  119  SGLKALISRIHNRKWRTESRSD-GMLSEVNSPRTFTQRSSPL  159



>ref|XP_009603792.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X2 [Nicotiana 
tomentosiformis]
Length=915

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS 
Sbjct  8    ASGTVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSH  67

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  68   VSRIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISR  125

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  GV S  +SP +Y RR   L
Sbjct  126  GHQRKWRTESRSD-GVPSGATSPRTYTRRNSPL  157



>emb|CDX69686.1| BnaA10g20350D [Brassica napus]
Length=1070

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GSMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    P++E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPDKEYQSFSLIYS--ERSLDVICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+I S +H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALI-SRYHQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|XP_007213716.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica]
 gb|EMJ14915.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica]
Length=1102

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  9    GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  68

Query  305  NIIHGQQTKQLQP----ERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q     E+E Q  SL+Y +  RSLDLICKDK +A+ WF GL+A+IS SH
Sbjct  69   RIITGQRTPIFQRYPRLEKEYQSFSLIYND--RSLDLICKDKDEADVWFSGLKALISRSH  126

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  G+ S  +SP +Y RR   L
Sbjct  127  HRKWRTESRSD-GIPSEANSPRTYTRRSSPL  156



>ref|XP_008782005.1| PREDICTED: uncharacterized protein LOC103701639 [Phoenix dactylifera]
Length=1101

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+LS V+
Sbjct  13   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKRLKLSHVS  72

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SH
Sbjct  73   RIMPGQRTAVFQRYPRPEKECQSFSLIYND--RSLDLICKDKDEAEVWFAGLKTLISQSH  130

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H+++    +S  GV S  +SP +Y  R   L
Sbjct  131  HQKWRTESRSD-GVSSGTNSPRTYTHRSSPL  160



>emb|CDP08456.1| unnamed protein product [Coffea canephora]
Length=1103

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  L+W SG++EKHL+LS V+
Sbjct  16   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLMWLSGKEEKHLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF GL+A+IS SH
Sbjct  76   RIISGQRTPIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFSGLKALISRSH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  GV S  +SP +Y RR   L
Sbjct  134  QRKWRTESRSD-GVSSEANSPRTYTRRSSPL  163



>ref|XP_002279847.2| PREDICTED: uncharacterized protein LOC100248282 [Vitis vinifera]
Length=1107

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       GA++R  EQA+ ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++E
Sbjct  6    RMASDLSRTGAAERDTEQALTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEE  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            K L+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF G
Sbjct  66   KLLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS   H R   T     G+ S  +SP +Y RR   L
Sbjct  124  LKALISRGGHHRKWRTESRSDGIPSEANSPRTYTRRSSPL  163



>ref|XP_010555025.1| PREDICTED: uncharacterized protein LOC104824622 [Tarenaya hassleriana]
Length=1094

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPF+LS DE  LIW+SG++
Sbjct  5    GRMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFQLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+L  V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF 
Sbjct  65   EKHLKLFQVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS  H +R+    +S  G  S  +SP +Y RR   L
Sbjct  123  GLKALISRFHQRRWRTESRSD-GTPSEANSPRTYTRRSSPL  162



>ref|XP_010420743.1| PREDICTED: uncharacterized protein LOC104706266 [Camelina sativa]
Length=1108

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = +2

Query  128  ASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTN  307
            A  R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ 
Sbjct  20   AVTRDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSR  79

Query  308  IIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHH  475
            II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H 
Sbjct  80   IISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRCHQ  137

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +++    +S  G  S  +SP +Y RR   L
Sbjct  138  RKWRTESRSD-GTPSEANSPRTYTRRSSPL  166



>gb|KFK25508.1| hypothetical protein AALP_AA8G123700 [Arabis alpina]
Length=1069

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 106/159 (67%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK
Sbjct  1    MASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDLICKDKDEAEVWFSGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A++S   H+R   T     G  S  +SP +Y RR   L
Sbjct  119  KALVSHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  156



>ref|XP_010454214.1| PREDICTED: uncharacterized protein LOC104736008 [Camelina sativa]
Length=1108

 Score =   160 bits (404),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = +2

Query  128  ASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTN  307
            A  R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ 
Sbjct  20   AVTRDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSR  79

Query  308  IIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHH  475
            II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H 
Sbjct  80   IISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRCHQ  137

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +++    +S  G  S  +SP +Y RR   L
Sbjct  138  RKWRTESRSD-GTPSEANSPRTYTRRSSPL  166



>emb|CBI24230.3| unnamed protein product [Vitis vinifera]
Length=953

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       GA++R  EQA+ ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK
Sbjct  1    MASDLSRTGAAERDTEQALTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   LLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS   H R   T     G+ S  +SP +Y RR   L
Sbjct  119  KALISRGGHHRKWRTESRSDGIPSEANSPRTYTRRSSPL  157



>ref|XP_010493003.1| PREDICTED: uncharacterized protein LOC104770301 [Camelina sativa]
Length=1108

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = +2

Query  128  ASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTN  307
            A  R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ 
Sbjct  20   AVTRDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSR  79

Query  308  IIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHH  475
            II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H 
Sbjct  80   IISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRCHQ  137

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +++    +S  G  S  +SP +Y RR   L
Sbjct  138  RKWRTESRSD-GTPSEANSPRTYTRRSSPL  166



>ref|XP_006349801.1| PREDICTED: uncharacterized protein LOC102600493 [Solanum tuberosum]
Length=1106

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 154/277 (56%), Gaps = 31/277 (11%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS 
Sbjct  14   ASGLIERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSH  73

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  74   VSRIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKEEAEVWFSGLKALISR  131

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLS--------KVRSLAGS  622
             H +++    +S  G+ S  +SP +Y RR   L   P  S   S        ++ S  GS
Sbjct  132  GHQRKWRTDSRSD-GIPSGATSPRTYTRRSSPL-HSPFGSGDSSQKDGGDQLRLHSPYGS  189

Query  623  P-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVD  787
            P     D++FS+               S  +      ++ +++SG    G +D++ +   
Sbjct  190  PPKNGVDKAFSDVILYAVPPKGFFPADSASA------SIHSLSSG----GSNDIHGQMKA  239

Query  788  FGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
             G    + ++ + + +S   S      AL DVF+WGE
Sbjct  240  MGMDNFRVSLSSAVSSSSQGSGHDDGDALGDVFMWGE  276



>ref|XP_004252890.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X2 [Solanum 
lycopersicum]
Length=1107

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS 
Sbjct  14   ASGLIERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSH  73

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS 
Sbjct  74   VSRIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKEEAEVWFSGLKALISR  131

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +++    +S  G+ S  +SP +Y RR   L
Sbjct  132  GHQRKWRTDSRSD-GIPSGATSPRTYTRRSSPL  163



>ref|NP_197443.3| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
 gb|AED92703.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
Length=1105

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G   R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  16   GPVTRDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  76   RIISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRCH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  G  S  +SP +Y RR   L
Sbjct  134  QRKWRTESRSD-GTPSEANSPRTYTRRSSPL  163



>ref|XP_009785512.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Nicotiana sylvestris]
Length=919

 Score =   159 bits (401),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+
Sbjct  10   GTVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVS  69

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  70   RIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRGH  127

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  G+ S  +SP +Y RR   L
Sbjct  128  QRKWRTESRSD-GIPSGATSPRTYTRRSSPL  157



>ref|XP_009785511.1| PREDICTED: uncharacterized protein LOC104233767 isoform X1 [Nicotiana 
sylvestris]
Length=1101

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+
Sbjct  10   GTVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVS  69

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  70   RIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRGH  127

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  G+ S  +SP +Y RR   L
Sbjct  128  QRKWRTESRSD-GIPSGATSPRTYTRRSSPL  157



>ref|XP_010031729.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Eucalyptus grandis]
 gb|KCW51099.1| hypothetical protein EUGRSUZ_J00702 [Eucalyptus grandis]
Length=1102

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIW+SG++E
Sbjct  7    RMASDLGRAGPIERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEE  66

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            KHL+LS V  II GQ+T   Q    PE+E Q  SL+Y  G RSLDLICKDK +AE+WF G
Sbjct  67   KHLKLSHVDRIISGQRTPIFQRYPRPEKEYQSFSLIY--GDRSLDLICKDKDEAEAWFSG  124

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMR  550
            L+A+IS   H++     +S  G+ S  +SP +Y R
Sbjct  125  LKALISRCRHRKGRTESRSD-GIPSEATSPRTYTR  158



>ref|XP_006399751.1| hypothetical protein EUTSA_v10012520mg [Eutrema salsugineum]
 gb|ESQ41204.1| hypothetical protein EUTSA_v10012520mg [Eutrema salsugineum]
Length=1074

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW SG++
Sbjct  5    GRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWISGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFT  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS   H+R   T     G  S  +SP ++ RR   L
Sbjct  123  GLKALISHC-HQRNRRTESRSDGTPSEANSPRTHTRRSSPL  162



>ref|XP_003532065.2| PREDICTED: uncharacterized protein LOC100797527 [Glycine max]
Length=1109

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+L++V+
Sbjct  19   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKRLKLTNVS  78

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  79   RIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRGH  136

Query  473  HKRFLGTPKSKR-GVQSCISSPASYMRRRQNL  565
            H ++   P+S+  G+ S  +SP +Y RR   L
Sbjct  137  HWKW--RPESRTDGIPSEANSPRTYTRRSSPL  166



