BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13805_g1_i1 len=1264 path=[1:0-500 502:501-1263]

Length=1264
                                                                      Score     E

ref|XP_009768067.1|  PREDICTED: crocetin glucoside glucosyltransf...    540   0.0      
ref|XP_009608408.1|  PREDICTED: crocetin glucoside glucosyltransf...    528   0.0      
ref|XP_006355167.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    525   0.0      
ref|XP_010318090.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    523   4e-180   
ref|XP_009775018.1|  PREDICTED: crocetin glucoside glucosyltransf...    474   6e-161   
ref|XP_010649358.1|  PREDICTED: crocetin glucoside glucosyltransf...    443   5e-149   
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    441   3e-148   
ref|XP_002271587.2|  PREDICTED: crocetin glucoside glucosyltransf...    440   5e-148   Vitis vinifera
ref|XP_010658725.1|  PREDICTED: crocetin glucoside glucosyltransf...    437   6e-147   
ref|XP_006367679.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    437   7e-147   
ref|XP_010034308.1|  PREDICTED: crocetin glucoside glucosyltransf...    437   9e-147   
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    437   9e-147   
ref|XP_011076907.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    438   1e-146   
ref|XP_009593691.1|  PREDICTED: crocetin glucoside glucosyltransf...    436   2e-146   
dbj|BAF99027.1|  UDP-glucose:sesaminol 2'-O-glucoside-O-glucosylt...    437   2e-146   Sesamum indicum [beniseed]
ref|XP_002264771.2|  PREDICTED: crocetin glucoside glucosyltransf...    431   2e-144   Vitis vinifera
ref|XP_004249996.1|  PREDICTED: crocetin glucoside glucosyltransf...    431   3e-144   
ref|XP_002523035.1|  glucosyl/glucuronosyl transferases, putative       428   1e-143   Ricinus communis
ref|XP_009775013.1|  PREDICTED: crocetin glucoside glucosyltransf...    429   1e-143   
ref|XP_004250486.1|  PREDICTED: crocetin glucoside glucosyltransf...    428   2e-143   
gb|KCW51492.1|  hypothetical protein EUGRSUZ_J01008                     426   6e-143   
ref|XP_008231982.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    427   9e-143   
ref|XP_010032098.1|  PREDICTED: crocetin glucoside glucosyltransf...    427   9e-143   
ref|XP_009770958.1|  PREDICTED: crocetin glucoside glucosyltransf...    425   4e-142   
ref|XP_008375610.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    425   8e-142   
ref|XP_010034306.1|  PREDICTED: crocetin glucoside glucosyltransf...    424   1e-141   
ref|XP_011094502.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    422   8e-141   
ref|XP_008231997.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    421   2e-140   
ref|XP_007220462.1|  hypothetical protein PRUPE_ppa005532mg             421   2e-140   
ref|XP_006342241.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    420   5e-140   
ref|XP_007220458.1|  hypothetical protein PRUPE_ppa005471mg             420   6e-140   
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...    419   7e-140   
gb|KCW51498.1|  hypothetical protein EUGRSUZ_J01015                     419   7e-140   
ref|XP_010034309.1|  PREDICTED: crocetin glucoside glucosyltransf...    419   9e-140   
ref|XP_008231988.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    418   2e-139   
ref|XP_007219141.1|  hypothetical protein PRUPE_ppa016015mg             416   1e-138   
ref|XP_009604940.1|  PREDICTED: crocetin glucoside glucosyltransf...    415   4e-138   
ref|XP_008231983.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    415   5e-138   
ref|XP_006360518.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    414   6e-138   
ref|XP_009596289.1|  PREDICTED: crocetin glucoside glucosyltransf...    414   1e-137   
gb|KCW53337.1|  hypothetical protein EUGRSUZ_J02585                     413   2e-137   
ref|XP_010033637.1|  PREDICTED: crocetin glucoside glucosyltransf...    413   2e-137   
ref|XP_010248422.1|  PREDICTED: crocetin glucoside glucosyltransf...    416   2e-137   
ref|XP_009795814.1|  PREDICTED: crocetin glucoside glucosyltransf...    412   4e-137   
ref|XP_004244816.1|  PREDICTED: crocetin glucoside glucosyltransf...    412   6e-137   
ref|XP_009623061.1|  PREDICTED: crocetin glucoside glucosyltransf...    408   9e-137   
ref|XP_009601673.1|  PREDICTED: crocetin glucoside glucosyltransf...    412   9e-137   
gb|EYU19795.1|  hypothetical protein MIMGU_mgv1a019121mg                412   2e-136   
ref|XP_009337015.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    410   4e-136   
gb|KCW51493.1|  hypothetical protein EUGRSUZ_J01009                     408   6e-136   
ref|XP_006352206.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    409   8e-136   
emb|CDP00191.1|  unnamed protein product                                408   2e-135   
ref|XP_004238624.1|  PREDICTED: crocetin glucoside glucosyltransf...    407   4e-135   
ref|XP_008344515.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    407   5e-135   
ref|XP_008345539.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    406   1e-134   
ref|XP_009796593.1|  PREDICTED: crocetin glucoside glucosyltransf...    406   2e-134   
emb|CDO99874.1|  unnamed protein product                                406   2e-134   
ref|XP_010658726.1|  PREDICTED: crocetin glucoside glucosyltransf...    404   3e-134   
ref|XP_007220461.1|  hypothetical protein PRUPE_ppa005526mg             405   3e-134   
emb|CDO99872.1|  unnamed protein product                                405   4e-134   
ref|XP_010032103.1|  PREDICTED: crocetin glucoside glucosyltransf...    404   1e-133   
ref|XP_008345567.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    404   2e-133   
ref|XP_007218014.1|  hypothetical protein PRUPE_ppa005830mg             402   4e-133   
gb|KCW51489.1|  hypothetical protein EUGRSUZ_J01005                     400   3e-132   
ref|XP_009335994.1|  PREDICTED: crocetin glucoside glucosyltransf...    400   3e-132   
ref|XP_008231995.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    399   5e-132   
ref|XP_008375609.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    399   6e-132   
ref|XP_008231981.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    399   9e-132   
ref|XP_008344699.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    399   1e-131   
gb|AHZ30598.1|  ufgt                                                    395   1e-130   
gb|AEJ88222.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase           396   1e-130   
gb|EYU31926.1|  hypothetical protein MIMGU_mgv1a021717mg                396   1e-130   
ref|XP_004250481.1|  PREDICTED: crocetin glucoside glucosyltransf...    396   1e-130   
ref|XP_009336996.1|  PREDICTED: crocetin glucoside glucosyltransf...    396   2e-130   
ref|XP_007220460.1|  hypothetical protein PRUPE_ppa005520mg             395   4e-130   
ref|XP_010327003.1|  PREDICTED: crocetin glucoside glucosyltransf...    394   6e-130   
ref|XP_010110161.1|  Cyanidin-3-O-glucoside 2-O-glucuronosyltrans...    394   1e-129   
ref|XP_009337016.1|  PREDICTED: crocetin glucoside glucosyltransf...    393   2e-129   
ref|XP_010525697.1|  PREDICTED: crocetin glucoside glucosyltransf...    392   5e-129   
ref|XP_002270285.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    392   5e-129   Vitis vinifera
ref|XP_009793442.1|  PREDICTED: crocetin glucoside glucosyltransf...    388   2e-127   
ref|XP_009609108.1|  PREDICTED: crocetin glucoside glucosyltransf...    387   2e-127   
ref|XP_006367683.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    386   1e-126   
gb|KCW51496.1|  hypothetical protein EUGRSUZ_J01013                     385   1e-126   
dbj|BAG80557.1|  UDP-glucose:glucosyltransferase                        385   2e-126   Lycium barbarum [goji berry]
ref|XP_009775011.1|  PREDICTED: crocetin glucoside glucosyltransf...    384   4e-126   
ref|XP_009616666.1|  PREDICTED: crocetin glucoside glucosyltransf...    384   7e-126   
ref|XP_006367680.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    383   1e-125   
ref|XP_004249995.1|  PREDICTED: crocetin glucoside glucosyltransf...    383   2e-125   
ref|XP_009763810.1|  PREDICTED: crocetin glucoside glucosyltransf...    381   6e-125   
sp|F8WKW8.1|UGT9_GARJA  RecName: Full=Beta-D-glucosyl crocetin be...    381   7e-125   
dbj|BAO51835.1|  UDP-glycosyltransferase 94P1                           380   2e-124   
ref|XP_004250482.1|  PREDICTED: crocetin glucoside glucosyltransf...    379   3e-124   
ref|XP_006367533.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    379   4e-124   
ref|XP_006436669.1|  hypothetical protein CICLE_v10033610mg             377   1e-123   
ref|XP_009593727.1|  PREDICTED: crocetin glucoside glucosyltransf...    379   2e-123   
ref|XP_004234916.1|  PREDICTED: crocetin glucoside glucosyltransf...    377   4e-123   
ref|XP_006363504.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    376   5e-123   
ref|XP_004250485.1|  PREDICTED: crocetin glucoside glucosyltransf...    376   7e-123   
ref|XP_004249992.1|  PREDICTED: crocetin glucoside glucosyltransf...    376   9e-123   
ref|XP_006361192.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    375   1e-122   
ref|XP_010034307.1|  PREDICTED: crocetin glucoside glucosyltransf...    374   2e-122   
gb|AFK79036.1|  glycosyltransferase UGT4                                374   4e-122   
ref|XP_006367682.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    373   1e-121   
ref|XP_004250484.1|  PREDICTED: crocetin glucoside glucosyltransf...    372   2e-121   
emb|CDP13368.1|  unnamed protein product                                371   2e-121   
ref|XP_006367681.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    370   1e-120   
ref|XP_006436664.1|  hypothetical protein CICLE_v10033373mg             370   1e-120   
ref|XP_011075272.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    365   2e-118   
gb|AGR44632.1|  UDP-glucosyltransferase 94B1                            364   2e-118   
emb|CDO99873.1|  unnamed protein product                                364   3e-118   
ref|XP_004238697.1|  PREDICTED: crocetin glucoside glucosyltransf...    363   4e-118   
dbj|BAG80553.1|  UDP-glucose:glucosyltransferase                        363   1e-117   Lycium barbarum [goji berry]
dbj|BAH80312.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    361   4e-117   Catharanthus roseus [chatas]
gb|AFJ53042.1|  UDP-glycosyltransferase 1                               361   1e-116   
ref|XP_011076906.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    358   6e-116   
gb|AED99884.1|  glycosyltransferase                                     356   5e-115   
ref|XP_008456584.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    358   5e-115   
ref|XP_011084223.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    355   6e-115   
emb|CDP06965.1|  unnamed protein product                                355   6e-115   
ref|XP_011084222.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    355   6e-115   
gb|EYU18697.1|  hypothetical protein MIMGU_mgv1a006194mg                355   7e-115   
ref|XP_006351221.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    354   5e-114   
ref|XP_011032816.1|  PREDICTED: crocetin glucoside glucosyltransf...    352   2e-113   
gb|EYU39888.1|  hypothetical protein MIMGU_mgv1a022198mg                352   2e-113   
dbj|BAH80313.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    350   2e-112   Catharanthus roseus [chatas]
ref|XP_011090910.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    350   2e-112   
ref|XP_011032817.1|  PREDICTED: crocetin glucoside glucosyltransf...    347   7e-112   
ref|XP_011090911.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    348   9e-112   
ref|XP_011090843.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    347   3e-111   
dbj|BAM28984.1|  UDP-glucose glucosyltransferase                        345   1e-110   
ref|XP_004140986.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    345   3e-110   
gb|AGO03777.1|  non-smoky glycosyltransferase 1                         342   1e-109   
gb|EYU38052.1|  hypothetical protein MIMGU_mgv1a019912mg                343   1e-109   
ref|XP_009416699.1|  PREDICTED: crocetin glucoside glucosyltransf...    343   2e-109   
gb|KCW51491.1|  hypothetical protein EUGRSUZ_J01007                     340   3e-109   
ref|XP_006365665.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    340   4e-109   
ref|XP_004243636.1|  PREDICTED: crocetin glucoside glucosyltransf...    340   5e-109   
emb|CDP12002.1|  unnamed protein product                                340   2e-108   
gb|EYU43900.1|  hypothetical protein MIMGU_mgv1a026213mg                337   2e-107   
dbj|BAI44134.1|  flavonoid glycosyltransferase UGT94C2                  335   6e-107   Veronica persica [bird-eye speedwell]
emb|CDP12003.1|  unnamed protein product                                335   6e-107   
emb|CDP17151.1|  unnamed protein product                                335   1e-106   
ref|XP_011090909.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    334   1e-106   
gb|EPS69530.1|  hypothetical protein M569_05234                         333   1e-106   
gb|AFK79037.1|  glycosyltransferase UGT5                                333   3e-106   
ref|XP_006354527.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    332   1e-105   
ref|XP_009775012.1|  PREDICTED: crocetin glucoside glucosyltransf...    332   2e-105   
ref|XP_011090908.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    330   8e-105   
gb|EYU43902.1|  hypothetical protein MIMGU_mgv1a020418mg                327   9e-104   
emb|CDP05516.1|  unnamed protein product                                326   1e-103   
ref|XP_006851566.1|  hypothetical protein AMTR_s00040p00192700          327   1e-103   
ref|XP_006342776.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    327   2e-103   
gb|EPS70317.1|  hypothetical protein M569_04444                         323   2e-103   
ref|XP_011071476.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    326   2e-103   
emb|CDP11999.1|  unnamed protein product                                326   3e-103   
gb|EYU18696.1|  hypothetical protein MIMGU_mgv1a006481mg                325   4e-103   
gb|AGP25113.1|  uridine diphosphate glycosyltransferase                 325   6e-103   
gb|EPS60299.1|  hypothetical protein M569_14508                         321   1e-102   
gb|KDO39400.1|  hypothetical protein CISIN_1g038300mg                   322   1e-102   
gb|ADW20351.1|  putative branch-forming glycosyltransferase             324   1e-102   
gb|AGO03779.1|  non-smoky glycosyltransferase 2                         323   3e-102   
ref|XP_006424313.1|  hypothetical protein CICLE_v10030271mg             323   4e-102   
ref|XP_008449848.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    323   4e-102   
dbj|BAI44133.1|  flavonoid glycosyltransferase UGT94F1                  322   5e-102   Veronica persica [bird-eye speedwell]
ref|XP_009630066.1|  PREDICTED: crocetin glucoside glucosyltransf...    325   6e-102   
ref|XP_011071477.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    322   7e-102   
ref|XP_004229306.1|  PREDICTED: crocetin glucoside glucosyltransf...    322   1e-101   
ref|XP_004142254.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    321   1e-101   
ref|XP_004162020.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    320   3e-101   
gb|KGN54053.1|  UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltr...    320   4e-101   
ref|XP_010321591.1|  PREDICTED: crocetin glucoside glucosyltransf...    320   5e-101   
gb|AGA84058.1|  UDP-glucosyltransferase isoform 2                       321   6e-101   
ref|XP_004142256.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    318   2e-100   
emb|CDO99875.1|  unnamed protein product                                313   2e-100   
gb|EYU45578.1|  hypothetical protein MIMGU_mgv1a007199mg                317   4e-100   
ref|XP_004142255.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    315   4e-99    
gb|KGN54052.1|  hypothetical protein Csa_4G279810                       315   4e-99    
gb|AFJ53038.1|  UDP-glycosyltransferase 1                               315   8e-99    
gb|EYU43901.1|  hypothetical protein MIMGU_mgv1a020989mg                315   1e-98    
gb|AFJ53039.1|  UDP-glycosyltransferase 1                               313   3e-98    
gb|AFJ53040.1|  UDP-glycosyltransferase 1                               313   3e-98    
ref|XP_009803961.1|  PREDICTED: crocetin glucoside glucosyltransf...    312   5e-98    
ref|XP_011091058.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    310   2e-97    
gb|KDO51358.1|  hypothetical protein CISIN_1g046033mg                   309   4e-97    
sp|Q8GVE3.2|FLRT_CITMA  RecName: Full=Flavanone 7-O-glucoside 2''...    310   4e-97    Citrus maxima [buntan]
gb|ACX70154.1|  1,2 rhamnosyltransferase                                309   9e-97    Citrus maxima [buntan]
gb|AFB73772.1|  1,2 rhamnosyltransferase                                308   3e-96    
gb|EPS71335.1|  hypothetical protein M569_03424                         307   3e-96    
gb|EYU45580.1|  hypothetical protein MIMGU_mgv1a021692mg                307   7e-96    
gb|EPS70316.1|  hypothetical protein M569_04443                         305   1e-95    
gb|EYU45579.1|  hypothetical protein MIMGU_mgv1a006511mg                306   1e-95    
gb|AFJ53037.1|  UDP-glycosyltransferase 1                               305   1e-95    
sp|Q5NTH0.1|UGAT_BELPE  RecName: Full=Cyanidin-3-O-glucoside 2-O-...    305   2e-95    Bellis perennis [English daisy]
ref|XP_010046728.1|  PREDICTED: crocetin glucoside glucosyltransf...    303   3e-95    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      306   6e-95    
ref|XP_009589204.1|  PREDICTED: crocetin glucoside glucosyltransf...    303   2e-94    
ref|XP_008347175.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    297   2e-93    
ref|XP_009620256.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    300   3e-93    
gb|EPS71334.1|  glycosyltransferase                                     299   5e-93    
gb|EPS71672.1|  hypothetical protein M569_03087                         297   5e-92    
gb|EMT05942.1|  hypothetical protein F775_52247                         296   6e-92    
ref|XP_002311963.2|  hypothetical protein POPTR_0008s02520g             295   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011071677.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    296   1e-91    
ref|XP_008363249.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    292   2e-91    
ref|XP_008449847.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    295   2e-91    
dbj|BAK08326.1|  predicted protein                                      294   1e-90    
ref|XP_009774569.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    293   5e-90    
ref|XP_009802399.1|  PREDICTED: crocetin glucoside glucosyltransf...    288   6e-90    
ref|XP_004958654.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    291   1e-89    
gb|EAZ05102.1|  hypothetical protein OsI_27293                          290   2e-89    Oryza sativa Indica Group [Indian rice]
ref|NP_001060603.1|  Os07g0672700                                       290   5e-89    Oryza sativa Japonica Group [Japonica rice]
gb|EPS70318.1|  hypothetical protein M569_04442                         285   8e-89    
ref|XP_009804830.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    288   1e-88    
ref|XP_008670653.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    288   2e-88    
ref|XP_009793589.1|  PREDICTED: crocetin glucoside glucosyltransf...    281   1e-87    
ref|XP_004250483.1|  PREDICTED: crocetin glucoside glucosyltransf...    285   1e-87    
gb|AHK12771.1|  flavanone-O-beta-L-rhamnosyltransferase-like prot...    282   3e-86    
gb|EMS55799.1|  Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltra...    279   2e-85    
ref|NP_001147268.1|  anthocyanidin 3-O-glucosyltransferase              276   8e-84    Zea mays [maize]
tpg|DAA64088.1|  TPA: anthocyanidin 3-O-glucosyltransferase             276   9e-84    
gb|KCW87408.1|  hypothetical protein EUGRSUZ_B03886                     268   3e-82    
ref|XP_003559812.1|  PREDICTED: crocetin glucoside glucosyltransf...    270   3e-81    
ref|XP_006424314.1|  hypothetical protein CICLE_v10030045mg             261   7e-79    
ref|XP_002311964.1|  hypothetical protein POPTR_0008s02530g             249   7e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008366513.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    245   4e-74    
gb|AGO03780.1|  truncated non-smoky glycosyltransferase 2               246   1e-73    
ref|XP_010326752.1|  PREDICTED: crocetin glucoside glucosyltransf...    243   8e-73    
gb|AGO03778.1|  truncated non-smoky glycosyltransferase 1               243   8e-73    
emb|CDP19775.1|  unnamed protein product                                242   3e-72    
ref|XP_007219845.1|  hypothetical protein PRUPE_ppa027014mg             237   4e-72    
ref|XP_006471419.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    242   1e-71    
ref|XP_009627944.1|  PREDICTED: crocetin glucoside glucosyltransf...    236   5e-70    
gb|AFJ53041.1|  UDP-glycosyltransferase 1                               237   8e-70    
emb|CDP12000.1|  unnamed protein product                                234   2e-69    
gb|ABR16160.1|  unknown                                                 234   7e-68    Picea sitchensis
gb|ABR18376.1|  unknown                                                 232   8e-67    Picea sitchensis
ref|XP_002463370.1|  hypothetical protein SORBIDRAFT_02g042580          231   2e-66    Sorghum bicolor [broomcorn]