>ref|XP_009785513.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X3 
[Nicotiana sylvestris]
Length=910

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+
Sbjct  10   GTVERDIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVS  69

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  H
Sbjct  70   RIISGQRTPIFQRHPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRGH  127

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  G+ S  +SP +Y RR   L
Sbjct  128  QRKWRTESRSD-GIPSGATSPRTYTRRSSPL  157



>ref|XP_010938572.1| PREDICTED: uncharacterized protein LOC105057618 [Elaeis guineensis]
Length=1100

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 122/190 (64%), Gaps = 21/190 (11%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R VEQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+LS V+
Sbjct  13   GPVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKRLKLSHVS  72

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+ +IS SH
Sbjct  73   RIMPGQRTAVFQRYPRPEKECQSFSLIYND--RSLDLICKDKDEAEVWFAGLKTLISQSH  130

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM--------DSTKLSKVRSLAGSP-  625
            ++++    +S  GV S  +SP +Y  R   L   P         DS++  ++RS   SP 
Sbjct  131  NQKWRTESRSD-GVSSGTNSPRTYTHRSSPLS-SPFGSSDSIQKDSSETLRLRSPYESPP  188

Query  626  ----DRSFSE  643
                D++FS+
Sbjct  189  KNGLDKAFSD  198



>ref|XP_002980107.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii]
 gb|EFJ18977.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii]
Length=1090

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            GA +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EK LRLSS+T
Sbjct  8    GAVERDIEQAITALKKGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSIT  67

Query  305  NIIHGQQTKQLQP----ERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T   Q     E+E Q  SL+Y N  RSLDLICKDK +AE WF+GL+A++S   
Sbjct  68   RIVPGQRTANFQRYPRLEKEYQSFSLIYGN-DRSLDLICKDKDEAEVWFVGLKALVSGGQ  126

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR  550
              R     +S+ G  S  +SPA++ R
Sbjct  127  LSRLRFDSRSECGPPSDSNSPATWSR  152



>emb|CDX91165.1| BnaC02g04320D [Brassica napus]
Length=1073

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M          +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GRMASDLSRAVPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS   H+R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALISRC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  162



>ref|XP_006654344.1| PREDICTED: uncharacterized protein LOC102712360 [Oryza brachyantha]
Length=1085

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 7/148 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PGA +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK LRLS V
Sbjct  12   PGAVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHV  71

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS S
Sbjct  72   SRIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRS  129

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRR  553
            H +++    +S   + S  +SP +Y RR
Sbjct  130  HQRKWRTESRSDM-LSSGTTSPRTYTRR  156



>ref|XP_009131736.1| PREDICTED: uncharacterized protein LOC103856379 [Brassica rapa]
Length=1103

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  APGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSS  298
            A G   R VEQAI ALKKGA+LLKY   GKPKFCPFRLS DE  LIW+SG +EKHL+LS 
Sbjct  14   AGGPVARDVEQAITALKKGAYLLKYGTRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSH  73

Query  299  VTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISS  466
            V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLD+ICKDK +AE WF GL+A+IS 
Sbjct  74   VSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDVICKDKDEAEVWFSGLKALISR  131

Query  467  SHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             H +R+    +S  G  S  +SP +Y RR   L
Sbjct  132  CHQRRWRTESRSD-GTPSEATSPRTYTRRSSPL  163



>gb|KFK26205.1| hypothetical protein AALP_AA8G216200 [Arabis alpina]
Length=1104

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/285 (39%), Positives = 156/285 (55%), Gaps = 31/285 (11%)
 Frame = +2

Query  95   GKMGEQFLA-PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            G+M    L+  G   R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  5    GRMASSDLSRAGPVTRDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGK  64

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF
Sbjct  65   EEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIY--NERSLDLICKDKDEAEVWF  122

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKL-------S  598
             GL+A++S  + +++    +S  G  S  +SP +Y RR   L   P  S +         
Sbjct  123  SGLKALVSRCYQRKWRTESRSD-GTPSEANSPRTYTRRSSPL-HSPFSSNESFQKDGSNH  180

Query  599  KVRSLAGSP-----DRSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPD  763
            ++ S  GSP     D++FS+               S         ++ +++SG    GP+
Sbjct  181  RLHSPYGSPPKNGIDKAFSDMSLYAVPPKGFFPSDSATI------SVHSLSSG----GPE  230

Query  764  DLNKRTVDFGQGETQANMLNLLETSVYESTQSANYALRDVFIWGE  898
             ++      G    + ++ + + +S + S      AL DVF+WGE
Sbjct  231  SIHGHMKGMGMDAFRVSLSSAISSSSHGSGHDDGDALGDVFMWGE  275



>ref|XP_002873947.1| hypothetical protein ARALYDRAFT_488831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50206.1| hypothetical protein ARALYDRAFT_488831 [Arabidopsis lyrata subsp. 
lyrata]
Length=1100

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G   R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+
Sbjct  11   GPVTRDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVS  70

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y   +RSLD+ICKDK +AE WF GL+A+IS  H
Sbjct  71   RIISGQRTPIFQRYPRPEKEYQSFSLIY--DERSLDVICKDKDEAEVWFSGLKALISRCH  128

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
             +++    +S  G  S  +SP +Y RR   L
Sbjct  129  QRKWRTESRSD-GTPSEANSPRTYTRRSSPL  158



>emb|CBI31979.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R VEQAIVALKKGA+LLKY R GKPKFCPFRLS DE  LIWYSG++EK L+L++V+
Sbjct  8    GLAERDVEQAIVALKKGAYLLKYGRRGKPKFCPFRLSNDESMLIWYSGKEEKQLKLNNVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y  G RSLDLICKDK +AE WF+GL+ +IS  +
Sbjct  68   RIIPGQRTPIFQRYPRPEKEYQSFSLIY--GDRSLDLICKDKDEAEVWFIGLKGLISRGN  125

Query  473  HKRF  484
            ++++
Sbjct  126  YRKW  129



>ref|XP_008668987.1| PREDICTED: uncharacterized protein LOC103646027 [Zea mays]
Length=1073

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  RAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIH  316
            R VEQAIVALKKGAHLLK  + GKPKFC FR+S DE  LIWYS  +EKHL LSSV+ ++ 
Sbjct  12   RGVEQAIVALKKGAHLLKCGKRGKPKFCAFRISSDETTLIWYSKGREKHLSLSSVSAVVL  71

Query  317  GQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRF  484
            GQ+T    +Q  PE+E    SL+Y NG+RSLDLIC D+ QAE+W+LGLRA++ +  +   
Sbjct  72   GQKTIKFLRQRCPEKEPHSFSLIYKNGERSLDLICSDRDQAENWYLGLRALLPTPCNPCS  131

Query  485  LGTPKSKRGVQSCISSPASYMRRRQNL  565
                +S R + SC ++P+SY++ +  L
Sbjct  132  SIESRSSRQIDSCTNTPSSYIQLKSKL  158



>ref|NP_001055416.1| Os05g0384800 [Oryza sativa Japonica Group]
 dbj|BAF17330.1| Os05g0384800 [Oryza sativa Japonica Group]
Length=1086

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 7/148 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PGA +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK LRLS V
Sbjct  13   PGAVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHV  72

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +I+ S
Sbjct  73   SRIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLITRS  130

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRR  553
            H +++    +S   + S  +SP +Y RR
Sbjct  131  HQRKWRTESRSDM-LSSGTTSPRTYTRR  157



>ref|XP_010645610.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Vitis vinifera]
Length=1104

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +E AI+ALKKGAHLLKY R GKPKFCPFRLS DE  LIW SG++EK L+LS V+
Sbjct  16   GPEERDIELAIIALKKGAHLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEEKRLKLSHVS  75

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE W  GL+A+IS  H
Sbjct  76   RIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWLTGLKALISRGH  133

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H++  G  +S+ GV S  +SP ++ +R   L
Sbjct  134  HQK--GRTESRSGVSSEANSPRTHTQRSSPL  162



>gb|AAT77332.1| unknown prtein [Oryza sativa Japonica Group]
Length=901

 Score =   157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 7/148 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PGA +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK LRLS V
Sbjct  13   PGAVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHV  72

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +I+ S
Sbjct  73   SRIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLITRS  130

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRR  553
            H +++    +S   + S  +SP +Y RR
Sbjct  131  HQRKWRTESRSDM-LSSGTTSPRTYTRR  157



>ref|XP_008678947.1| PREDICTED: uncharacterized protein LOC103653921 isoform X2 [Zea 
mays]
Length=1065

 Score =   157 bits (397),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
            ++IVALKKGAHLLK  + GKPKFC  RLS DE+ LIWYS E+ K L L+SV++++ GQ+T
Sbjct  19   ESIVALKKGAHLLKCGKRGKPKFCTVRLSYDERALIWYSKERGKRLSLNSVSSVVLGQKT  78

Query  329  KQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
             +L     PE+ES  +S++Y NG+ SLDL+CKD+ QAE W+LGL AVIS+      L   
Sbjct  79   TKLLRLHWPEKESHSLSIIYKNGESSLDLVCKDRDQAECWYLGLTAVISAPCTPLLLIDS  138

Query  497  KSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP  625
             + R + SC +SP SY+++R  L     D     KV SL GSP
Sbjct  139  TNSRRINSCTNSPPSYIQQRSRL-FAVHDGRNFPKVNSLYGSP  180



>ref|XP_011004007.1| PREDICTED: uncharacterized protein LOC105110613 [Populus euphratica]
Length=1096

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G M       G  +R  EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  4    GDMASDLGRTGHVERDTEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKQ  63

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EK L+L  V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF 
Sbjct  64   EKFLQLIHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFS  121

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS SH++++    +S  G+ S  +SP +Y RR   L
Sbjct  122  GLKALISRSHNRKWRTESRSD-GIPSEANSPRTYTRRSSPL  161



>ref|XP_011015114.1| PREDICTED: uncharacterized protein LOC105118779 [Populus euphratica]
Length=1096

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G M       G  +R  EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  4    GDMASDLGRTGHVERDTEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKQ  63

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EK L+L  V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF 
Sbjct  64   EKFLQLIHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFS  121

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+IS SH++++    +S  G+ S  +SP +Y RR   L
Sbjct  122  GLKALISRSHNRKWRTESRSD-GIPSEANSPRTYTRRSSPL  161



>ref|XP_006470569.1| PREDICTED: uncharacterized protein LOC102612328 isoform X3 [Citrus 
sinensis]
Length=918

 Score =   156 bits (394),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
            +AI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T
Sbjct  41   KAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  100

Query  329  KQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
               Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SHH+++    
Sbjct  101  PIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTES  158

Query  497  KSKRGVQSCISSPASYMRRRQNL  565
            +S  G+ S  +SP +Y RR   L
Sbjct  159  RSD-GIPSEANSPRTYTRRSSPL  180



>ref|XP_006470567.1| PREDICTED: uncharacterized protein LOC102612328 isoform X1 [Citrus 
sinensis]
Length=1123

 Score =   156 bits (395),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
            +AI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T
Sbjct  41   KAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  100

Query  329  KQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
               Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SHH+++    
Sbjct  101  PIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTES  158

Query  497  KSKRGVQSCISSPASYMRRRQNL  565
            +S  G+ S  +SP +Y RR   L
Sbjct  159  RSD-GIPSEANSPRTYTRRSSPL  180



>ref|XP_004168499.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like, partial [Cucumis 
sativus]
Length=806

 Score =   155 bits (392),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 110/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G + R +EQAI+ALKKGAHLLKY R GKPKFCPFRLS DE  L+WYSG+ EK L+LS V+
Sbjct  8    GLAQRDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVS  67

Query  305  NIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T       QPE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   KIIPGQRTAIFQQYPQPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR-RRQNLGLYPMDSTKLSKV  604
            H+++    + +      +SS + + R RR +  + P D   L  V
Sbjct  126  HRKWRVESRCES-----VSSDSPHARLRRNSPSITPCDPGDLDGV  165



>ref|XP_006646687.1| PREDICTED: uncharacterized protein LOC102710941 [Oryza brachyantha]
Length=1090

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 119/186 (64%), Gaps = 19/186 (10%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  18   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIV  77

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  78   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRSHQRK  135

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP-----  625
            +    +S   + S  +SP +Y RR   L            D ++  ++RS  GSP     
Sbjct  136  WRTESRSDI-ISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSEHYRLRSPFGSPPKNAL  194

Query  626  DRSFSE  643
            D++FS+
Sbjct  195  DKAFSD  200



>ref|XP_002298476.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE83281.2| zinc finger family protein [Populus trichocarpa]
Length=1115

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 110/171 (64%), Gaps = 18/171 (11%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIV-----------ALKKGAHLLKYSRMGKPKFCPFRLSQDE  244
            +M       G  +R +EQ I+           ALKKGA+LLKY R GKPKFCPFRLS DE
Sbjct  6    RMASDLSRTGPVERDMEQLIMKWKYILKESNPALKKGAYLLKYGRRGKPKFCPFRLSNDE  65

Query  245  KFLIWYSGEKEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICK  412
              LIW+SG++EKHLRLS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICK
Sbjct  66   SVLIWFSGKEEKHLRLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICK  123

Query  413  DKMQAESWFLGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            DK +AE WF GL+A+IS SHH++     +S  G+ S ++SP +Y RR   L
Sbjct  124  DKDEAEVWFSGLKALISRSHHRKSRTESRSD-GILSEVNSPRTYTRRSSPL  173



>ref|XP_009410388.1| PREDICTED: uncharacterized protein LOC103992424 [Musa acuminata 
subsp. malaccensis]
Length=1047

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 9/150 (6%)
 Frame = +2

Query  116  LAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLS  295
            L  G+ +R VEQAI ALKKGAHLLKY R GKPKFCPFRLS DE  LIWYSG+ EK L+LS
Sbjct  5    LRNGSVERDVEQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESLLIWYSGKDEKQLKLS  64

Query  296  SVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS  463
             V+ II GQ+T   Q    P++E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS
Sbjct  65   QVSKIIPGQRTAIFQRYPRPDKEYQSFSLIYND--RSLDLICKDKDEAEVWFVGLKALIS  122

Query  464  SSHHKRFLGTPKSKRGVQSCISSPASYMRR  553
               H++        RG ++   SP+++ ++
Sbjct  123  HGSHQKLR---SESRGDRTSSDSPSTHTQK  149



>gb|KGN61393.1| hypothetical protein Csa_2G109700 [Cucumis sativus]
Length=828

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 110/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G + R +EQAI+ALKKGAHLLKY R GKPKFCPFRLS DE  L+WYSG+ EK L+LS V+
Sbjct  8    GLAQRDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVS  67

Query  305  NIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T       QPE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   KIIPGQRTAIFQQYPQPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR-RRQNLGLYPMDSTKLSKV  604
            H+++    + +      +SS + + R RR +  + P D   L  V
Sbjct  126  HRKWRVESRCES-----VSSDSPHARLRRNSPSITPCDPGDLDGV  165



>ref|XP_008441693.1| PREDICTED: uncharacterized protein LOC103485768 isoform X2 [Cucumis 
melo]
Length=864

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G + R +EQAI+ALKKGAHLLKY R GKPKFCPFRLS DE  L+WYSG+ EK L+LS V+
Sbjct  8    GLAQRDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLLWYSGKDEKQLKLSLVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    +  QPE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   KIIPGQRTAIFQQHPQPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR-RRQNLGLYPMDSTKLSKV  604
            H+++    + +      +SS + + R RR +  + P D   L  V
Sbjct  126  HRKWRVESRCES-----VSSDSPHARMRRNSPSITPCDPGDLDGV  165



>ref|XP_004138993.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101222790 
[Cucumis sativus]
Length=982

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 110/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G + R +EQAI+ALKKGAHLLKY R GKPKFCPFRLS DE  L+WYSG+ EK L+LS V+
Sbjct  8    GLAQRDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVS  67

Query  305  NIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T       QPE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   KIIPGQRTAIFQQYPQPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR-RRQNLGLYPMDSTKLSKV  604
            H+++    + +      +SS + + R RR +  + P D   L  V
Sbjct  126  HRKWRVESRCES-----VSSDSPHARLRRNSPSITPCDPGDLDGV  165



>gb|EYU35939.1| hypothetical protein MIMGU_mgv1a019835mg, partial [Erythranthe 
guttata]
Length=1074

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 104/154 (68%), Gaps = 8/154 (5%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI ALKKGAHLLKY R GKPKFCPFRL+ DE  LIW+SG++EKHL+LS V+ I+ GQ+T 
Sbjct  1    AITALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIVSGQRTP  60

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  H +++    +
Sbjct  61   IFQRYPRPEKEYQSFSLIYND--RSLDLICKDKEEAEVWFSGLKALISRGHQRKWRTETR  118

Query  500  SKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSK  601
            S  G+ S  +SP +Y RR   L   P  S  L K
Sbjct  119  SD-GISSGANSPRAYTRRSSPLN-SPFGSDSLQK  150



>ref|XP_008441692.1| PREDICTED: uncharacterized protein LOC103485768 isoform X1 [Cucumis 
melo]
Length=982

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G + R +EQAI+ALKKGAHLLKY R GKPKFCPFRLS DE  L+WYSG+ EK L+LS V+
Sbjct  8    GLAQRDIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLLWYSGKDEKQLKLSLVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    +  QPE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   KIIPGQRTAIFQQHPQPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR-RRQNLGLYPMDSTKLSKV  604
            H+++    + +      +SS + + R RR +  + P D   L  V
Sbjct  126  HRKWRVESRCES-----VSSDSPHARMRRNSPSITPCDPGDLDGV  165



>gb|KDO54855.1| hypothetical protein CISIN_1g0026771mg, partial [Citrus sinensis]
Length=869

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 101/142 (71%), Gaps = 7/142 (5%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T 
Sbjct  1    AITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRTP  60

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SHH+++    +
Sbjct  61   IFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESR  118

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S  G+ S  +SP +Y RR   L
Sbjct  119  SD-GIPSEANSPRTYTRRSSPL  139



>gb|KDO54854.1| hypothetical protein CISIN_1g0026771mg [Citrus sinensis]
Length=885

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
            +AI ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T
Sbjct  16   RAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  75

Query  329  KQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
               Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS SHH+++    
Sbjct  76   PIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTES  133

Query  497  KSKRGVQSCISSPASYMRRRQNL  565
            +S  G+ S  +SP +Y RR   L
Sbjct  134  RSD-GIPSEANSPRTYTRRSSPL  155



>gb|EEE56014.1| hypothetical protein OsJ_04782 [Oryza sativa Japonica Group]
Length=1093