ref|XP_008344517.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    225   4e-66    
ref|XP_009620578.1|  PREDICTED: crocetin glucoside glucosyltransf...    219   2e-64    
emb|CBI37520.3|  unnamed protein product                                219   1e-63    
gb|ABR18123.1|  unknown                                                 221   1e-62    Picea sitchensis
emb|CBI40234.3|  unnamed protein product                                209   1e-60    
ref|XP_009767153.1|  PREDICTED: crocetin glucoside glucosyltransf...    211   2e-60    
gb|KDO54370.1|  hypothetical protein CISIN_1g044441mg                   211   2e-60    
ref|XP_006658957.1|  PREDICTED: LOW QUALITY PROTEIN: flavanone 7-...    213   3e-60    
ref|XP_011071660.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    207   6e-59    
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             209   4e-58    
gb|EPS66584.1|  hypothetical protein M569_08191                         207   5e-58    
ref|XP_004166802.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    201   1e-56    
ref|XP_010030919.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       203   3e-56    
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            202   1e-55    
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         201   2e-55    
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       201   2e-55    
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        200   4e-55    
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    201   4e-55    
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein        202   6e-55    
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    199   1e-54    
ref|XP_011020572.1|  PREDICTED: UDP-glycosyltransferase 91C1            199   2e-54    
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            199   2e-54    
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                198   2e-54    
gb|ABR16053.1|  unknown                                                 199   2e-54    Picea sitchensis
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            197   6e-54    
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                     196   1e-53    
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       196   1e-53    
ref|XP_002303861.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    196   2e-53    Populus trichocarpa [western balsam poplar]
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    196   3e-53    
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    195   3e-53    
ref|XP_004233155.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       195   4e-53    
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            195   4e-53    
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    195   4e-53    
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    195   5e-53    
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             194   5e-53    Populus trichocarpa [western balsam poplar]
ref|XP_004162019.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    189   2e-52    
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    193   2e-52    
emb|CDP01582.1|  unnamed protein product                                192   3e-52    
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            192   3e-52    
ref|XP_006426251.1|  hypothetical protein CICLE_v10025508mg             193   3e-52    
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   192   3e-52    
ref|XP_006466331.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       192   4e-52    
emb|CDP21084.1|  unnamed protein product                                192   4e-52    
ref|XP_006367824.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    191   4e-52    
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    192   4e-52    
gb|AES79436.2|  UDP-glucosyltransferase family protein                  191   5e-52    
ref|XP_007148436.1|  hypothetical protein PHAVU_006G208500g             192   7e-52    
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            191   1e-51    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    191   2e-51    
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         191   2e-51    
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    191   2e-51    
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  189   2e-51    
ref|XP_006353004.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       191   2e-51    
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       190   3e-51    
gb|KHN26937.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            189   4e-51    
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              191   4e-51    
emb|CDP01583.1|  unnamed protein product                                189   4e-51    
ref|XP_009795659.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       189   8e-51    
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    189   8e-51    
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  189   1e-50    
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    188   1e-50    
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       188   1e-50    
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     187   1e-50    
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        188   2e-50    
emb|CDP21820.1|  unnamed protein product                                187   2e-50    
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       187   3e-50    
dbj|BAC43110.1|  putative anthocyanidin-3-glucoside rhamnosyltran...    187   4e-50    
ref|NP_201358.1|  UDP-glycosyltransferase 91B1                          187   4e-50    
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    186   4e-50    
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    187   5e-50    
emb|CDP21083.1|  unnamed protein product                                186   6e-50    
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            187   7e-50    
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    186   8e-50    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    187   1e-49    
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         186   1e-49    
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       186   1e-49    
ref|XP_007148434.1|  hypothetical protein PHAVU_006G208300g             186   1e-49    
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein        186   1e-49    
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    185   1e-49    
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    186   2e-49    
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       184   2e-49    
emb|CDP01584.1|  unnamed protein product                                185   2e-49    
gb|EYU30925.1|  hypothetical protein MIMGU_mgv1a005472mg                185   3e-49    
gb|ACE87855.1|  UDP-glucosyltransferase                                 184   4e-49    
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    184   4e-49    
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             184   5e-49    
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         184   5e-49    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             184   5e-49    
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    184   6e-49    
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       184   6e-49    
gb|KHN26939.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            183   8e-49    
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               183   9e-49    
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1            184   1e-48    
ref|XP_007205156.1|  hypothetical protein PRUPE_ppa005394mg             183   1e-48    
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    183   1e-48    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    183   1e-48    
emb|CDP04856.1|  unnamed protein product                                183   1e-48    
dbj|BAJ89368.1|  predicted protein                                      183   1e-48    
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    183   1e-48    
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       182   1e-48    
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   182   1e-48    
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           183   2e-48    
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    182   2e-48    
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         182   3e-48    
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...    183   3e-48    
emb|CAN80742.1|  hypothetical protein VITISV_015059                     182   3e-48    
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       182   3e-48    
gb|KDP29778.1|  hypothetical protein JCGZ_18713                         182   3e-48    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          182   4e-48    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   4e-48    
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    182   4e-48    
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   6e-48    
ref|XP_002270294.1|  PREDICTED: UDP-glycosyltransferase 91A1            181   6e-48    
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             181   8e-48    
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       180   1e-47    
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             181   1e-47    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    180   1e-47    
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         180   1e-47    
emb|CDP00929.1|  unnamed protein product                                180   1e-47    
ref|XP_009615005.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       180   1e-47    
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    180   1e-47    
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   1e-47    
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     180   2e-47    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  180   2e-47    
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    179   2e-47    
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             180   2e-47    
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       180   2e-47    
ref|XP_007015923.1|  Uncharacterized protein TCM_041491                 178   2e-47    
gb|KDO51357.1|  hypothetical protein CISIN_1g042362mg                   175   2e-47    
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    180   2e-47    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          179   2e-47    
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    179   4e-47    
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    179   4e-47    
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             178   5e-47    
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                  177   5e-47    
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    179   5e-47    
ref|XP_007222833.1|  hypothetical protein PRUPE_ppa005106mg             179   5e-47    
ref|XP_008236324.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       178   6e-47    
ref|XP_009609569.1|  PREDICTED: crocetin glucoside glucosyltransf...    171   8e-47    
ref|XP_002459516.1|  hypothetical protein SORBIDRAFT_02g005940          178   8e-47    
ref|XP_002320817.1|  hypothetical protein POPTR_0014s08440g             178   8e-47    
gb|AIE12480.1|  UGT3                                                    178   9e-47    
gb|AFJ52931.1|  UDP-glycosyltransferase 1                               178   9e-47    
ref|XP_003591655.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    177   9e-47    
ref|XP_010111557.1|  Anthocyanidin 3-O-glucosyltransferase              178   1e-46    
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       178   1e-46    
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    177   1e-46    
ref|XP_002270260.1|  PREDICTED: UDP-glycosyltransferase 91A1            178   1e-46    
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            177   1e-46    
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    178   1e-46    
dbj|BAJ84800.1|  predicted protein                                      177   1e-46    
ref|XP_003564684.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    177   1e-46    
dbj|BAJ99561.1|  predicted protein                                      177   2e-46    
emb|CDO97382.1|  unnamed protein product                                177   2e-46    
ref|XP_009343124.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    177   2e-46    
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       177   2e-46    
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             176   2e-46    
ref|XP_002532389.1|  UDP-glucosyltransferase, putative                  176   2e-46    
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    176   3e-46    
ref|XP_003635105.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       177   3e-46    
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    176   3e-46    
dbj|BAC10994.1|  rhamnosyl transferase                                  176   3e-46    
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    176   3e-46    
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             176   3e-46    
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            176   4e-46    
ref|XP_008219240.1|  PREDICTED: UDP-glycosyltransferase 91C1            176   4e-46    
gb|ABO21818.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    176   4e-46    
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       176   4e-46    
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    176   4e-46    
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    176   4e-46    
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    176   4e-46    
ref|XP_009366540.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    176   5e-46    
ref|XP_008386125.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    176   5e-46    
gb|ABO21810.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    176   5e-46    
emb|CDP00928.1|  unnamed protein product                                176   6e-46    
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       176   7e-46    
ref|XP_007220939.1|  hypothetical protein PRUPE_ppa025376mg             176   7e-46    
gb|KHN06911.1|  UDP-glycosyltransferase 91A1                            175   7e-46    
gb|EYU42689.1|  hypothetical protein MIMGU_mgv1a018398mg                176   7e-46    
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       175   8e-46    
gb|KCW79477.1|  hypothetical protein EUGRSUZ_C00864                     175   8e-46    
ref|XP_010047534.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       175   9e-46    
ref|XP_010091274.1|  Anthocyanidin 3-O-glucosyltransferase              175   9e-46    
ref|XP_011036928.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    175   1e-45    
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       176   1e-45    
ref|XP_007206476.1|  hypothetical protein PRUPE_ppa019000mg             172   1e-45    
gb|AHL38585.1|  glycosyltransferase                                     179   1e-45    
gb|AFK35814.1|  unknown                                                 175   1e-45    
emb|CDX81291.1|  BnaC09g07020D                                          174   1e-45    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          175   1e-45    
ref|XP_006367560.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    174   1e-45    
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          175   2e-45    
ref|XP_002458816.1|  hypothetical protein SORBIDRAFT_03g040840          174   2e-45    
gb|AFO67249.1|  putative glucosyltransferase                            166   2e-45    
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       174   2e-45    
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    174   2e-45    
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    174   2e-45    
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       174   2e-45    
ref|XP_003551309.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       174   2e-45    
ref|NP_001240857.1|  soyasaponin III rhamnosyltransferase               174   2e-45    
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    174   2e-45    
ref|XP_006292848.1|  hypothetical protein CARUB_v10019108mg             174   2e-45    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    174   2e-45    
emb|CDP03925.1|  unnamed protein product                                174   2e-45    
ref|XP_003619124.1|  Anthocyanidin 3-O-glucosyltransferase              174   2e-45    
ref|XP_009351089.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       173   4e-45    
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    173   4e-45    
ref|XP_002532392.1|  UDP-glucosyltransferase, putative                  173   4e-45    
gb|ABO21830.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    173   4e-45    
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     172   5e-45    
gb|EAY86485.1|  hypothetical protein OsI_07863                          172   5e-45    
ref|XP_009376199.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    173   6e-45    
gb|ABO21809.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    173   6e-45    
ref|XP_009382171.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       173   6e-45    
ref|XP_007219064.1|  hypothetical protein PRUPE_ppa014698mg             167   6e-45    
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    173   7e-45    
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                     172   7e-45    
ref|XP_002463705.1|  hypothetical protein SORBIDRAFT_01g004570          173   7e-45    
ref|XP_010506988.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       172   8e-45    
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       172   8e-45    
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  172   8e-45    
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    172   9e-45    
ref|XP_010099555.1|  UDP-glycosyltransferase 91C1                       172   9e-45    
ref|XP_006346388.1|  PREDICTED: scopoletin glucosyltransferase-like     172   1e-44    
emb|CAA50376.1|  anthocyanin 3 glucoside: rhamnosyltransferase          172   1e-44    
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               172   2e-44    
ref|XP_002511902.1|  UDP-glucosyltransferase, putative                  172   2e-44    
ref|XP_008233032.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    171   2e-44    
ref|XP_010506987.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       172   2e-44    
ref|XP_008378602.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       172   2e-44    
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       173   2e-44    
ref|NP_001275524.1|  anthocyanidin 3-O-glucosyltransferase-like         171   2e-44    
ref|XP_004230759.1|  PREDICTED: scopoletin glucosyltransferase          171   3e-44    
ref|XP_010518639.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       171   3e-44    
ref|XP_010091273.1|  Anthocyanidin 3-O-glucosyltransferase              171   3e-44    
ref|XP_006836294.1|  hypothetical protein AMTR_s00092p00017910          171   3e-44    
ref|XP_010031469.1|  PREDICTED: crocetin glucoside glucosyltransf...    165   4e-44    
ref|XP_011092852.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       171   4e-44    
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    170   4e-44    
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    170   5e-44    
ref|XP_006493672.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       171   5e-44    
ref|XP_008362977.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    170   5e-44    
ref|XP_002463702.1|  hypothetical protein SORBIDRAFT_01g004560          171   6e-44    
gb|AGU14093.1|  UDP-glycosyltransferase                                 170   6e-44    
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       171   6e-44    
ref|XP_010431575.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       170   7e-44    
tpg|DAA56691.1|  TPA: anthocyanidin 3-O-glucosyltransferase             171   7e-44    
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             169   7e-44    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    170   8e-44    
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    169   1e-43    
ref|XP_006445992.1|  hypothetical protein CICLE_v10015045mg             170   1e-43    
ref|XP_004955765.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    169   1e-43    
gb|KEH32398.1|  UDP-glucosyltransferase family protein                  169   1e-43    
ref|XP_003593144.1|  Glucosyltransferase                                169   1e-43    
ref|XP_010419269.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       169   1e-43    
ref|XP_008342850.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       169   1e-43    
ref|XP_002458815.1|  hypothetical protein SORBIDRAFT_03g040830          169   1e-43    
dbj|BAK04512.1|  predicted protein                                      169   1e-43    
gb|EPS66323.1|  hypothetical protein M569_08455                         162   2e-43    
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       169   2e-43    
ref|XP_009803298.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       169   2e-43    
ref|XP_010942592.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    169   2e-43    



>ref|XP_009768067.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=459

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/383 (68%), Positives = 316/383 (83%), Gaps = 5/383 (1%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT QRSIR+ M PWLAHGHICPF+ LA+AL+KRNFYIYICSTPVN++S K+ +SEKD+I
Sbjct  1     MDTRQRSIRIAMLPWLAHGHICPFIELAKALSKRNFYIYICSTPVNINSFKQTISEKDSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIK+VEL LP+LP+LPPHYHTTNGLPPHLM TLK ALDM+KP F ++L TLKPDLV+YDF
Sbjct  61    SIKIVELHLPNLPELPPHYHTTNGLPPHLMSTLKNALDMAKPSFFHILSTLKPDLVMYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPWVP MAA+Q+IP+VLFL+PGAAA  YLFH+GR  P  EYPF  +YLRDHE+ RN+ +
Sbjct  121   LQPWVPTMAASQNIPSVLFLTPGAAASCYLFHIGRKKPVSEYPFSAIYLRDHEYDRNRDM  180

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
             FEP E  DG      R++GC+DGSS IILIKT R+LEGKY+D LS L +KR VPVGPLVR
Sbjct  181   FEPTED-DGYTDTQRRVNGCIDGSSEIILIKTIRELEGKYMDFLSTLCEKRYVPVGPLVR  239

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 + E+ E+ +WL+ K RCSTV  SFGSEYFL++EEMEE+A GLELS VNFLWV+RFP
Sbjct  240   EPETEHEHSEVMKWLNSKQRCSTVLASFGSEYFLSKEEMEELAYGLELSNVNFLWVVRFP  299

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                      ++ +ALP+G+L+R+G RGK+V+GWAPQ  IL+HSSIGGFVSHCGWSSVME 
Sbjct  300   VG----TNISLEEALPKGFLDRIGNRGKIVQGWAPQLRILQHSSIGGFVSHCGWSSVMEG  355

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             L+ G+PIIAMPM LDQPLNA++V
Sbjct  356   LQLGIPIIAMPMHLDQPLNAKLV  378



>ref|XP_009608408.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/386 (68%), Positives = 319/386 (83%), Gaps = 7/386 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT QRSIR+ M PWLAHGHICPF+ LA+AL+KRNFYIYICSTPVN++S K+ +SEKD+I
Sbjct  21    MDTRQRSIRIAMLPWLAHGHICPFIELAKALSKRNFYIYICSTPVNINSFKQTISEKDSI  80

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIK+VEL  P+LP+LPPHYHTTNGLPP LM TLK ALDM+KP F ++L+TLKPDLV+YDF
Sbjct  81    SIKIVELHFPNLPELPPHYHTTNGLPPLLMSTLKNALDMAKPSFFHILNTLKPDLVMYDF  140

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPWVP MAA+Q+IP+VLFL+PGAAA  YLFH+GR  P  EYPF  +YLRDHE+ RN+ +
Sbjct  141   LQPWVPTMAASQNIPSVLFLTPGAAASCYLFHIGRKKPVSEYPFSAIYLRDHEYDRNRHM  200

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
             FEP E  DG      R++GC+DGSS IILIKT R+LEGKY+D LS L +KR VPVGPLVR
Sbjct  201   FEPTED-DGYTDTQRRVNGCIDGSSEIILIKTIRELEGKYMDFLSTLCEKRYVPVGPLVR  259

Query  437   S--LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             +     + E+ E+ +WL+ K RCST+  SFGSEYFL++EEMEE+A GLELSKVNFLWV+R
Sbjct  260   APETEHEHEHSEVMKWLNSKQRCSTILASFGSEYFLSKEEMEELAYGLELSKVNFLWVVR  319

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP    GEK  ++ +ALP+G+L+R+G  GKVV+GWAPQ  IL+HSSIGGFVSHCGWSSVM
Sbjct  320   FP---MGEKI-SLEEALPKGFLDRIGNTGKVVQGWAPQLRILQHSSIGGFVSHCGWSSVM  375

Query  83    EALKFGVPIIAMPMQLDQPLNARVVA  6
             E LK G+PIIAMPM LDQPLNA++V 
Sbjct  376   EGLKLGIPIIAMPMHLDQPLNAKLVV  401



>ref|XP_006355167.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/387 (67%), Positives = 318/387 (82%), Gaps = 7/387 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT  RSIR+ M PWLAHGHI PF+ LA+AL+ RNFYIYICST VN++S K+ +SEK +I
Sbjct  1     MDTRNRSIRIAMLPWLAHGHITPFIELAKALSNRNFYIYICSTQVNINSFKQTISEKYSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIK+VE+ LP+LP+LPPHYHTTNGLPPHLM TLK A+DM++P F ++L TLKPDLV+YDF
Sbjct  61    SIKIVEIHLPNLPNLPPHYHTTNGLPPHLMSTLKNAMDMARPSFYHILTTLKPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPWVP MAA+ +IP+VLFL+PGAAA SYLFH+G+  P  EYPFP +YLRD+E+ RN+ +
Sbjct  121   LQPWVPTMAASLNIPSVLFLTPGAAAGSYLFHIGKKKPVSEYPFPAIYLRDYEYERNRCM  180

Query  617   FEPPEQIDGD--VSDTE-RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             FEP E+ +G+   +DT+ R++GC+DGSS IILIK+ RQLEGKYID LS++  KR VPVGP
Sbjct  181   FEPTEEDEGNDGFTDTQRRVNGCIDGSSQIILIKSIRQLEGKYIDYLSSVHNKRYVPVGP  240