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 118/186 (63%), Gaps = 19/186 (10%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  18   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIV  77

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  78   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISHSHQRK  135

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP-----  625
            +    +S   + S  +SP +Y RR   L            D +   ++RS  GSP     
Sbjct  136  WRTESRSDI-ISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHYRLRSPFGSPPKNAL  194

Query  626  DRSFSE  643
            D++FS+
Sbjct  195  DKAFSD  200



>gb|EEC72175.1| hypothetical protein OsI_05225 [Oryza sativa Indica Group]
Length=1093

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 118/186 (63%), Gaps = 19/186 (10%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  18   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIV  77

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  78   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISHSHQRK  135

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP-----  625
            +    +S   + S  +SP +Y RR   L            D +   ++RS  GSP     
Sbjct  136  WRTESRSDI-ISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHYRLRSPFGSPPKNAL  194

Query  626  DRSFSE  643
            D++FS+
Sbjct  195  DKAFSD  200



>dbj|BAD87854.1| putative ZR1 protein [Oryza sativa Japonica Group]
Length=1091

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 118/186 (63%), Gaps = 19/186 (10%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  18   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIV  77

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  78   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISHSHQRK  135

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP-----  625
            +    +S   + S  +SP +Y RR   L            D +   ++RS  GSP     
Sbjct  136  WRTESRSDI-ISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHYRLRSPFGSPPKNAL  194

Query  626  DRSFSE  643
            D++FS+
Sbjct  195  DKAFSD  200



>ref|XP_009125861.1| PREDICTED: uncharacterized protein LOC103850825 [Brassica rapa]
Length=1076

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 106/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  95   GKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEK  274
            G+M          +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++
Sbjct  5    GRMASDLSRAVPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKE  64

Query  275  EKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFL  442
            EKHL+LS V+ II GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF 
Sbjct  65   EKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFS  122

Query  443  GLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            GL+A+I S   +R   T     G  S  +SP +Y RR   L
Sbjct  123  GLKALI-SHFRQRTRRTESRSDGTPSEANSPRTYTRRSSPL  162



>gb|KDO49057.1| hypothetical protein CISIN_1g0013612mg, partial [Citrus sinensis]
Length=924

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M     A    +R +E AI ALKKGAHLLKY R GKPKFCPFRL+ DE  LIW SG++EK
Sbjct  1    MATTGAAAAPVERDIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SH+++     +S   V S  +SP ++ +R   L
Sbjct  119  KALISRSHYRKGRAESRSDE-VSSVATSPRAHTQRSSPL  156



>ref|XP_006420722.1| hypothetical protein CICLE_v10004216mg [Citrus clementina]
 gb|ESR33962.1| hypothetical protein CICLE_v10004216mg [Citrus clementina]
Length=1092

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M     A    +R +E AI ALKKGAHLLKY R GKPKFCPFRL+ DE  LIW SG++EK
Sbjct  1    MATTGAAAAPVERDIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SH+++     +S   V S  +SP ++ +R   L
Sbjct  119  KALISRSHYRKGRAESRSDE-VSSVATSPRAHTQRSSPL  156



>ref|XP_004971285.1| PREDICTED: uncharacterized protein LOC101782721 [Setaria italica]
Length=1092

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+
Sbjct  14   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVS  73

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH
Sbjct  74   RIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRSH  131

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRR  553
             +++    +S   + S  +SP +Y RR
Sbjct  132  QRKWRTESRSDI-LSSGATSPRTYTRR  157



>ref|NP_001045419.2| Os01g0952300 [Oryza sativa Japonica Group]
 dbj|BAF07333.2| Os01g0952300 [Oryza sativa Japonica Group]
Length=1133

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 118/186 (63%), Gaps = 19/186 (10%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  18   ERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIV  77

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  78   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISHSHQRK  135

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP-----  625
            +    +S   + S  +SP +Y RR   L            D +   ++RS  GSP     
Sbjct  136  WRTESRSDI-ISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHYRLRSPFGSPPKNAL  194

Query  626  DRSFSE  643
            D++FS+
Sbjct  195  DKAFSD  200



>ref|XP_006470863.1| PREDICTED: uncharacterized protein LOC102630015 isoform X1 [Citrus 
sinensis]
Length=1092

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M     A    +R +E AI ALKKGAHLLKY R GKPKFCPFRL+ DE  LIW SG++EK
Sbjct  1    MATTGAAAAPVERDIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
            HL+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL
Sbjct  61   HLKLSHVSRIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +A+IS SH+++     +S   V S  +SP ++ +R   L
Sbjct  119  KALISRSHYRKGRAESRSDE-VSSVATSPRAHTQRSSPL  156



>ref|XP_004307114.1| PREDICTED: uncharacterized protein LOC101307830 [Fragaria vesca 
subsp. vesca]
Length=1083

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 153/270 (57%), Gaps = 20/270 (7%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PG  +R +  AI ALKKG+ LLKY R GKPKFCPFRLS DE  LIWYSG+ EK+++LS V
Sbjct  14   PGPLERDIHLAITALKKGSQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKDEKYVKLSHV  73

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS  
Sbjct  74   SRIIPGQRTPIFQRYPRPEKEYQSFSLIYDD--RSLDLICKDKDEAEVWFTGLKALISRG  131

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNLG--LYPMDSTKLSKVR-----SLAGSPD  628
              ++  G  ++K GV S  +SP S+ +R   L       DS++  +V      + + SP 
Sbjct  132  LQQK--GRAETKSGVTSEANSPRSHTQRSSPLSSPFCSGDSSQKDEVEPFHPHATSESPP  189

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
            +   E+  SD +  +        S S+   +  +++SG    G D +N RT   G    +
Sbjct  190  KVHLEKALSDAMLYALPPKVPFPSDSAS-GSFQSLSSG----GSDGMNGRTKGAGTDAYR  244

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWGE  898
             ++ + + +S   S      AL DVFIWGE
Sbjct  245  VSLSSAVSSSSQGSGHDDGDALGDVFIWGE  274



>ref|XP_006854588.1| hypothetical protein AMTR_s00030p00120950 [Amborella trichopoda]
 gb|ERN16055.1| hypothetical protein AMTR_s00030p00120950 [Amborella trichopoda]
Length=1114

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R +EQAIVALKKGA LLKY R GKPKFCPFR+S DE  LIWYS  +E+ L+L+SVT
Sbjct  8    GGAERNIEQAIVALKKGAQLLKYGRKGKPKFCPFRISNDESTLIWYSRGEERKLKLASVT  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    + L PE++    SL+Y NG+RSLDLICKDK++AE WF GL+A+IS   
Sbjct  68   KIIPGQRTVIFKRYLCPEKDYLSFSLLYNNGERSLDLICKDKVEAEVWFGGLKALISGGQ  127

Query  473  HKR  481
            H R
Sbjct  128  HSR  130



>dbj|BAJ88383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1092

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 119/189 (63%), Gaps = 19/189 (10%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK LRLS V+
Sbjct  15   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH
Sbjct  75   RIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRSH  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPM-------DSTKLSKVRSLAGSP--  625
             +++    +S   + S  +SP +Y RR   L            D ++  ++RS  GSP  
Sbjct  133  QRKWRTESRSDM-LSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGSENYRLRSPYGSPPK  191

Query  626  ---DRSFSE  643
               D++FS+
Sbjct  192  AGLDKAFSD  200



>ref|XP_007011054.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
 gb|EOY19864.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
Length=1111

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  EQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHL  286
            EQ    G  +R +E AI ALKKGA LLKY R GKPKFCPFRLS DE  LIW SG++EK+L
Sbjct  13   EQSRVAGVPERDIELAITALKKGAPLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKYL  72

Query  287  RLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRA  454
            +LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A
Sbjct  73   KLSHVSRIIPGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGLKA  130

Query  455  VISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            +IS  HH++     +S  GV S  +SP ++ +R   L
Sbjct  131  LISRGHHRKGRAESRSD-GVSSEATSPRAHTQRSSPL  166



>ref|XP_009360355.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103950839 
[Pyrus x bretschneideri]
Length=1033

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R ++QAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EKHL+L  V+
Sbjct  8    GPVERDIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKHLKLCHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E    SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   TIIPGQRTAIFQRYPRPEKEYXSFSLLYND--RSLDLICKDKDEAEVWFVGLKAIITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRR  556
            ++ +   P+S+    + I SP +  RRR
Sbjct  126  YRNWRSEPRSE---GTSIDSPHARTRRR  150



>ref|XP_003565075.1| PREDICTED: uncharacterized protein LOC100834588 [Brachypodium 
distachyon]
Length=1092

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 124/201 (62%), Gaps = 23/201 (11%)
 Frame = +2

Query  92   LGKMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGE  271
            LG +G +   P   +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+
Sbjct  8    LGGVGLRAGPP--VERDLEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGK  65

Query  272  KEKHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWF  439
            +EKHLRLS V+ I+ GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF
Sbjct  66   EEKHLRLSHVSRIMPGQRTAIFQRYPRPEKECQSFSLISQD--RSLDIICKDKDEAEVWF  123

Query  440  LGLRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRR--------RQNLGLYPMDSTKL  595
             GL+ +IS SH +++    +S   + S  +SP  Y RR          N  L+  D  + 
Sbjct  124  AGLKTLISRSHQRKWRTESRSDT-ISSAATSPRIYTRRSSPLSSPFSSNDSLH-KDGNEN  181