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             LVRS   + E+ EI +WL+ K RCSTVF SFG+EYFL++EE EE+ALGLELSKVNFLWVI
Sbjct  241   LVRSPETETEHLEIMDWLNSKERCSTVFASFGTEYFLSKEETEELALGLELSKVNFLWVI  300

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP  +       + +ALP+G+LERVG RGKVV+GWAPQ  IL H SIGGFVSHCGWSSV
Sbjct  301   RFPVGQ----NMNLEEALPKGFLERVGNRGKVVQGWAPQLTILSHWSIGGFVSHCGWSSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVA  6
             ME LK GVPII MPM LDQPLNA+++ 
Sbjct  357   MEGLKLGVPIIGMPMHLDQPLNAKLIV  383



>ref|XP_010318090.1| PREDICTED: LOW QUALITY PROTEIN: crocetin glucoside glucosyltransferase-like 
[Solanum lycopersicum]
Length=463

 Score =   523 bits (1346),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 314/387 (81%), Gaps = 7/387 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT  RSIR+ M PWLAHGHI PF+ LA+AL+ RNFYIYICST VN++S K+ +SEK +I
Sbjct  1     MDTRHRSIRIAMLPWLAHGHITPFIELAKALSNRNFYIYICSTQVNINSFKQTISEKHSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIK+VE+ LP+LP+LPPHYHTTNGLPPHLM TLK A+DM++P F ++L TLKPDLV+YDF
Sbjct  61    SIKIVEIHLPNLPNLPPHYHTTNGLPPHLMSTLKNAMDMAQPSFYHILTTLKPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPWVP +AA+ +IP+VLFL+PGAAACSYLF         EYPFP +YLRD+E+ RN+ +
Sbjct  121   LQPWVPTLAASLNIPSVLFLTPGAAACSYLFXYWXKKTVCEYPFPSIYLRDYEYGRNRHM  180

Query  617   FEPPEQIDGD--VSDTE-RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             FEP E+ +G+   +DT+ R++GC+DGSS IILIK+ RQLEGKYID LSN+  KR VPVGP
Sbjct  181   FEPTEEDEGNDGFTDTQRRVNGCIDGSSQIILIKSIRQLEGKYIDYLSNIQNKRYVPVGP  240

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             LVR+   + E+ EI EWL+ K RCSTVF SFG+EYFL++EE E VALGLELSKVNFLWVI
Sbjct  241   LVRAPETEDEHSEIMEWLNSKTRCSTVFASFGTEYFLSKEETEVVALGLELSKVNFLWVI  300

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP  +     R + +ALP+G+LERVG RGK+V+GWAPQ  IL H SIGGFVSHCGWSSV
Sbjct  301   RFPVGQ----NRNLEEALPKGFLERVGNRGKIVQGWAPQLTILSHWSIGGFVSHCGWSSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVA  6
             ME LK GVPII MPM LDQPLNA+++ 
Sbjct  357   MEGLKLGVPIIGMPMHLDQPLNAKLIV  383



>ref|XP_009775018.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=462

 Score =   474 bits (1219),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 243/386 (63%), Positives = 299/386 (77%), Gaps = 8/386 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+T  ++IR++M PWLAHGHICPFL LA+AL+ RNF  Y+ +TPVNL+  K+R+S K++I
Sbjct  1     METRMKNIRIVMLPWLAHGHICPFLELAKALSMRNFITYLFTTPVNLTFFKQRLSVKESI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              IKL+E+QLP+LP LPPH+HTTNGLPPHLM TLKKA  MSKP F  +LDTLKPDL++YDF
Sbjct  61    RIKLMEIQLPNLPQLPPHFHTTNGLPPHLMNTLKKAFLMSKPDFFTILDTLKPDLIIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQP +P MAA  +IPAVLFL+PGAA+ SY +H    +P  +YPF E++ RDHE  +NK +
Sbjct  121   LQPCIPTMAATLNIPAVLFLTPGAASNSYHYHGRNNNPISDYPFREIFFRDHEHRKNKEI  180

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
             F+  E  DG + +   +  C + S  I+LIKTF++LEGKYID LS L KK+ VPVGPLVR
Sbjct  181   FDSLEN-DG-IDEKNGVTRCFERSHDIVLIKTFKELEGKYIDYLSVLFKKKFVPVGPLVR  238

Query  437   SL-VADGENP-EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
              +   DGE   EI EWL+ K +CST+FVSFGSE FL+ EE+EE ALGLELS VNF+WV+R
Sbjct  239   EIDQEDGEQHCEIIEWLNEKEKCSTIFVSFGSECFLSNEEIEEFALGLELSMVNFIWVVR  298

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP  E     + I + LP+GY ERV  RG V+EGWAPQG ILEHSSIGGFVSHCGWSSVM
Sbjct  299   FPMGE----KKNILEVLPKGYFERVENRGIVIEGWAPQGRILEHSSIGGFVSHCGWSSVM  354

Query  83    EALKFGVPIIAMPMQLDQPLNARVVA  6
             E+L +GVPIIAMPMQ DQPLNAR+V 
Sbjct  355   ESLNYGVPIIAMPMQHDQPLNARLVV  380



>ref|XP_010649358.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Vitis 
vinifera]
Length=450

 Score =   443 bits (1139),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 228/377 (60%), Positives = 284/377 (75%), Gaps = 13/377 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + S++V++ PWLAHGHI PFL LA+ L++RNFYIY CSTPVNLSSIK +++E+D++SI+L
Sbjct  4     RSSMKVVLLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLSSIKGKLTEEDSLSIEL  63

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VE+ LPSLPDLPPHY TTNGLPPHLMPTLKKA DM+ PGF ++L TL PDL++YD LQPW
Sbjct  64    VEIHLPSLPDLPPHYQTTNGLPPHLMPTLKKAFDMASPGFADILTTLNPDLIIYDILQPW  123

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
              P  A++Q+IPAVLFLS GA   S L         +E P   + L+D E  R K L    
Sbjct  124   APVAASSQNIPAVLFLSTGATLLSVLL--------QEQPITGIPLQDSE--RIKMLNHLA  173

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
             +    +++D  R   CL  SS+IIL++TFR LEGK+IDQ S L +K+ VPVGPLV+    
Sbjct  174   DSSANEITDEARAAQCLKLSSNIILMRTFRDLEGKHIDQASCLTQKKVVPVGPLVQHTTD  233

Query  425   DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
             + E  EI EWLD K   STV VSFGSEYFL++EEMEE+A  LELS V+F+WV+RFP    
Sbjct  234   EFEKEEIIEWLDKKEESSTVLVSFGSEYFLSKEEMEEMAHALELSTVSFIWVLRFPQR--  291

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
              +K  ++ +ALPEG+L RVG+RGKVV+ WAPQ  IL HSS GGFVSHCGWSSVME+LKFG
Sbjct  292   -DKIASVEEALPEGFLSRVGERGKVVKDWAPQREILNHSSTGGFVSHCGWSSVMESLKFG  350

Query  65    VPIIAMPMQLDQPLNAR  15
             VPI+A+PM LDQPLNA+
Sbjct  351   VPIVAIPMHLDQPLNAK  367



>ref|XP_006361439.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=449

 Score =   441 bits (1134),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 285/386 (74%), Gaps = 11/386 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I +LM PWLAHGHI PFL LA+ LT RNF+IY+CSTP+NLSSIKK V++K   
Sbjct  1     MEAKKNTISILMLPWLAHGHISPFLELAKKLTNRNFHIYLCSTPINLSSIKKNVTKKYCE  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLP+LPPHYHTTNGLPPHLM TLKKA + + P F  +L TL PDLV+YDF
Sbjct  61    SIELVELHLPSLPNLPPHYHTTNGLPPHLMNTLKKAFENASPNFSKILQTLNPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYL-FHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              QPW    A++ +IPA+ FL+  AA  + L  H+      E++PFPE+YLR+HE ++ K+
Sbjct  121   NQPWAAEFASSMNIPAIQFLTFSAAIVALLALHIMFDKSGEKFPFPEIYLREHEMLQIKK  180

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
               E  E  D +  D    +  L  S  I+L+KT R  EGKYID LS LV K+ VPVG LV
Sbjct  181   SLE--ESKDENYKDP--FNDALRLSRDIVLVKTSRDFEGKYIDYLSKLVSKKIVPVGSLV  236

Query  440   R-SLVADGENPE-IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             + S+  D ++ E I +WLD K +CS+VFVSFGSEYFL++EEM EVA GLE SKVNF+WVI
Sbjct  237   QDSIDQDHDHEEIIMQWLDKKEKCSSVFVSFGSEYFLSKEEMHEVAQGLEFSKVNFIWVI  296

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP  E      +I D LP+G+LERVG+RG V+E WAPQ  IL+H S GGFVSHCGWSSV
Sbjct  297   RFPQGEKN----SIQDVLPQGFLERVGERGMVLEKWAPQAAILQHRSTGGFVSHCGWSSV  352

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             ME++KFGVPIIAMPM +DQP+NAR+V
Sbjct  353   MESMKFGVPIIAMPMHIDQPMNARIV  378



>ref|XP_002271587.2| PREDICTED: crocetin glucoside glucosyltransferase-like [Vitis 
vinifera]
Length=434

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 282/374 (75%), Gaps = 8/374 (2%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPS  945
             MFPWLAHGHI PFL LA+ L+KRNF IY CSTPVNL  IK ++SE  ++SI+LV+L LPS
Sbjct  1     MFPWLAHGHISPFLQLAKKLSKRNFSIYFCSTPVNLDPIKGKLSESYSLSIQLVKLHLPS  60

Query  944   LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
             LP+LPP YHTTNGLPPHLMPTLK A DM+ P F N+L TL PDL++YDFLQPW PA A++
Sbjct  61    LPELPPQYHTTNGLPPHLMPTLKMAFDMASPNFSNILKTLHPDLLIYDFLQPWAPAAASS  120

Query  764   QSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDV  585
              +IPAV FLS GA   S+L H  R  P  E+PF E++L D+E  R  R  EP     G +
Sbjct  121   LNIPAVQFLSTGATLQSFLAHRHR-KPGIEFPFQEIHLPDYEIGRLNRFLEPSA---GRI  176

Query  584   SDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEI  405
             SD +R + CL+ SS   LIKTFR++E KY+D +S+L KK+ V VGPL++    + E  +I
Sbjct  177   SDRDRANQCLERSSRFSLIKTFREIEAKYLDYVSDLTKKKMVTVGPLLQDPEDEDEATDI  236

Query  404   KEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAI  225
              EWL+ K   S VFVSFGSEYF+++EEMEE+A GLELS V+F+WV+RFP    GEK R +
Sbjct  237   VEWLNKKCEASAVFVSFGSEYFVSKEEMEEIAHGLELSNVDFIWVVRFP---MGEKIR-L  292

Query  224   GDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMP  45
              DALP G+L R+G RG VVEGWAPQ  IL HSSIGGFVSHCGWSSVME +KFGVPIIAMP
Sbjct  293   EDALPPGFLHRLGDRGMVVEGWAPQRKILGHSSIGGFVSHCGWSSVMEGMKFGVPIIAMP  352

Query  44    MQLDQPLNARVVAA  3
             M LDQP+NA++V A
Sbjct  353   MHLDQPINAKLVEA  366



>ref|XP_010658725.1| PREDICTED: crocetin glucoside glucosyltransferase-like isoform 
X1 [Vitis vinifera]
Length=450

 Score =   437 bits (1125),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 228/382 (60%), Positives = 285/382 (75%), Gaps = 9/382 (2%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             Q  I+VL+ PWLAHGHI PFL L++ L K+ FYIY CS+PVNLS IK +++   + SI+L
Sbjct  7     QSRIKVLVLPWLAHGHISPFLELSKQLMKQKFYIYFCSSPVNLSRIKGKLTGNYSHSIQL  66

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPSLP+LPPHYHTTNGLPPHLMPTLK ALDM+ P F N+L TL PDL++YDF+QPW
Sbjct  67    VELHLPSLPELPPHYHTTNGLPPHLMPTLKMALDMASPSFTNILKTLSPDLLIYDFIQPW  126

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
              PA AA+  IP+V FLS GAAA +++ H  +  P  E+PFPE+YLRD+E     R  E  
Sbjct  127   APAAAASLGIPSVQFLSNGAAATAFMIHFVK-KPGNEFPFPEIYLRDYETSGFNRFVESS  185

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-SLV  429
                     D E+   CL+ SS++ILI++F+++E ++ID LSNL  K  VPVGPL++  L 
Sbjct  186   ANAR---KDKEKARQCLEQSSNVILIRSFKEIEERFIDFLSNLNAKTVVPVGPLLQDQLD  242

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              +    E+ EWL  K   S+VFVSFGSEYFL++EE+EEVA GLELSKVNF+WV+RFP   
Sbjct  243   EEDAETEMVEWLSKKDPASSVFVSFGSEYFLSKEELEEVAYGLELSKVNFIWVVRFP---  299

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              G+K R + +ALPEG+L RVG +G VVEGWAPQ  IL HSSIGGFVSHCGW SVME++ F
Sbjct  300   MGDKTR-VEEALPEGFLSRVGDKGMVVEGWAPQKKILRHSSIGGFVSHCGWGSVMESMNF  358

Query  68    GVPIIAMPMQLDQPLNARVVAA  3
             GVPI+AMPM LDQP NA++V A
Sbjct  359   GVPIVAMPMHLDQPFNAKLVEA  380



>ref|XP_006367679.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=443

 Score =   437 bits (1124),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 281/383 (73%), Gaps = 11/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I VLM PWLAHGHI PFL LA+ L  +NF+IY+CSTPVNL+SIKKRVSEK + 
Sbjct  1     MEAKKHTISVLMLPWLAHGHINPFLELAKKLASKNFHIYLCSTPVNLNSIKKRVSEKYSQ  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+L+EL L SLPDLPPHYHTTNGLPPHLM TLK A +++ P F  +L TL PDLV++D+
Sbjct  61    SIELIELHLLSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLHPDLVIHDY  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPWV   A++ +IPAV F +  A   +   H+   +  E++PFPE+YLR+HE I  K+ 
Sbjct  121   NQPWVTDSASSMNIPAVQFPTFSATVVALAIHMS-DNTEEKFPFPEIYLREHEMISLKK-  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                   ID   S     D  +  S  IIL+KT R  EGKYID LSNL  K+ VPVG LV+
Sbjct  179   -----DIDEVPSKKFPYDEAIRRSHDIILVKTCRDFEGKYIDYLSNLTSKKIVPVGSLVQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               +   +  EI +WLD K + STVFVSFGSEYFL++EE+  VA GLELSKVNF+WVIRFP
Sbjct  234   ESMDQDDYEEIAQWLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+   I DALPEGYLERVG+RG ++EGWAPQ +IL+H SIGGFVSHCGWSS ME+
Sbjct  294   ---QGERLN-IRDALPEGYLERVGERGMIMEGWAPQALILQHPSIGGFVSHCGWSSFMES  349

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPM +DQP+NAR+V
Sbjct  350   MKFGVPIIAMPMHIDQPMNARLV  372



>ref|XP_010034308.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=435

 Score =   437 bits (1123),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 228/372 (61%), Positives = 278/372 (75%), Gaps = 8/372 (2%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPS  945
             M PWLAHGHI PFL L + L++RNF+IY+CSTPVNLSSIK ++SEK + SI+LVEL LPS
Sbjct  1     MLPWLAHGHISPFLELGKRLSERNFHIYLCSTPVNLSSIKPKISEKYSSSIELVELHLPS  60

Query  944   LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
             LPDLPPHYHTT GLPPHLM TLK A DM+ PGF N++  L P+L+VYDFLQPW P +A  
Sbjct  61    LPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFSNIIKKLNPNLIVYDFLQPWAPEIARL  120

Query  764   QSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDV  585
              ++PAV F S GA   S+ FH  + +  E +PF  + L D+E  +  RLF   E   G +
Sbjct  121   HNVPAVNFWSVGAGMVSFFFHAVQ-NVGEGFPFEAVRLHDYEQWKFDRLF---ENSAGGI  176

Query  584   SDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEI  405
             +D +R   C   SS  IL+KTFR+LEGKY+D LS+LV K+ +PVGPLV+    +G N +I
Sbjct  177   TDKDRALQCAGRSSGFILMKTFRELEGKYLDYLSSLVGKKVIPVGPLVQDPGEEGGNDDI  236

Query  404   KEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAI  225
              +WLD K  CS+VFVS G+EYFLT +E EE+A GLELS VNF+WVIRFP  E+ E    +
Sbjct  237   IKWLDEKEECSSVFVSCGTEYFLTVKEREEIAYGLELSNVNFIWVIRFPIGESME----L  292

Query  224   GDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMP  45
              +ALP G+LERVG RG V EGWAPQ  ILEH SIGGFVSHCGWSS+ME++K GVPIIAMP
Sbjct  293   EEALPAGFLERVGDRGLVREGWAPQTKILEHPSIGGFVSHCGWSSIMESMKSGVPIIAMP  352

Query  44    MQLDQPLNARVV  9
             MQLDQPLNAR+V
Sbjct  353   MQLDQPLNARIV  364



>ref|XP_009629528.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=445

 Score =   437 bits (1124),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 222/383 (58%), Positives = 281/383 (73%), Gaps = 10/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I +LM PWLAHGHI PFL LA+ LTKRNF+IY+CS+PVNL+SIKK V+EK + 
Sbjct  1     MEGKKNTISILMLPWLAHGHISPFLELAKRLTKRNFHIYMCSSPVNLNSIKKSVTEKYSK  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLP+LPP+YHTTNGLPPHLM TLK A + S P F  +L TL PDLV+YDF
Sbjct  61    SIELVELHLPSLPNLPPYYHTTNGLPPHLMNTLKTAFERSSPNFSKILQTLNPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +QPW    A++ +IPAV FL+  AA  ++ FH+      E++PFPE+YLR +E ++ K++
Sbjct  121   IQPWAATFASSMNIPAVQFLTFSAAVLAFAFHMFEKR-GEDFPFPEIYLRKYEMVQMKKI  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  +       D    D  L  S   IL+KT ++ EGKY+D  S+LV K+ VPVG LV+
Sbjct  180   MEESK------DDKSPFDEALRKSRDFILVKTCKEFEGKYMDYFSSLVSKKIVPVGSLVQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               V +  N EI +WLD K + STVFVSFGSEYFL++EE+ EVA GLELSKVNF+WVIR P
Sbjct  234   DSVNEDNNDEITQWLDKKEKSSTVFVSFGSEYFLSKEEIHEVAQGLELSKVNFIWVIRVP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 G K   I DALP+ +LE+V  RG V+E WAPQ  IL+H SIGGFVSHCGWSS ME+
Sbjct  294   ---QGVKNSTIQDALPKEFLEKVEDRGMVLEKWAPQATILKHKSIGGFVSHCGWSSFMES  350

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPM +DQP+NA++V
Sbjct  351   VKFGVPIIAMPMHIDQPMNAKLV  373



>ref|XP_011076907.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=478

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 286/388 (74%), Gaps = 12/388 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT +RSIR+LMFPWLAHGHI  FL LA++L KRNF IYICS+ VNL+SI K +S KD+I
Sbjct  1     MDTRKRSIRILMFPWLAHGHISAFLELAKSLAKRNFVIYICSSQVNLNSISKNMSSKDSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             S+KLVEL +P+   LPP YHTTNGLPPHLM TLK+ALD ++P F  LL TLKPDLV+YDF
Sbjct  61    SVKLVELHIPTTI-LPPPYHTTNGLPPHLMSTLKRALDSARPAFSTLLQTLKPDLVLYDF  119

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSY-LFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             LQ W    A +Q+IPA++FLS GAAA S+ ++H     P EEYPFP +Y R+HE+    R
Sbjct  120   LQSWASEEAESQNIPAMVFLSTGAAAISFIMYHWFETRP-EEYPFPAIYFREHEYDNFCR  178

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                  +  D   SD  R+  C+  S  ++LIKTFR+LEG+Y+D LS+L +KR VPVGPLV
Sbjct  179   F----KSSDSGTSDQLRVSDCVKRSHDLVLIKTFRELEGQYVDFLSDLTRKRFVPVGPLV  234

Query  440   RSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             + +  D EN   +I EWLD K R STVF SFGSEYFL+  E+EE+A GLELS +NF+WV+
Sbjct  235   QEVGCDMENEGNDIIEWLDGKDRRSTVFSSFGSEYFLSANEIEEIAYGLELSGLNFIWVV  294

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP    G++   I + LPEG+LERV  RG VVEGWA Q  IL H S+GGF+SHCGWSSV
Sbjct  295   RFP---HGDEKIKIEEKLPEGFLERVEGRGLVVEGWAQQRRILSHPSVGGFLSHCGWSSV  351

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVAA  3
             ME +  GVPIIA+PM LDQP NAR+V A
Sbjct  352   MEGVYSGVPIIAVPMHLDQPFNARLVEA  379



>ref|XP_009593691.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/386 (59%), Positives = 282/386 (73%), Gaps = 16/386 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +IRVLM PWLAHGHI PFL LA+ LTKRNF+IY+CSTPVNLSSI+K V+EK + 
Sbjct  1     MEAKKNTIRVLMVPWLAHGHISPFLELAKRLTKRNFHIYMCSTPVNLSSIQKNVTEKYSE  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE+ LPSLPDLPPHYHTTNGLPPHLM TLK A +MS P F  +L TL PDLV+YD+
Sbjct  61    SIELVEIHLPSLPDLPPHYHTTNGLPPHLMNTLKTAFEMSSPKFSKILQTLNPDLVIYDY  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHE-FIRNKR  621
              QPW   +A + +IPAV  L+  AA  +  FH+  G   E++PFPE+Y R++E  +  K 
Sbjct  121   NQPWTAQLALSMNIPAVQLLTFSAAVIALGFHMS-GDKEEKFPFPEIYQREYEMLLLMKA  179

Query  620   LFEPPEQIDGDVSDTERIDGC--LDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             + E P          +    C  L  S  I+L+KT R  EGKY++ LS LV K+ VPVG 
Sbjct  180   INESP---------GKEFPFCEALRRSRDIVLVKTCRDFEGKYMNYLSRLVSKKIVPVGT  230

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             LV+      E+ E  +WLD K + STVFVSFGSEYFL++EE+  VA GLEL KVNF+WVI
Sbjct  231   LVQESTDQDEHEETIQWLDKKGKSSTVFVSFGSEYFLSKEEIHAVAQGLELRKVNFIWVI  290

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP    GEK   I DALP+G+L RVG+RGK++EGWAPQ  IL+H+SIGGFVSHCGWSS 
Sbjct  291   RFP---QGEKTSTIEDALPDGFLGRVGERGKIMEGWAPQATILQHASIGGFVSHCGWSSF  347

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             ME++KFGVPIIAMPM +DQP+NAR+V
Sbjct  348   MESVKFGVPIIAMPMHIDQPMNARLV  373



>dbj|BAF99027.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltransferase [Sesamum 
indicum]
Length=469

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 286/388 (74%), Gaps = 12/388 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT +RSIR+LMFPWLAHGHI  FL LA++L KRNF IYICS+ VNL+SI K +S KD+I
Sbjct  1     MDTRKRSIRILMFPWLAHGHISAFLELAKSLAKRNFVIYICSSQVNLNSISKNMSSKDSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             S+KLVEL +P+   LPP YHTTNGLPPHLM TLK+ALD ++P F  LL TLKPDLV+YDF
Sbjct  61    SVKLVELHIPTTI-LPPPYHTTNGLPPHLMSTLKRALDSARPAFSTLLQTLKPDLVLYDF  119

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSY-LFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             LQ W    A +Q+IPA++FLS GAAA S+ ++H     P EEYPFP +Y R+HE+    R
Sbjct  120   LQSWASEEAESQNIPAMVFLSTGAAAISFIMYHWFETRP-EEYPFPAIYFREHEYDNFCR  178

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                  +  D   SD  R+  C+  S  ++LIKTFR+LEG+Y+D LS+L +KR VPVGPLV
Sbjct  179   F----KSSDSGTSDQLRVSDCVKRSHDLVLIKTFRELEGQYVDFLSDLTRKRFVPVGPLV  234

Query  440   RSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             + +  D EN   +I EWLD K R STVF SFGSEYFL+  E+EE+A GLELS +NF+WV+
Sbjct  235   QEVGCDMENEGNDIIEWLDGKDRRSTVFSSFGSEYFLSANEIEEIAYGLELSGLNFIWVV  294

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP    G++   I + LPEG+LERV  RG VVEGWA Q  IL H S+GGF+SHCGWSSV
Sbjct  295   RFP---HGDEKIKIEEKLPEGFLERVEGRGLVVEGWAQQRRILSHPSVGGFLSHCGWSSV  351

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVAA  3
             ME +  GVPIIA+PM LDQP NAR+V A
Sbjct  352   MEGVYSGVPIIAVPMHLDQPFNARLVEA  379



>ref|XP_002264771.2| PREDICTED: crocetin glucoside glucosyltransferase [Vitis vinifera]
Length=455

 Score =   431 bits (1109),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/380 (58%), Positives = 281/380 (74%), Gaps = 7/380 (2%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             +I V+M PWLAHGHI PFL LA+ L++RNFYIY CSTPVNL  IK +++++++ SI LVE
Sbjct  6     TISVVMLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLGCIKGKLNQENSRSIHLVE  65

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LPS PDLPPHYHTTNGLPPHLMPTLKKA D +   F ++L +LKPDL++YD LQPW P
Sbjct  66    LHLPSSPDLPPHYHTTNGLPPHLMPTLKKAFDTANHSFADILKSLKPDLLIYDILQPWAP  125

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELY-LRDHEFIRNKRLFEPPE  603
               A++  IPA+LF S GAA  S + H+G+  P   YPFPE++ L+D  F R   L     
Sbjct  126   TAASSLDIPAILFFSTGAAVLSIILHLGK-RPGTVYPFPEIFHLQD--FRRTTELNRVTG  182