Query  596  SKVRSLAGSP-----DRSFSE  643
             + RS  GSP     D++FS+
Sbjct  182  YRFRSPYGSPQKNGLDKAFSD  202



>ref|XP_002273996.2| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652192.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652196.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652200.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
Length=1047

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R VEQAIVALKKGA+LLKY R GKPKFCPFRLS DE  LIWYSG++EK L+L++V+
Sbjct  8    GLAERDVEQAIVALKKGAYLLKYGRRGKPKFCPFRLSNDESMLIWYSGKEEKQLKLNNVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y  G RSLDLICKDK +AE WF+GL+ +IS  +
Sbjct  68   RIIPGQRTPIFQRYPRPEKEYQSFSLIY--GDRSLDLICKDKDEAEVWFIGLKGLISRGN  125

Query  473  HKRF  484
            ++++
Sbjct  126  YRKW  129



>ref|XP_004298436.1| PREDICTED: uncharacterized protein LOC101307114 [Fragaria vesca 
subsp. vesca]
Length=1012

 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 147/272 (54%), Gaps = 39/272 (14%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G +DR ++QAI +LKKGA LLKY R GKPKFCPFRLS DE  LIWYSG+ EKH+RLS V+
Sbjct  8    GPADRDIDQAIASLKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKDEKHIRLSHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+   
Sbjct  68   TIIPGQRTAIFQRYPRPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALINRGS  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMDSTKLSKVRSLAGSP----DRSFS  640
            ++      +S   + S  + PA   R   ++  +  D+   ++  SL  +P     R+F+
Sbjct  126  YRNLRIESRSDNSI-STDTPPARTRRSSPSIAPFICDAAGDTEGASLENAPLNRLGRAFA  184

Query  641  ERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ-ANM  817
            +               S    +  H    +I+S SP          +VD   G +  +  
Sbjct  185  D-------------IISYTDATKTHAESPSISSLSPA---------SVDHSNGRSSTSEA  222

Query  818  LNLLETSVYESTQSANY-----ALRDVFIWGE  898
            + +  +S   S+   +Y     AL DVFIWGE
Sbjct  223  VRISLSSAVSSSSQGSYPDDFDALGDVFIWGE  254



>ref|XP_009395123.1| PREDICTED: uncharacterized protein LOC103980429 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395124.1| PREDICTED: uncharacterized protein LOC103980429 [Musa acuminata 
subsp. malaccensis]
Length=1059

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 102/150 (68%), Gaps = 9/150 (6%)
 Frame = +2

Query  116  LAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLS  295
            L  G  +R VEQAI ALKKGA+LLKY R G+PKFCPFRLS DE  LIWYSG  EK L+LS
Sbjct  15   LRNGPVERDVEQAITALKKGAYLLKYGRRGRPKFCPFRLSNDESLLIWYSGRDEKQLKLS  74

Query  296  SVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS  463
             V  II GQ+T   Q    P++E Q  SL+Y   +RSLDLICKDK +AE+WF+GL+A+IS
Sbjct  75   QVYKIIPGQRTAIFQRYPRPDKEYQSFSLIY--NERSLDLICKDKDEAEAWFVGLKALIS  132

Query  464  SSHHKRFLGTPKSKRGVQSCISSPASYMRR  553
              ++++     K  R   +   SP +Y+R+
Sbjct  133  RGNYRKLRSESKGDR---TSSDSPTTYIRK  159



>ref|XP_002513064.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF49567.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1096

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 153/270 (57%), Gaps = 19/270 (7%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            PG  +R +E AI ALKKGA LLKY R GKPKFCPFRL+ DE  L+W SG++EKHL+LS V
Sbjct  9    PGPVERDIELAITALKKGAQLLKYGRRGKPKFCPFRLANDESALVWLSGKEEKHLKLSHV  68

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE W  GL+A+IS +
Sbjct  69   SRIISGQRTPIFQRYPRPEKEYQSFSLIYDD--RSLDLICKDKDEAEVWITGLKALISRN  126

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQNL--GLYPMDSTKLSKV-----RSLAGSPD  628
            H ++  G  +S  G+ S  +SP ++ +R   L       DS++  ++     R+  GSP 
Sbjct  127  HMRKGRGESRSD-GISSEATSPRAHTQRSSPLSSAFGSGDSSQKDEIDPLRLRTPYGSPP  185

Query  629  RSFSERgcsdglscssdsffselsmssmHNALDAINSGSPYVGPDDLNKRTVDFGQGETQ  808
            ++  E+     LS       +   +    +A  +++S S   G D +N R         +
Sbjct  186  KAGLEK----VLSDMELYAVAPKVLCPPESACGSVHSVS-SAGSDAINGRLKGMTVDAFR  240

Query  809  ANMLNLLETSVYESTQSANYALRDVFIWGE  898
             ++ + + +S   S    + AL DV+IWGE
Sbjct  241  VSLSSAVSSSSQGSGHDDSDALGDVYIWGE  270



>ref|XP_008656863.1| PREDICTED: uncharacterized protein LOC103636281 [Zea mays]
Length=1092

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS ++
Sbjct  14   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHIS  73

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS  H
Sbjct  74   KIIPGQRTSIFQRYPRPEKECQSFSLISHD--RSLDVICKDKDEAEVWFAGLKTLISRCH  131

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRR  553
             +++    +S   + S  +SP +Y RR
Sbjct  132  QRKWRTESRSDL-LSSGATSPRTYTRR  157



>ref|XP_010091214.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
 gb|EXB43469.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
Length=1018

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EKH++LS V+
Sbjct  8    GIAERDIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHVKLSHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y  G RSLDLICKDK +AE WF+GL A+I+  +
Sbjct  68   RIIPGQRTAIFQRYPRPEKEYQSFSLIY--GDRSLDLICKDKDEAEVWFVGLNALITRDN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMD  583
            + ++     S  G    + SP +   RR +  + P D
Sbjct  126  YCKWRTELISDNG---SVDSPNTRT-RRNSPSITPFD  158



>ref|XP_004976599.1| PREDICTED: uncharacterized protein LOC101769145 [Setaria italica]
Length=1068

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  RAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIH  316
            R VEQAIVALKKGA+LLK  + GKPKFC FRLS DE  LIWYS  +EK L LSSV+ ++ 
Sbjct  12   RGVEQAIVALKKGAYLLKCGKRGKPKFCSFRLSSDETALIWYSKGREKRLSLSSVSAVVL  71

Query  317  GQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRF  484
            GQ+T    +Q  PE+ESQ +SL+Y NG+RSLDLIC +K QAE W+LGLRA++ +      
Sbjct  72   GQKTIKFLRQRCPEKESQSLSLIYKNGERSLDLICSNKDQAEYWYLGLRALLPAPCSPCS  131

Query  485  LGTPKSKRGVQSCISSPASYMRRRQNL  565
                +S R + SC ++P SY++ +  L
Sbjct  132  SIGSRSSRQIDSCTNTPRSYIQLKSRL  158



>ref|XP_011024954.1| PREDICTED: uncharacterized protein LOC105125966 isoform X2 [Populus 
euphratica]
Length=1103

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  98   KMGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKE  277
            +M       G  +R  EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+++
Sbjct  6    RMASDLSRTGPVERDNEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEK  65

Query  278  KHLRLSSVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLG  445
            K L+LS V+ II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE+WF G
Sbjct  66   KLLKLSDVSKIISGQRTPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEAWFHG  123

Query  446  LRAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            L+A+IS S  +++    +S  G+ S ++SP +Y RR   L
Sbjct  124  LKALISRSCPQKWRTESRSD-GILSEVNSPRTYTRRSSPL  162



>emb|CDX70876.1| BnaC03g09600D [Brassica napus]
Length=1115

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +EKHL+LS V+ II GQ+T 
Sbjct  49   AITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSHVSRIISGQRTP  108

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y   +RSLD+ICKDK +AE WF GL+A+IS  H +R+    +
Sbjct  109  IFQRYPRPEKEYQSFSLIY--NERSLDVICKDKDEAEVWFSGLKALISRCHQRRWRTESR  166

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S  G  S  +SP +Y RR   L
Sbjct  167  SD-GTPSEATSPRTYTRRSSPL  187



>emb|CDX88891.1| BnaA03g07580D [Brassica napus]
Length=1135

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +EKHL+LS V+ II GQ+T 
Sbjct  57   AITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSHVSRIISGQRTP  116

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y   +RSLD+ICKDK +AE WF GL+A+IS  H +R+    +
Sbjct  117  IFQRYPRPEKEYQSFSLIY--NERSLDVICKDKDEAEVWFSGLKALISRCHQRRWRTESR  174

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S  G  S  +SP +Y RR   L
Sbjct  175  SD-GTPSEATSPRTYTRRSSPL  195



>ref|XP_003568548.1| PREDICTED: uncharacterized protein LOC100838586 [Brachypodium 
distachyon]
Length=1090

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK LRL+ V+
Sbjct  15   GPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLNHVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH
Sbjct  75   RIIPGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRSH  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRR  553
             +++    +S   + S  +SP +Y RR
Sbjct  133  QRKWRTESRSDM-LSSGTTSPRTYTRR  158



>gb|KDO76103.1| hypothetical protein CISIN_1g0026021mg, partial [Citrus sinensis]
Length=161

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R  EQA+  LKKG +LLKY R GKPKFCPFRLS DEK LIWY+G++EK L+LS V+ II
Sbjct  11   ERDTEQAVRVLKKGTYLLKYGRRGKPKFCPFRLSSDEKLLIWYAGKEEKQLKLSHVSRII  70