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD  423
                 ++ D ER   CL  SS++ILIKTFR++ GKYID +S L +K+ +PVGPLV     +
Sbjct  183   SGANNMKDEERAAECLKQSSNVILIKTFREMGGKYIDYISALSEKKLIPVGPLVADSTEE  242

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              EN  I +WL+ K + S V VSFGSEYF+++EEMEE+A GLELS+V+F+WV+R      G
Sbjct  243   FENAAIIDWLNKKDKLSAVLVSFGSEYFMSKEEMEEIAHGLELSRVSFIWVVRIL---QG  299

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
              K     +ALPEGY+ RVG+RG VVEGWAPQ  IL H+SIGGFVSHCGWSS+ME++KFGV
Sbjct  300   NKINNAEEALPEGYIRRVGERGMVVEGWAPQKKILGHTSIGGFVSHCGWSSIMESIKFGV  359

Query  62    PIIAMPMQLDQPLNARVVAA  3
             PI+A+PMQ+DQP NA+++ A
Sbjct  360   PIVAIPMQIDQPFNAKLLEA  379



>ref|XP_004249996.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   431 bits (1107),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/384 (58%), Positives = 279/384 (73%), Gaps = 12/384 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  +  + +LM PWLAHGHI PFL LA+ LT RNF+IY+CSTP+NLSSIKK +++K   
Sbjct  1     MEAKKNKMSILMLPWLAHGHISPFLELAKKLTNRNFHIYMCSTPINLSSIKKNITKKYFE  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE  LPSLP+LPPHYHTTNGLPPHLM TLK A + + P F  +L TL PDLV+YDF
Sbjct  61    SIELVEFHLPSLPNLPPHYHTTNGLPPHLMNTLKTAFENASPNFSKILQTLNPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPW    A++ +IPAV FL+ GAA  S   H+      +++PFPE+YL ++E +  K  
Sbjct  121   NQPWAAESASSVNIPAVQFLTFGAAVVSLAIHMFED-TEDKFPFPEIYLHEYEMLSLK--  177

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 E +     +    D  +  S  I+L+KT R  EGKY+D LSNLV K+ VPVG LV+
Sbjct  178   ----EAVKEAPGNKYSFDEAIRLSRDIVLVKTCRDFEGKYVDYLSNLVSKKIVPVGSLVQ  233

Query  437   SLVA-DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               +A D  + EI +WLD K +  TVFVSFGSEYFL++E++  VA GLELSKVNF+WVIRF
Sbjct  234   ESIARDDNDEEIMQWLDKKEKGLTVFVSFGSEYFLSKEDIFVVARGLELSKVNFIWVIRF  293

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
                  GE+  +I DALPEGYLERVG+RG V+EGWAPQ MIL+H SIGGFVSHCGWSS ME
Sbjct  294   S---QGERI-SIQDALPEGYLERVGERGMVIEGWAPQAMILQHPSIGGFVSHCGWSSFME  349

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++KFGVPIIAMPM +DQP+NAR+V
Sbjct  350   SMKFGVPIIAMPMHIDQPMNARLV  373



>ref|XP_002523035.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis]
 gb|EEF39339.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis]
Length=420

 Score =   428 bits (1101),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/383 (59%), Positives = 283/383 (74%), Gaps = 11/383 (3%)
 Frame = -3

Query  1145  QRSIR-VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
             +RSI  VLMFPWLAHGHI PFL LA+ L KRNFY+Y+CSTPVNL SIK+ +S K  +SI+
Sbjct  6     KRSISSVLMFPWLAHGHISPFLELAKKLAKRNFYVYLCSTPVNLDSIKQNLSPKYLLSIQ  65

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
             LVEL LPSLPDLP H HTT GLPPHLM TLK A DM+ P F N+L+TL+PDL++YDFLQP
Sbjct  66    LVELHLPSLPDLPSHCHTTKGLPPHLMTTLKTAFDMATPNFSNILETLRPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W  A+A +  IPAVLFL    A  ++  H       + +PFPE+Y +   +  +K++ E 
Sbjct  126   WAAALALSFDIPAVLFLCSSMAMSTFCRHFSENSSDDHFPFPEIYPK---WCLDKKVLEV  182

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL-  432
              E    +  D  R++ C++ S  +IL KTFR+LEGKYID LS  + K+ VPVGPLV+   
Sbjct  183   LESSSNERKDKHRVNQCIERSYHLILAKTFRELEGKYIDYLSVKLMKKIVPVGPLVQEDN  242

Query  431   --VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               + + E  E+ +WL+ K   S VFVSFGSEYFL+ EE EE+A GLELSKVNF+WV+RFP
Sbjct  243   IPIHEDEKMEVIQWLEKKEPSSAVFVSFGSEYFLSSEEREEIANGLELSKVNFIWVVRFP  302

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                AGE+ + + DALP+GY+ERV ++G +VEGW PQ  +L HSSIGGFVSHCGWSS+ME+
Sbjct  303   ---AGEEIK-LEDALPKGYIERVKEKGLIVEGWLPQAKMLGHSSIGGFVSHCGWSSIMES  358

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVP+IAMPM LDQPLNARVV
Sbjct  359   MKFGVPVIAMPMNLDQPLNARVV  381



>ref|XP_009775013.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score =   429 bits (1102),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 279/383 (73%), Gaps = 10/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I +LM PWLAHGHI PFL LA+ LTKRNF+IY+CSTPVNL+SIKK V+EK + 
Sbjct  1     MEGKKNTISILMLPWLAHGHISPFLELAKRLTKRNFHIYMCSTPVNLNSIKKSVTEKYSQ  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLP+LPP+YHTTNGLPPHLM TLK A +MS P F         DLV+YDF
Sbjct  61    SIELVELHLPSLPNLPPYYHTTNGLPPHLMNTLKIAFEMSSPNFSKXXXXXXXDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +QPW    A++ +IPAV FL+  A   ++ FH+    P E++PFPE+YLR++E ++ K+ 
Sbjct  121   IQPWAATFASSVNIPAVQFLTFSAGVLAFAFHMFE-KPGEDFPFPEIYLREYEMLQMKKT  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  ++      D    D  L  S   IL+KT ++ EGKY+   S+LV K+ VPVG L++
Sbjct  180   MEESKE------DKSPFDEALRKSRDFILVKTCKEFEGKYMGYFSSLVSKKIVPVGSLIQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               V+  +N EI +WLD K + S VFVSFGSEYFL++EE+ EVA GLELSKVNF+WVI FP
Sbjct  234   DTVSRDDNEEITQWLDKKEKNSGVFVSFGSEYFLSKEELHEVAQGLELSKVNFIWVISFP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE   +I D+LP+G+L+RV  RG V+EGWAPQ  IL+H SIGGFVSHCGWSS ME+
Sbjct  294   ---QGENNSSIKDSLPKGFLQRVEDRGMVLEGWAPQATILKHISIGGFVSHCGWSSFMES  350

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             + FGVPIIAMPM LDQP+NAR+V
Sbjct  351   VNFGVPIIAMPMHLDQPMNARLV  373



>ref|XP_004250486.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=443

 Score =   428 bits (1101),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 277/383 (72%), Gaps = 11/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + ++ VLM PWLAHGHI PFL LA+ L  +NF IY+CST VNL SIKKRV EK + 
Sbjct  1     MEAKKHTMSVLMLPWLAHGHINPFLELAKKLASKNFDIYLCSTLVNLLSIKKRVGEKYSE  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+L+EL LPSLPDLPPHYHTTNGLPPHLM TLK A +++ P F  +L TL+PDLV++D+
Sbjct  61    SIELIELHLPSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLRPDLVIHDY  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPWV   A++ +IPAV F +  A   +   H+   +  E++PFPE+YLR+HE I  K+ 
Sbjct  121   NQPWVTDSASSMNIPAVQFPTFSATVVALSIHMSE-NTTEKFPFPEIYLREHEMISLKK-  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                   I+   S     D  +  S  IIL+KT R  EGKYID LSNL  K+ VPVG LV+
Sbjct  179   -----DINEVPSKKFPYDEAIRRSHDIILVKTCRDFEGKYIDYLSNLTSKKVVPVGSLVQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               +   +  EI +WLD K + STVFVSFGSEYFL++EE+  VA GLELSKVNF+WVIRFP
Sbjct  234   ETMDQDDYKEIAQWLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+   I DALP+ YLERVG+RG V+EGWAPQ  IL+H SIGGFVSHCGWSS ME+
Sbjct  294   ---QGERMN-IRDALPKEYLERVGERGMVIEGWAPQATILQHPSIGGFVSHCGWSSFMES  349

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPM +DQP+NAR+V
Sbjct  350   MKFGVPIIAMPMHIDQPMNARLV  372



>gb|KCW51492.1| hypothetical protein EUGRSUZ_J01008, partial [Eucalyptus grandis]
Length=412

 Score =   426 bits (1095),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 222/385 (58%), Positives = 288/385 (75%), Gaps = 12/385 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M   QR I+VLM PWLAHGHI P+L LA+ L+ RNF++Y CSTPVNLSSIK ++SEK + 
Sbjct  1     MANMQRPIKVLMLPWLAHGHISPYLELAKRLSTRNFHVYFCSTPVNLSSIKPKISEKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              ++LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+ PGF +++ +L PDL+++DF
Sbjct  61    CVELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASPGFSDIVKSLGPDLLIHDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW   +A +  +P+V+F S GA   S++FH+ + + + E+PF  + L D+E     +L
Sbjct  121   LQPWAAEVAKSHGLPSVVFFSVGAGTLSFMFHMIK-NTSIEFPFKAIRLHDYE---QAKL  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +  +   G VS+ +R   C++ SS+ IL+KTFR+L+GKY+D LS+L+ K  VPVGPLV 
Sbjct  177   TDMIDDSTGSVSNKDRCLQCVERSSNFILLKTFRELDGKYMDYLSSLLGKIVVPVGPLVE  236

Query  437   --SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               S + DG+   I EWLD +   ST+FVSFG+EYFL E+E EE+A GLELS VNF+WVIR
Sbjct  237   VPSNIEDGDG--IIEWLDEREESSTIFVSFGTEYFLNEKEREEIAYGLELSNVNFIWVIR  294

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP  E+ E    + +ALPEG+  RV  RG V++GWAPQGMILEH SIGGFVSHCGWSS+M
Sbjct  295   FPVGESIE----LEEALPEGFFGRVRDRGLVIDGWAPQGMILEHPSIGGFVSHCGWSSIM  350

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++K GVPIIA+PMQ DQPLNAR+V
Sbjct  351   ESMKSGVPIIAIPMQFDQPLNARMV  375



>ref|XP_008231982.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=456

 Score =   427 bits (1098),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 286/388 (74%), Gaps = 16/388 (4%)
 Frame = -3

Query  1157  MDTSQ-RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MD+SQ R   VLMFPWLAHGHI P+L LA+ LT RNF+IY CSTPVNL SIK ++SEK +
Sbjct  1     MDSSQQRKFSVLMFPWLAHGHISPYLELAKKLTNRNFHIYFCSTPVNLRSIKPKLSEKYS  60

Query  980   ISIKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
               I+LV+L LP   LP+LPPHYHTTNGLPPHLM TLK A DM+ P F N+L TL PDL++
Sbjct  61    CCIELVQLHLPYEDLPELPPHYHTTNGLPPHLMSTLKTAFDMASPNFSNILKTLNPDLLI  120

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             YDFLQPW P++A  Q+IPA+ F++  AA  S   H G   P  ++PFP +Y   +E  + 
Sbjct  121   YDFLQPWAPSLALLQNIPAIEFVTTSAAMMSVCTHHGE-KPGVKFPFPSIY---YETSKI  176

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             K L E        +SD +R   C D S  I+L+K+ R++E KYID LS+L+ K+ VPVG 
Sbjct  177   KMLLESS---SNGISDGDRAKQCSDHSCKIVLVKSSREIEAKYIDYLSDLIGKKIVPVGS  233

Query  446   LVRSLV---ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             LV+ L+    D E  +I +WL+ + R S V+VSFGSEYFL++EE+EE+A GLELS+V+F+
Sbjct  234   LVQDLIEQEVDSEKTKIMKWLNTRERSSVVYVSFGSEYFLSKEEIEEIAHGLELSRVSFI  293

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WVIRFP  E G +   + + LPEG+LERVG++G +V+GWAPQ  IL+HSS GGFVSHCGW
Sbjct  294   WVIRFPKEEKGTR---VEEVLPEGFLERVGEKGIIVDGWAPQAKILKHSSAGGFVSHCGW  350

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARV  12
             SSV+E++KFGVPI+AMPM LDQP+NAR+
Sbjct  351   SSVLESIKFGVPIVAMPMHLDQPINARI  378



>ref|XP_010032098.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=453

 Score =   427 bits (1098),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 222/385 (58%), Positives = 288/385 (75%), Gaps = 12/385 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M   QR I+VLM PWLAHGHI P+L LA+ L+ RNF++Y CSTPVNLSSIK ++SEK + 
Sbjct  1     MANMQRPIKVLMLPWLAHGHISPYLELAKRLSTRNFHVYFCSTPVNLSSIKPKISEKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              ++LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+ PGF +++ +L PDL+++DF
Sbjct  61    CVELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASPGFSDIVKSLGPDLLIHDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW   +A +  +P+V+F S GA   S++FH+ + + + E+PF  + L D+E     +L
Sbjct  121   LQPWAAEVAKSHGLPSVVFFSVGAGTLSFMFHMIK-NTSIEFPFKAIRLHDYE---QAKL  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +  +   G VS+ +R   C++ SS+ IL+KTFR+L+GKY+D LS+L+ K  VPVGPLV 
Sbjct  177   TDMIDDSTGSVSNKDRCLQCVERSSNFILLKTFRELDGKYMDYLSSLLGKIVVPVGPLVE  236

Query  437   --SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               S + DG+   I EWLD +   ST+FVSFG+EYFL E+E EE+A GLELS VNF+WVIR
Sbjct  237   VPSNIEDGDG--IIEWLDEREESSTIFVSFGTEYFLNEKEREEIAYGLELSNVNFIWVIR  294

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP  E+ E    + +ALPEG+  RV  RG V++GWAPQGMILEH SIGGFVSHCGWSS+M
Sbjct  295   FPVGESIE----LEEALPEGFFGRVRDRGLVIDGWAPQGMILEHPSIGGFVSHCGWSSIM  350

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++K GVPIIA+PMQ DQPLNAR+V
Sbjct  351   ESMKSGVPIIAIPMQFDQPLNARMV  375



>ref|XP_009770958.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=443

 Score =   425 bits (1093),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/382 (58%), Positives = 276/382 (72%), Gaps = 11/382 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +IR+LM PWLAHGHI PFL LA+ LT RNF+IY+ STPVNLSSIKK V+EK + 
Sbjct  1     MEAKKNTIRLLMVPWLAHGHISPFLELAKKLTNRNFHIYMYSTPVNLSSIKKNVTEKYSQ  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLP+LPPHYHTTNGLPPHLM TLK A +M+ P F  +L+TL PDLV+YD+
Sbjct  61    SIELVELHLPSLPNLPPHYHTTNGLPPHLMNTLKTAFEMAAPKFSKILETLNPDLVIYDY  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPW   +A + +IPAV  L+  AA  +   H+      E++PFPE+YLR++E +  K+ 
Sbjct  121   NQPWTAQLALSMNIPAVQLLTFSAAVIALGIHMSEDK-EEKFPFPEIYLREYEMLSLKK-  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                   I+            L  S +I+L+KT R  EGKY+D LSNLV K+ VPVG LV+
Sbjct  179   -----AINESPGKEFPFGEALRRSRNIVLVKTCRDFEGKYMDYLSNLVTKKIVPVGTLVQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   E+ EI +WLD K + STVFVSFGSEYFL+ EE+  VA GLELSKVNF+WVIRFP
Sbjct  234   EATDQDEHEEIMQWLDKKEKSSTVFVSFGSEYFLSNEEILAVAQGLELSKVNFIWVIRFP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+  +I D +PE +LERVGK GK++E WAPQ  IL+H S GGFVSHCGWSS ME+
Sbjct  294   ---QGERI-SIADVVPEVFLERVGKSGKILEEWAPQANILQHPSTGGFVSHCGWSSFMES  349

Query  77    LKFGVPIIAMPMQLDQPLNARV  12
             +KFGVPIIAMPM +DQP+NAR+
Sbjct  350   MKFGVPIIAMPMHIDQPMNARL  371



>ref|XP_008375610.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=457

 Score =   425 bits (1092),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 283/388 (73%), Gaps = 12/388 (3%)
 Frame = -3

Query  1157  MDT-SQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSIKKRVSEKD  984
             MD+  QR   VLM PWLAHGHI PFL L++ LT R NF+I+ CSTPVNL+SIK ++ +K 
Sbjct  1     MDSVQQRKTSVLMLPWLAHGHISPFLELSKKLTSRGNFHIFFCSTPVNLNSIKPKLPQKY  60

Query  983   AISIKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             +  I+LVEL LP   LP+LPPHYHTTNGLPPHLMPTLKKA DM+   F N+L TLKPDL+
Sbjct  61    SHCIELVELHLPYXELPELPPHYHTTNGLPPHLMPTLKKAFDMASXNFSNILKTLKPDLL  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDFLQPW P  A +++IPAV F    AA  S+  H     P+  +PFP +YLRD+E ++
Sbjct  121   IYDFLQPWAPXRALSKNIPAVQFYPSCAAMASFGBHRRCKXPSARFPFPSIYLRDYELMK  180

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
                L + P      +SD ER+  C + S  IILIKT R++E KYID L  L+ K  VPVG
Sbjct  181   FNNLGKSP---SNGLSDGERVQKCTEQSCKIILIKTSREIEAKYIDYLCGLLGKVIVPVG  237

Query  449   PLVRS-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
              LV+  L  +GE  EI +WL+ + R S VFVSFG+EYFL++ E++E+ALGLELS V F+W
Sbjct  238   SLVQEPLDGEGEETEIIKWLNTRERSSVVFVSFGTEYFLSKXEIQEIALGLELSNVCFIW  297

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             VIRFP  E  +    I + LPEG++ERVG+RG VVEGWAPQ  IL+HSSIGGFVSHCGWS
Sbjct  298   VIRFPVGETTK----IEELLPEGFMERVGERGMVVEGWAPQAKILQHSSIGGFVSHCGWS  353

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SVME++KF VPIIA+PM LDQPLNAR+V
Sbjct  354   SVMESIKFCVPIIAIPMHLDQPLNARLV  381



>ref|XP_010034306.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=464

 Score =   424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 225/384 (59%), Positives = 279/384 (73%), Gaps = 9/384 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T++RSIRVLM PWLAHGHI PFL LA+ L+KRNF+IY CS+PVNL+SIK ++      
Sbjct  1     MATTRRSIRVLMLPWLAHGHIAPFLELAKKLSKRNFHIYFCSSPVNLASIKPKLVGTTYF  60

Query  977   S-IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             S I+LVEL LPSLP+LPP  H+T  LPPHLMPTLKKA DMS PGF ++L  L P LVVYD
Sbjct  61    SKIELVELHLPSLPELPPRNHSTKTLPPHLMPTLKKAFDMSSPGFADILKLLDPALVVYD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW PA+A++  IPAV FL   A  C+++ H     P  ++P+P +YL DHE  +   
Sbjct  121   FLQPWAPAIASSMGIPAVEFLCTSATMCAFVNHANM-KPGNKFPYPGIYLHDHEVDQFAN  179

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C + S  +I+IK+ R++EGKYID LS L+ K  VPVGPLV
Sbjct  180   LLECSAN---GIKDRDRVFQCYERSRDMIMIKSIREIEGKYIDYLSFLIDKSVVPVGPLV  236

Query  440   R-SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               +   D E  EI +WLD K   STVFVSFGSEYFL+++EM E+A GLE SKVNF+WV+R
Sbjct  237   EDTAFEDCEKSEILDWLDNKEEKSTVFVSFGSEYFLSKQEMTEIAHGLEASKVNFVWVVR  296

Query  263   FPAAEAGEKARAIGDA-LPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             F   E    A A G++ LPEG+L+RV  RG V+EGWAPQ  IL+HSS+GGFVSHCGWSSV
Sbjct  297   FHDGE--RDAAANGESYLPEGFLKRVAGRGLVLEGWAPQAAILQHSSVGGFVSHCGWSSV  354

Query  86    MEALKFGVPIIAMPMQLDQPLNAR  15
             ME+++FGVPIIAMPM LDQP+NAR
Sbjct  355   MESMRFGVPIIAMPMHLDQPVNAR  378



>ref|XP_011094502.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 221/383 (58%), Positives = 280/383 (73%), Gaps = 11/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             + T Q++I VLMFPWLAHGHI P+L LA+ LTKR+F I++CSTP NLSSIK ++ EK A 
Sbjct  4     LATDQKTIHVLMFPWLAHGHISPYLELAKRLTKRDFIIHLCSTPANLSSIKHKIGEKFAF  63

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE+ LPSLP+LPP YHTTNGLPP LMPTLK A DM+KP FL +L ++KPDL++YDF
Sbjct  64    SIRLVEIHLPSLPNLPPCYHTTNGLPPDLMPTLKLAFDMAKPNFLRILASVKPDLLIYDF  123

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW P  A+   IPAV F++  +   +Y+FH     P   +PF  +  RD+E +   +L
Sbjct  124   LQPWAPLAASRYKIPAVEFITSSSTMTAYMFHFFM-KPKVAFPFETIRYRDYELVHQAKL  182

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
               P +++  +  +  R       S+ I+LIK FR++E KY D LS L+ K+ +PVGPLV+
Sbjct  183   LAPDDRVRREAFEGVR------RSNRIVLIKGFREIELKYSDYLSTLLGKKIMPVGPLVQ  236

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
             +   +    EI EWLD K +CSTVFVSFGSEYFL +EEMEE+A GLELS VNF+WV+RFP
Sbjct  237   NPSQEVGCSEIIEWLDKKAKCSTVFVSFGSEYFLKQEEMEELAHGLELSNVNFIWVVRFP  296

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                   K   + +ALP G+L+RVG+RG VVEGWAPQ  IL H SIGGFVSHCG SS+ME+
Sbjct  297   KG----KKITLKEALPLGFLDRVGQRGMVVEGWAPQAQILGHESIGGFVSHCGCSSMMES  352

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPM LDQPLNAR+V
Sbjct  353   MKFGVPIIAMPMHLDQPLNARLV  375



>ref|XP_008231997.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=459

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 223/386 (58%), Positives = 289/386 (75%), Gaps = 14/386 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + QRSI +LM PWLAHGHI P+L LA+ LT KRNF+I+ICSTPVNL+SIK ++S+K +  
Sbjct  4     SQQRSITILMLPWLAHGHISPYLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSQKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK+A DMS   F  +L TLKPDL++YD
Sbjct  64    IEFVELHLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTTLKPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW P++A+ Q+IP+V F++  AA  S+  H  + +P+ ++PFP +YLRD+E  +   
Sbjct  124   FLQPWAPSLASLQNIPSVEFITTSAALTSFGVHHLK-NPSAKFPFPSIYLRDYEAQKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C D SS IIL KT R++E KY+D LS L+ K+ VPVGPLV
Sbjct  183   LLECS---SNGIKDGDRLQKCSDLSSDIILEKTSREIEAKYVDYLSGLMGKKIVPVGPLV  239

Query  440   RS---LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    L  D E   I +WL+ + R S V+V FGSEYFLT+EE+EE+A GLELSKV+F+WV
Sbjct  240   QEPMDLKVD-EETWIMKWLNKRERASVVYVCFGSEYFLTKEEIEEIAHGLELSKVSFIWV  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP  E G   R + + LPEG+L+RVG++G +VEGWAPQ  IL+H S+GGFVSHCGWSS
Sbjct  299   IRFPKEEKG---RRVEEVLPEGFLKRVGEKGIIVEGWAPQAKILKHFSVGGFVSHCGWSS  355

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             V+E++KFGVPIIAMPM LDQP+N+R+
Sbjct  356   VLESIKFGVPIIAMPMHLDQPINSRL  381



>ref|XP_007220462.1| hypothetical protein PRUPE_ppa005532mg [Prunus persica]
 gb|EMJ21661.1| hypothetical protein PRUPE_ppa005532mg [Prunus persica]
Length=456

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/388 (56%), Positives = 283/388 (73%), Gaps = 16/388 (4%)
 Frame = -3

Query  1157  MDTSQ-RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MD+SQ R   VLMFPWLAHGHI P+L LA+ LT RNF+IY CSTPVNL SIK ++SEK +
Sbjct  1     MDSSQQRKFSVLMFPWLAHGHISPYLELAKKLTNRNFHIYFCSTPVNLRSIKPQLSEKYS  60

Query  980   ISIKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
               I+LV+L LP   LP+LPPHYHTTNGLPPHLM TLK A D + P F N+L TL PDL++
Sbjct  61    RCIELVQLHLPYDDLPELPPHYHTTNGLPPHLMSTLKTAFDRASPNFSNILKTLHPDLLI  120

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             YDFLQPW P++A  Q+IPA+ F +  AA  S   H G   P  ++PFP +Y   +E  + 
Sbjct  121   YDFLQPWAPSLALLQNIPAIEFFTTSAAMMSVCTHHGE-KPGVKFPFPSIY---YETSKI  176

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             K L E        +SD +R   C D S  I+L+K+ R++E KYID LS+L+ K+ VPVG 
Sbjct  177   KMLLESS---SNGISDGDRAKQCSDRSCKIVLVKSSREIEAKYIDYLSDLIGKKIVPVGS  233

Query  446   LVRSLV---ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             LV+ L+    D E  +I +WL+ + R S V+VSFGSEYFL++EE+EE+A GLE+SKV+F+
Sbjct  234   LVQDLIEQEVDSEETKIMKWLNTRERSSVVYVSFGSEYFLSKEEIEEIAHGLEISKVSFI  293