Query  314  HGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             GQ+T       QPE+E Q  SL+Y N  RSLDLICKDK +AE WF  LRA+IS  +
Sbjct  71   PGQRTAVFQRYPQPEKEYQSFSLIYRN--RSLDLICKDKDEAELWFTALRALISEDN  125



>ref|NP_001190338.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
 gb|AED92704.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
Length=1139

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = +2

Query  149  QAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQT  328
             AI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T
Sbjct  58   HAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  117

Query  329  KQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTP  496
               Q    PE+E Q  SL+Y   +RSLDLICKDK +AE WF GL+A+IS  H +++    
Sbjct  118  PIFQRYPRPEKEYQSFSLIY--DERSLDLICKDKDEAEVWFSGLKALISRCHQRKWRTES  175

Query  497  KSKRGVQSCISSPASYMRRRQNL  565
            +S  G  S  +SP +Y RR   L
Sbjct  176  RSD-GTPSEANSPRTYTRRSSPL  197



>ref|XP_002992739.1| hypothetical protein SELMODRAFT_430894 [Selaginella moellendorffii]
 gb|EFJ06220.1| hypothetical protein SELMODRAFT_430894 [Selaginella moellendorffii]
Length=982

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 100/153 (65%), Gaps = 9/153 (6%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            DR VEQAI+ALKKG+ LLKY R G+PKF PFRLS DE  LIW+SG KE+ LRL +VT II
Sbjct  12   DRDVEQAIIALKKGSQLLKYGRRGRPKFAPFRLSNDETTLIWFSGRKERQLRLDAVTKII  71

Query  314  HGQQTKQLQ----PERESQCISLVYANG--QRSLDLICKDKMQAESWFLGLRAVISSSHH  475
             GQ+T   Q    PE+E Q  SL+Y +G  +RSLDLICKDK +AE WF+GL+A +SS+  
Sbjct  72   PGQRTANFQRYPRPEKEYQSFSLIYGSGGEERSLDLICKDKDEAEVWFVGLKARVSSN--  129

Query  476  KRFLGTPKSKRGVQSCISSPASYMRRRQNLGLY  574
             R L       G  S ++SP     R   L  Y
Sbjct  130  -RTLKVDNKSEGTLSDVNSPLGRALRDSPLNSY  161



>emb|CBI40156.3| unnamed protein product [Vitis vinifera]
Length=905

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 100/142 (70%), Gaps = 8/142 (6%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI+ALKKGAHLLKY R GKPKFCPFRLS DE  LIW SG++EK L+LS V+ II GQ+T 
Sbjct  19   AIIALKKGAHLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEEKRLKLSHVSRIIPGQRTP  78

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y +  RSLDLICKDK +AE W  GL+A+IS  HH++  G  +
Sbjct  79   IFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWLTGLKALISRGHHQK--GRTE  134

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S+ GV S  +SP ++ +R   L
Sbjct  135  SRSGVSSEANSPRTHTQRSSPL  156



>emb|CDX85690.1| BnaA02g01230D [Brassica napus]
Length=1070

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 102/148 (69%), Gaps = 7/148 (5%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EK L+LS V+ II
Sbjct  12   ERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKRLKLSHVSRII  71

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+Y+  +RSLD+ICKDK +AE WF GL+A+I S   +R
Sbjct  72   SGQRTPIFQRYPRPEKEYQSFSLIYS--ERSLDVICKDKDEAEVWFSGLKALI-SHFRQR  128

Query  482  FLGTPKSKRGVQSCISSPASYMRRRQNL  565
               T     G  S  +SP +Y RR   L
Sbjct  129  TRRTESRSDGTPSEANSPMTYTRRSSPL  156



>emb|CDM86514.1| unnamed protein product [Triticum aestivum]
Length=1089

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHLRLS V+ I+
Sbjct  20   ERDLEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIM  79

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+  +  RSLD+ICKDK +AE WF GL+ +IS SH ++
Sbjct  80   PGQRTAIFQRYPRPEKECQSFSLISHD--RSLDIICKDKDEAEVWFAGLKTLISRSHQRK  137

Query  482  FLGTPKSKRGVQSCISSPASYMRR  553
            +    +S   + S  +SP ++ R+
Sbjct  138  WRTGSRSDT-ISSAATSPRTFTRQ  160



>emb|CAC42896.1| putative protein [Arabidopsis thaliana]
Length=1062

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 6/155 (4%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M       G  +R +EQAI+ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG +EK
Sbjct  1    MASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEK  60

Query  281  HLRLSSVTNIIHGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
            HL+LS V+ II GQ+T+  +PE+E Q  SL+Y+  +RSLD+   DK +AE WF GL+A+I
Sbjct  61   HLKLSHVSRIISGQRTRYPRPEKEYQSFSLIYS--ERSLDV---DKDEAEVWFTGLKALI  115

Query  461  SSSHHKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            S   H+R   T     G  S  +SP +Y RR   L
Sbjct  116  SHC-HQRNRRTESRSDGTPSEANSPRTYTRRSSPL  149



>ref|XP_008221643.1| PREDICTED: uncharacterized protein LOC103321597 [Prunus mume]
Length=1031

 Score =   151 bits (381),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 6/124 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EKHL+LS V+
Sbjct  8    GPVERDIEQAITALKKGATLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHLKLSHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A++S  +
Sbjct  68   TIIPGQRTAIFQRYPRPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALVSRGN  125

Query  473  HKRF  484
            ++ +
Sbjct  126  YRNW  129



>emb|CDY13998.1| BnaC09g38280D [Brassica napus]
Length=1116

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 7/142 (5%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            A+ ALK GA+LLKY R GKPKFCPFRLS DE  LIW+SG++EKHL+LS V+ II GQ+T 
Sbjct  35   AVTALKMGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRTP  94

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y   +RSLDLICKDK +A+ WF GL+AVIS  H +RF    +
Sbjct  95   IFQRCPRPEKEYQSFSLIY--DERSLDLICKDKDEAQVWFTGLKAVISRCHQRRFRTDSR  152

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S     S  +SP +Y RR   L
Sbjct  153  SDE-TPSEANSPRTYTRRSSPL  173



>ref|XP_002991915.1| hypothetical protein SELMODRAFT_430200, partial [Selaginella 
moellendorffii]
 gb|EFJ07026.1| hypothetical protein SELMODRAFT_430200, partial [Selaginella 
moellendorffii]
Length=253

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 96/146 (66%), Gaps = 12/146 (8%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            GA +R +EQ       GA LLKY R GKPKFCPFRLS DE  LIWYSG++EK LRLSS+T
Sbjct  8    GAVERDIEQ-------GAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSIT  60

Query  305  NIIHGQQTKQLQP----ERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T   Q     E+E Q  SL+Y N  RSLDLICKDK +AE WF+GL+A++S   
Sbjct  61   RIVPGQRTANFQRYPRLEKEYQSFSLIYGN-DRSLDLICKDKDEAEVWFVGLKALVSGGQ  119

Query  473  HKRFLGTPKSKRGVQSCISSPASYMR  550
              R     +S+ G  S  +SPA++ R
Sbjct  120  LSRLRFDSRSECGPPSDSNSPATWSR  145



>ref|XP_007224988.1| hypothetical protein PRUPE_ppa020628mg [Prunus persica]
 gb|EMJ26187.1| hypothetical protein PRUPE_ppa020628mg [Prunus persica]
Length=1031

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 6/124 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R +EQAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EKHL+LS V+
Sbjct  8    GPVERDIEQAITALKKGATLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHLKLSHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A++S  +
Sbjct  68   TIIPGQRTAIFQRYPRPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKALMSRGN  125

Query  473  HKRF  484
            ++ +
Sbjct  126  YRNW  129



>ref|XP_002511559.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF52161.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1028

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 104/155 (67%), Gaps = 12/155 (8%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M +  L   +  R + QAI A+KKGA+LLKY R GKPKFCPFRLS DE+FLIWY+G+ EK
Sbjct  1    MADNTLRTSSPGRDILQAITAIKKGAYLLKYGRWGKPKFCPFRLSNDERFLIWYAGKLEK  60

Query  281  HLRLSSVTNIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             L+LS V+ I+ GQ T       QPE+E Q  SL+Y+N  RSLD+ICKDK++AE W + L
Sbjct  61   QLKLSHVSKIMPGQHTAIFQRYPQPEKEYQSFSLIYSN--RSLDVICKDKVEAEVWIVAL  118

Query  449  RAVISSSHHKRFLGTPKSKRGVQSCISSPASYMRR  553
            RA+IS +   + +G P      QS  +SP S+ R+
Sbjct  119  RALISQNSCCKRIGDP------QSDANSPRSHARK  147



>ref|XP_004966829.1| PREDICTED: uncharacterized protein LOC101764879 [Setaria italica]
Length=1010

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 94/133 (71%), Gaps = 6/133 (5%)
 Frame = +2

Query  101  MGEQFLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEK  280
            M  +F+  G  DR VEQAI  LKKG HLLKY R GKPKFCPF+LS DE  LIWY+G  EK
Sbjct  1    MASEFMKNGPFDRDVEQAITGLKKGTHLLKYGRRGKPKFCPFKLSNDETVLIWYTGRVEK  60

Query  281  HLRLSSVTNIIHGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGL  448
             LRL+ V+ II GQ+T       +P++E Q  SL+Y  G RSLDLICKDK +AE+WF+ L
Sbjct  61   QLRLNQVSRIIPGQRTAIFLRYPRPDKEFQSFSLIY--GHRSLDLICKDKDEAEAWFVSL  118

Query  449  RAVISSSHHKRFL  487
            +A+IS  + +R++
Sbjct  119  KALISRWNCERWV  131



>ref|XP_007046139.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007046140.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 gb|EOY01971.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 gb|EOY01972.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
Length=1022

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 106/157 (68%), Gaps = 11/157 (7%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R ++QAI ALKKGA+LLKY R GKPKFCPF LS DE  LIWYSG++EKHL+LS V+
Sbjct  8    GLAERDIDQAITALKKGAYLLKYGRRGKPKFCPFHLSNDESKLIWYSGKEEKHLKLSQVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF+GL+ +IS   
Sbjct  68   RIIPGQRTAIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFIGLKGLISRGT  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNLGLYPMD  583
             +++    KS     + + SP   +R R+   + P D
Sbjct  126  TRKWRIEVKSD---SASLDSP--QLRNRKTSPISPFD  157



>ref|XP_009361965.1| PREDICTED: uncharacterized protein LOC103952146 [Pyrus x bretschneideri]
Length=1078

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R ++ AI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EK ++LS V 
Sbjct  15   GPLERDIDLAITALKKGAQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKCVKLSQVL  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T+  Q    PE+E Q  SL+  +  RSLDLICKDK +AE WF GL+A+IS   
Sbjct  75   RIVPGQRTQTFQRYPRPEKEYQSFSLICND--RSLDLICKDKDEAEVWFTGLKALISRGL  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H++  G P+S+ G+ S  +SP S+ ++   L
Sbjct  133  HQK--GRPESRSGITSEANSPRSHTQQSSPL  161



>ref|XP_010062134.1| PREDICTED: uncharacterized protein LOC104449612 [Eucalyptus grandis]
 gb|KCW69202.1| hypothetical protein EUGRSUZ_F02719 [Eucalyptus grandis]
Length=1129

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G +DR VEQA++ALKKGA LLKY R GKPKFCPFRLS DE  LIW S   EK L+L+SV+
Sbjct  8    GNADRDVEQALIALKKGAQLLKYGRKGKPKFCPFRLSSDESSLIWVSSSGEKSLKLASVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    + L+PE++    SL+Y NG+RSLDLICKDK++AE W  GL+A+IS+  
Sbjct  68   RIIPGQRTAVFRRYLRPEKDYLSFSLIYKNGKRSLDLICKDKVEAEVWIAGLKALISTGQ  127

Query  473  HKR  481
              R
Sbjct  128  GGR  130



>ref|XP_007221066.1| hypothetical protein PRUPE_ppa016519mg, partial [Prunus persica]
 gb|EMJ22265.1| hypothetical protein PRUPE_ppa016519mg, partial [Prunus persica]
Length=1061

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EK+++LS V+ II GQ+T+
Sbjct  1    AITALKKGAQLLKYGRRGKPKFCPFRLSNDESSLIWYSGKEEKYVKLSHVSRIIPGQRTQ  60

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS   H++  G  +
Sbjct  61   TFQRYPRPEKEYQSFSLMYND--RSLDLICKDKDEAEVWFTGLKALISRGLHQK--GRAE  116

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S+ GV S  +SP S+ +R   L
Sbjct  117  SRSGVTSEANSPRSHTQRSSPL  138



>ref|XP_008389492.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Malus domestica]
Length=1031

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 9/147 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R ++QAI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EKHL+L  V+
Sbjct  8    GPVERDIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKHLKLCHVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+I+  +
Sbjct  68   TIIPGQRTAIFQRYPRPEKEYQSFSLLYND--RSLDLICKDKDEAEVWFVGLKAIITRGN  125

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRR  553
            ++ +       R   + I SP +  RR
Sbjct  126  YRNWR---SESRLEGTSIDSPHARTRR  149



>ref|XP_008347000.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Malus domestica]
Length=709

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +2

Query  152  AIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQTK  331
            AI +LKKGA LLKY R GKPKFCPFRLS DE  LIWYSG++EK+L+LS V+ I+ GQ+T+
Sbjct  44   AITSLKKGAQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKYLKLSQVSRIVPGQRTQ  103

Query  332  QLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGTPK  499
              Q    PE+E Q  SL+  +  RSLDLICKDK +AE WF GL+A+IS   H++  G P+
Sbjct  104  TFQRYPRPEKEYQSFSLICBD--RSLDLICKDKDEAEVWFTGLKALISRGLHQK--GRPE  159

Query  500  SKRGVQSCISSPASYMRRRQNL  565
            S+ G+ S  +SP S+ ++   L
Sbjct  160  SRSGITSEANSPRSHTQQSSPL  181



>ref|XP_007153813.1| hypothetical protein PHAVU_003G066900g [Phaseolus vulgaris]
 gb|ESW25807.1| hypothetical protein PHAVU_003G066900g [Phaseolus vulgaris]
Length=900

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 9/144 (6%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R +EQAI  LKKG++LLKY R GKPKFCPFRLS DE  L+WYS ++EK L+LS+V+ II
Sbjct  11   ERDIEQAIAFLKKGSYLLKYGRRGKPKFCPFRLSNDESILLWYSDKEEKQLKLSTVSRII  70

Query  314  HGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF+GL+A+++ +++++
Sbjct  71   PGQRTATFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKEEAEIWFVGLKALVTRANNRK  128

Query  482  FLGTPKSKRGVQSCISSPASYMRR  553
            +    +S+     C  SP S  RR
Sbjct  129  WF---ESRTDDSHCSDSPKSSTRR  149



>ref|XP_010247275.1| PREDICTED: uncharacterized protein LOC104590345 [Nelumbo nucifera]
Length=1135

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R VEQA+VALKKGA LLKY R GKPKFCPFRLS DE  LIW+S   EK L+L+SV+
Sbjct  8    GNVERDVEQALVALKKGAQLLKYGRKGKPKFCPFRLSNDESSLIWFSSGGEKKLKLASVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ T    + L+PE+E    SL+Y NG+RSLDLICKDK++AE W  GL+A+ISS+ 
Sbjct  68   KIVPGQGTSVFQRYLRPEKEYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKALISSNQ  127

Query  473  HKR  481
              R
Sbjct  128  CGR  130



>ref|XP_010937079.1| PREDICTED: uncharacterized protein LOC105056557 [Elaeis guineensis]
Length=1071

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  116  LAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLS  295
            L  G  +R VEQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIWYSG+ EK L+LS
Sbjct  5    LRNGPVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWYSGKDEKQLKLS  64

Query  296  SVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS  463
             V+ II GQ+T   Q    P++E Q  SL+Y +  RSLDLICKDK +AE WF+GL+A+IS
Sbjct  65   QVSKIIPGQRTAIFQRYPRPDKEYQSFSLIYND--RSLDLICKDKDEAEVWFVGLKALIS  122

Query  464  SSHHKRFLGTPKSKR  508
              + ++     KS R
Sbjct  123  RGNCRKLRLDSKSDR  137



>ref|XP_011075488.1| PREDICTED: uncharacterized protein LOC105159953 isoform X2 [Sesamum 
indicum]
Length=1031

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            P   DR ++QAI ALKKGAHLLKY R GKPKFCPFRLS DE  LIWY G+ EK L L  V
Sbjct  7    PSLVDRDIDQAITALKKGAHLLKYGRRGKPKFCPFRLSSDESTLIWYYGKDEKQLELRQV  66

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF GL+A+I+ +
Sbjct  67   SKIIPGQRTAIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFAGLKALIARA  124

Query  470  HHKR  481
            ++K+
Sbjct  125  NYKK  128



>ref|XP_008808052.1| PREDICTED: uncharacterized protein LOC103720223 [Phoenix dactylifera]
Length=1071

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 96/135 (71%), Gaps = 6/135 (4%)
 Frame = +2

Query  116  LAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLS  295
            L  G  +R VEQAI ALKKGA+LLKY R GKPKFCPFRL+ DE  LIWYSG+ EK L+LS
Sbjct  5    LRNGPVERDVEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWYSGKDEKQLKLS  64

Query  296  SVTNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS  463
             V+ II GQ+T   Q    P++E Q  SL+Y++  RSLDLICKDK +AE WF+GL+A+IS
Sbjct  65   QVSKIIPGQRTAIFQRYPRPDKEYQSFSLMYSD--RSLDLICKDKDEAEVWFVGLKALIS  122

Query  464  SSHHKRFLGTPKSKR  508
              + ++     KS R
Sbjct  123  RGNCRKLRLDSKSDR  137



>ref|XP_009411942.1| PREDICTED: uncharacterized protein LOC103993562 [Musa acuminata 
subsp. malaccensis]
Length=1105

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = +2

Query  113  FLAPGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRL  292
             L    +DR +++A++ALKKGA LLKY R GKPKFCPFRLS DE  LIW+SG  E+ L+L
Sbjct  4    LLGSANADRDIDKALIALKKGAQLLKYGRKGKPKFCPFRLSNDESTLIWFSGGGERTLKL  63

Query  293  SSVTNIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVI  460
            +SV  I+ GQ+T    + L+P+R+    SL+Y +G+RSLDLICKDK++AE WF GL+A+I
Sbjct  64   ASVLRIVPGQRTPVFQRYLRPDRDYLSFSLIYNDGKRSLDLICKDKVEAEVWFSGLKALI  123

Query  461  SSSHHKR  481
            S+  + R
Sbjct  124  STGQYGR  130



>ref|XP_011075486.1| PREDICTED: uncharacterized protein LOC105159953 isoform X1 [Sesamum 
indicum]
Length=1034

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            P   DR ++QAI ALKKGAHLLKY R GKPKFCPFRLS DE  LIWY G+ EK L L  V
Sbjct  7    PSLVDRDIDQAITALKKGAHLLKYGRRGKPKFCPFRLSSDESTLIWYYGKDEKQLELRQV  66

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF GL+A+I+ +
Sbjct  67   SKIIPGQRTAIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFAGLKALIARA  124

Query  470  HHKR  481
            ++K+
Sbjct  125  NYKK  128



>ref|XP_006279150.1| hypothetical protein CARUB_v100079710mg, partial [Capsella rubella]
 gb|EOA12048.1| hypothetical protein CARUB_v100079710mg, partial [Capsella rubella]
Length=135

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R ++QA+V LKKG  LLKYSR GKPKF  FRLS DEK LIW+S  +EK L+LS V+ II
Sbjct  12   ERDIDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLSEVSRII  71

Query  314  HGQQTKQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKR  481
             GQ+T+ L+PE++    SL+Y N +RSLDLICKDK + E WF GL+++I  S ++R
Sbjct  72   PGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAGLKSLIEKSRNRR  127



>ref|XP_011024953.1| PREDICTED: uncharacterized protein LOC105125966 isoform X1 [Populus 
euphratica]
Length=1104

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 103/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  146  EQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNIIHGQQ  325
            +QAI ALKKGA+LLKY R GKPKFCPFRLS DE  LIW+SG+++K L+LS V+ II GQ+
Sbjct  23   QQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEKKLLKLSDVSKIISGQR  82

Query  326  TKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSHHKRFLGT  493
            T   Q    PE+E Q  SL+Y +  RSLDLICKDK +AE+WF GL+A+IS S  +++   
Sbjct  83   TPIFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEAWFHGLKALISRSCPQKWRTE  140

Query  494  PKSKRGVQSCISSPASYMRRRQNL  565
             +S  G+ S ++SP +Y RR   L
Sbjct  141  SRSD-GILSEVNSPRTYTRRSSPL  163



>ref|XP_002522401.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF39893.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1042

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 108/151 (72%), Gaps = 12/151 (8%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R +EQAI +LKKGA+LLKY R GKPKFCPF+LS DE  LIWYSG++EK L+LS V+
Sbjct  8    GLAERDIEQAITSLKKGAYLLKYGRRGKPKFCPFQLSSDESMLIWYSGKEEKQLKLSQVS  67

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS-SS  469
             II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE WF+GL+A+I+  S
Sbjct  68   KIIPGQRTAIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEVWFVGLKALITRGS  125

Query  470  HHKRFLGTPKSKRGVQSCISSPASYMRRRQN  562
            +  ++   P+S+       SS + ++R R++
Sbjct  126  YQSKWRIEPRSES-----TSSDSPHIRTRRH  151



>ref|XP_008348288.1| PREDICTED: uncharacterized protein LOC103411430 [Malus domestica]
Length=1078

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R ++ AI ALKKGA LLKY R GKPKFCPFRLS DE  LIWYSG +EK+++L+ V+
Sbjct  15   GPLERDIDLAITALKKGAQLLKYGRRGKPKFCPFRLSNDESXLIWYSGXEEKYVKLTQVS  74

Query  305  NIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             I+ GQ+T+  Q    PE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+IS   
Sbjct  75   RIVPGQRTQTFQRYPRPEKEYQSFSLIYND--RSLDLICKDKDEAEVWFTGLKALISRGL  132

Query  473  HKRFLGTPKSKRGVQSCISSPASYMRRRQNL  565
            H++     +S+ GV S  +SP S+ ++   L
Sbjct  133  HQKRRA--ESRSGVTSEANSPRSHTQQSSPL  161



>ref|XP_010227829.1| PREDICTED: uncharacterized protein LOC100836916 [Brachypodium 
distachyon]
Length=261

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 6/114 (5%)
 Frame = +2

Query  134  DRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVTNII  313
            +R VEQAI ALKKG HLLKY R GKPKFC FRLS DE  LIWYSG  EK L L  V+ II
Sbjct  83   ERDVEQAIAALKKGTHLLKYGRRGKPKFCLFRLSNDETMLIWYSGRMEKQLNLIQVSKII  142

Query  314  HGQQTKQL----QPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVIS  463
             GQ+T       +P++E Q  SL+Y  GQRSLDLICKDK +AE+WF+GL+A+IS
Sbjct  143  PGQRTAIFLRYPRPDKEYQSFSLIY--GQRSLDLICKDKDEAEAWFVGLKALIS  194



>gb|KCW51717.1| hypothetical protein EUGRSUZ_J01184 [Eucalyptus grandis]
Length=1075

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 100/141 (71%), Gaps = 8/141 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R VE AI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW SG++EKHL+++ ++
Sbjct  16   GPLERDVELAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHIS  75

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    +  QPE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+I+  +
Sbjct  76   KIIPGQRTPIFQRYPQPEKEYQSFSLIYDD--RSLDLICKDKDEAEVWFTGLKALITRRN  133

Query  473  HKRFLGTPKSKRGVQSCISSP  535
            H++  G   S+ GV S  +SP
Sbjct  134  HQKVRG--GSRSGVSSEATSP  152



>emb|CBI35500.3| unnamed protein product [Vitis vinifera]
Length=910

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R VEQA++ALKKGA LLKY R GKPKFCPFRLS DE  LIW S   E+ L+L+SV+
Sbjct  8    GNAERDVEQALIALKKGAQLLKYGRKGKPKFCPFRLSNDESSLIWISSSGERILKLASVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    + L+PE++    SL+Y NG+RSLDLICKDK++AE W  GL+A+ISS  
Sbjct  68   RIIPGQRTAVFQRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKALISSGQ  127

Query  473  HKR  481
              R
Sbjct  128  GGR  130



>ref|XP_010032304.1| PREDICTED: uncharacterized protein LOC104421870 isoform X3 [Eucalyptus 
grandis]
Length=1098

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 100/141 (71%), Gaps = 8/141 (6%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  +R VE AI ALKKGA LLKY R GKPKFCPFRL+ DE  LIW SG++EKHL+++ ++
Sbjct  16   GPLERDVELAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHIS  75

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    +  QPE+E Q  SL+Y +  RSLDLICKDK +AE WF GL+A+I+  +
Sbjct  76   KIIPGQRTPIFQRYPQPEKEYQSFSLIYDD--RSLDLICKDKDEAEVWFTGLKALITRRN  133

Query  473  HKRFLGTPKSKRGVQSCISSP  535
            H++  G   S+ GV S  +SP
Sbjct  134  HQKVRG--GSRSGVSSEATSP  152



>emb|CDO99240.1| unnamed protein product [Coffea canephora]
Length=1101

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G  DR +EQA++ALKKG  L+KYSR GKPKFCPFR+S DE  LIWYS   E+ L+LS+V 
Sbjct  8    GNPDRDIEQALIALKKGTQLIKYSRKGKPKFCPFRVSPDETTLIWYSHGSERILKLSTVQ  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    + L+PE+E    SL+Y NG+RSLDLICKDK +AE W  GL+A+ S+SH
Sbjct  68   RIIPGQRTPVFRRFLRPEKEYLSFSLIYNNGERSLDLICKDKAEAEVWIAGLKALTSTSH  127



>gb|KDP43019.1| hypothetical protein JCGZ_25205 [Jatropha curcas]
Length=1115

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +2

Query  125  GASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSVT  304
            G ++R +EQA++ALKKGA LLKY R GKPKFCPFRLS DE  LIW S   E+ L+L+SV+
Sbjct  8    GNAERDIEQALIALKKGAQLLKYGRKGKPKFCPFRLSNDETTLIWISSSGERSLKLASVS  67

Query  305  NIIHGQQT----KQLQPERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSSH  472
             II GQ+T    + L+PE++    SL+Y NG+RSLDLICKDK++AE W  GL+A+ISS  
Sbjct  68   KIIPGQRTAVFQRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKALISSGQ  127

Query  473  HKR  481
              R
Sbjct  128  GGR  130



>gb|EYU28734.1| hypothetical protein MIMGU_mgv1a000772mg [Erythranthe guttata]
Length=990

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  122  PGASDRAVEQAIVALKKGAHLLKYSRMGKPKFCPFRLSQDEKFLIWYSGEKEKHLRLSSV  301
            P   +R ++QAI ALKKGAHLLKY R GKPKFCPFRLS DE  LIWY G+ EK L L  V
Sbjct  7    PSLVERDIDQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESTLIWYYGKDEKQLELRQV  66

Query  302  TNIIHGQQTKQLQ----PERESQCISLVYANGQRSLDLICKDKMQAESWFLGLRAVISSS  469
            + II GQ+T   Q    PE+E Q  SL+Y++  RSLDLICKDK +AE+WF+GL+A+I+  
Sbjct  67   SRIIPGQRTSIFQRYPRPEKEYQSFSLIYSD--RSLDLICKDKDEAEAWFVGLKALIARG  124

Query  470  HHKR  481
             +K+
Sbjct  125  SYKK  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1851063916768