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WVIRFP  E G +   + + LPEG+ ERVG++G +V+GWAPQ  +L+HSS GGFVSHCGW
Sbjct  294   WVIRFPKEEKGTR---VEEVLPEGFFERVGEKGIIVDGWAPQAKVLKHSSAGGFVSHCGW  350

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARV  12
             SSV+E++KFGVPI+AMPM LDQP+NAR+
Sbjct  351   SSVLESIKFGVPIVAMPMHLDQPINARI  378



>ref|XP_006342241.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=457

 Score =   420 bits (1080),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 287/391 (73%), Gaps = 13/391 (3%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             + A M+ +Q+SIRVLMFPWL HGHI PF  LA+ L KRNF I++CSTP N  SIK+++  
Sbjct  1     MDASMEINQKSIRVLMFPWLGHGHISPFFELAKKLVKRNFTIFLCSTPANFISIKQKLIN  60

Query  989   KDAIS-IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
             +D    I LV+L+LPSLPDLPPHYHTTNGLP HLM TLKKA   ++P F  ++++++PDL
Sbjct  61    EDLTEKIHLVDLRLPSLPDLPPHYHTTNGLPSHLMSTLKKAFAKARPIFTQIINSIEPDL  120

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEF-  636
             ++YD LQPW P +AA ++IP+V+F++  A   SY+FH  R +P  E+PF  +Y RD+E  
Sbjct  121   LIYDLLQPWAPKVAAEKNIPSVVFVTSSATMFSYMFHTFR-YPNSEFPFSSIYYRDYELA  179

Query  635   --IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRC  462
               ++N+ L EP EQ      D   +  C   SS+I+LIK F++++G+Y D +S+L KKR 
Sbjct  180   RMVKNQEL-EPIEQ---QQKDNTSVKLCFKRSSNIVLIKGFKEIDGQYCDYISSLTKKRV  235

Query  461   VPVGPLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             V VGPLV+   ++  N +I  WL+ K + ST+FVSFGSEYFL++E+ EE+A GLE S+VN
Sbjct  236   VLVGPLVQEPTSEDGNSQILTWLNQKSKGSTIFVSFGSEYFLSQEDREEIAHGLEKSRVN  295

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP    GEK + +  ALP G+ ++VG+RG VVE WAPQ  IL + +IGGFVSHC
Sbjct  296   FIWVVRFP---KGEKLK-LEQALPRGFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHC  351

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GW+SVME++K GVPIIAMPM LDQPLNAR+V
Sbjct  352   GWNSVMESMKIGVPIIAMPMHLDQPLNARLV  382



>ref|XP_007220458.1| hypothetical protein PRUPE_ppa005471mg [Prunus persica]
 gb|EMJ21657.1| hypothetical protein PRUPE_ppa005471mg [Prunus persica]
Length=459

 Score =   420 bits (1079),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/386 (57%), Positives = 287/386 (74%), Gaps = 14/386 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             +  +SI VLM PWLAHGHI PFL LA+ LT KRNF+I+ICSTPVNL+SIK ++S K +  
Sbjct  4     SEHKSITVLMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK+A DMS   F N+L TLKPDL++YD
Sbjct  64    IEFVELHLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSNILTTLKPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             F+ PW P+ A+ Q+IP+V F++  AA  S   H  + +P  ++PFP +YLRD+E  +   
Sbjct  124   FIPPWAPSQASLQNIPSVRFITTSAALSSLRVHHLK-NPRVKFPFPSIYLRDYEAKKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L EP      D++D +R+  C   S +IIL+KT R++E KY+D LS L+ K+ VPVGPLV
Sbjct  183   LLEPS---SNDINDGDRVQQCSARSCNIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLV  239

Query  440   RS---LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    L  D E   I +W++ + R S V+V FGSEYFL+ E++EEVA GLELSKV+F+WV
Sbjct  240   QEPMDLKVD-EETWIMKWMNKRERSSVVYVCFGSEYFLSREQIEEVAHGLELSKVSFIWV  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP  E G++   + + LPEG+LERVG++G +VEGWAPQ  IL+HS +GGFVSHCGWSS
Sbjct  299   IRFPKEEKGKR---VEEVLPEGFLERVGEKGIIVEGWAPQANILKHSRVGGFVSHCGWSS  355

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             V+E++KFGVPIIAMPM LDQP+NAR+
Sbjct  356   VLESIKFGVPIIAMPMHLDQPINARL  381



>gb|AHK12770.1| flavanone-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
protein 4 [Litchi chinensis]
Length=449

 Score =   419 bits (1078),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 274/386 (71%), Gaps = 12/386 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  +++  VLM PWLAHGHI P+L L++ L  RN  IY CSTPVNL+SIK  +S K + 
Sbjct  1     MDARKKNFSVLMLPWLAHGHISPYLELSKKLASRNVRIYFCSTPVNLNSIK--LSPKHSN  58

Query  977   SIKLVELQLPS-LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             SI+LVEL+LPS  PDLPPHYHTTNGLPPHLM TLK A DM+   F NLL  LKPDLV+YD
Sbjct  59    SIQLVELRLPSSFPDLPPHYHTTNGLPPHLMTTLKHAFDMAASAFSNLLQNLKPDLVIYD  118

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             F+QPW  A+A+A +IPAV FL   A   S+L H  R H    +PF  +++ D+   +   
Sbjct  119   FVQPWASAVASALNIPAVHFLVFSAVTTSFLVHFSRNHADCPFPFSSIFVHDYMKPKVTH  178

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D ER     + S ++IL KTFR+LEGKYID LS LV K+ VPVGP+V
Sbjct  179   LLESS---SNGIQDKERYFQSFELSRNVILAKTFRELEGKYIDLLSVLVNKKIVPVGPIV  235

Query  440   RSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
               ++ D E+   EI +WLD K R STVFVSFGSEYFL++EE EE A GLELS+VNF+WV+
Sbjct  236   ADIIEDQEDDEMEIMKWLDKKERSSTVFVSFGSEYFLSKEEREETAHGLELSQVNFIWVL  295

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP  E  E    + +ALP G+LER  +RGK++E WAPQ  IL H+SIGGFVSHCGWSSV
Sbjct  296   RFPNGEKME----VKEALPLGFLERTKERGKIIENWAPQAKILGHTSIGGFVSHCGWSSV  351

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             +E++K GVPI+A PM LDQPLNAR+V
Sbjct  352   IESMKLGVPIVATPMHLDQPLNARLV  377



>gb|KCW51498.1| hypothetical protein EUGRSUZ_J01015, partial [Eucalyptus grandis]
Length=443

 Score =   419 bits (1078),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 211/383 (55%), Positives = 285/383 (74%), Gaps = 8/383 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  QR I+VLM PWLAHGH+ P+L LA+ L+ RNF+IY+CSTPVNLSSIK ++SEK + 
Sbjct  1     MDNMQRPIKVLMLPWLAHGHVSPYLELAKRLSTRNFHIYLCSTPVNLSSIKPKISEKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+ PGF +++ +L PDL++++F
Sbjct  61    SIELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFGDIVTSLGPDLLIHEF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW   +A +  +P+V+  + GA   S++FH+ + +   ++PF  + L D+E  + ++ 
Sbjct  121   LQPWAAEVAKSHGLPSVVLFNVGAGTISFMFHMIK-NTGNKFPFEAIRLHDYELAKIRK-  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 +     V++ +R+   ++ SS+ IL+KTFR+++GKY+D LS+L+ K+ + VGPLV 
Sbjct  179   --AADDSTARVNEKDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLLGKKVLTVGPLVE  236

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   +   I EWLD + + ST+FVSFG+EYFLTE+E EE+A GLELS VNF+WVIRF 
Sbjct  237   DPSNTEDGDSIIEWLDKREKSSTIFVSFGTEYFLTEKEREEIAHGLELSNVNFIWVIRFS  296

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E+ E    + +ALP+G+LERV  RG V++GWAPQG ILEH SIGGFVSHCGW S+ME+
Sbjct  297   VEESVE----LKEALPKGFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSIMES  352

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPMQ DQPLNAR+V
Sbjct  353   MKSGVPIIAMPMQHDQPLNARMV  375



>ref|XP_010034309.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=452

 Score =   419 bits (1078),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 211/383 (55%), Positives = 285/383 (74%), Gaps = 8/383 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  QR I+VLM PWLAHGH+ P+L LA+ L+ RNF+IY+CSTPVNLSSIK ++SEK + 
Sbjct  1     MDNMQRPIKVLMLPWLAHGHVSPYLELAKRLSTRNFHIYLCSTPVNLSSIKPKISEKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+ PGF +++ +L PDL++++F
Sbjct  61    SIELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFGDIVTSLGPDLLIHEF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW   +A +  +P+V+  + GA   S++FH+ + +   ++PF  + L D+E  + ++ 
Sbjct  121   LQPWAAEVAKSHGLPSVVLFNVGAGTISFMFHMIK-NTGNKFPFEAIRLHDYELAKIRK-  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 +     V++ +R+   ++ SS+ IL+KTFR+++GKY+D LS+L+ K+ + VGPLV 
Sbjct  179   --AADDSTARVNEKDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLLGKKVLTVGPLVE  236

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   +   I EWLD + + ST+FVSFG+EYFLTE+E EE+A GLELS VNF+WVIRF 
Sbjct  237   DPSNTEDGDSIIEWLDKREKSSTIFVSFGTEYFLTEKEREEIAHGLELSNVNFIWVIRFS  296

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E+ E    + +ALP+G+LERV  RG V++GWAPQG ILEH SIGGFVSHCGW S+ME+
Sbjct  297   VEESVE----LKEALPKGFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSIMES  352

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPMQ DQPLNAR+V
Sbjct  353   MKSGVPIIAMPMQHDQPLNARMV  375



>ref|XP_008231988.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=451

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 288/386 (75%), Gaps = 14/386 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + +R++ +LM PWLAHGHI PFL LA+ LT KRNF+I+ICSTPVNL+SIK ++S K +  
Sbjct  4     SERRTLTILMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPP YHTTNGLPPHLM TLK+A DMS   F  +L  LKPDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPQYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTALKPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW P++A+ Q+IP+V F++  AA  S+  H  R +P++++PFP +YLRD+E  +   
Sbjct  124   FLQPWAPSLASLQNIPSVEFITTSAALTSFSVHHLR-NPSDKFPFPSIYLRDYEAKKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + + +R+  C D SS IIL+KT R++E KY+D LS L+ K+ VPVGPLV
Sbjct  183   LLESS---SNGIKNGDRVLQCSDLSSGIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLV  239

Query  440   RS---LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    L  D E   I +WL+ + R S V+V FGSEYFL+ E++EE+A GLELSKV+F+WV
Sbjct  240   QEPMDLKVDDET-WIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSKVSFIWV  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP  E G +   + + LPEG+LERVG++G +VEGWAPQ  IL+HSS+GGFVSHCGWSS
Sbjct  299   IRFPKEEKGNR---VEEVLPEGFLERVGEKGVIVEGWAPQAKILKHSSVGGFVSHCGWSS  355

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             V+E++KFGVPIIAMPM LDQP+N+R+
Sbjct  356   VLESIKFGVPIIAMPMHLDQPINSRL  381



>ref|XP_007219141.1| hypothetical protein PRUPE_ppa016015mg [Prunus persica]
 gb|EMJ20340.1| hypothetical protein PRUPE_ppa016015mg [Prunus persica]
Length=451

 Score =   416 bits (1070),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 285/386 (74%), Gaps = 14/386 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + +R++ +LM PWLAHGHI PFL LA+ LT KRNF+I+ICSTPVNL+SIK ++S K +  
Sbjct  4     SERRTLTILMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPP YHTTNGLPPHLM TLK+A DMS   F  +L  LKPDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPQYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTALKPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW P++A+ Q+IP+V F++  AA  S+  H  R +P +++PFP +YLRD+E  +   
Sbjct  124   FLQPWAPSLASLQNIPSVEFITTSAALTSFSVHHLR-NPIDKFPFPSIYLRDYEAKKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C D SS IIL+KT R++E KY+D LS L+ K+ VPVGPLV
Sbjct  183   LLESS---SNGIKDGDRVLQCSDLSSGIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLV  239

Query  440   RS---LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    L  D E   I +WL+ + R S V+V FGSEYFL+ E++EE+A GLELSKV+F+WV
Sbjct  240   QEPMDLKVD-EETWIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSKVSFIWV  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP  E G +   + + LPE +LERVG++G +VEGWAPQ  IL HSS+GGFVSHCGWSS
Sbjct  299   IRFPKEEKGNR---VEEVLPEAFLERVGEKGVIVEGWAPQAKILNHSSVGGFVSHCGWSS  355

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             V+E++KFGVPIIAMPM LDQP+N+R+
Sbjct  356   VLESIKFGVPIIAMPMHLDQPINSRL  381



>ref|XP_009604940.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 276/383 (72%), Gaps = 11/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I VLM PWLAHGHI PFL LA  +  RN +IY+CSTPVNL+S+KKRV+   + 
Sbjct  1     MEGKKSTISVLMLPWLAHGHISPFLELATKVANRNLHIYMCSTPVNLNSVKKRVAGMYSR  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPS PDLPPHYHTT GLP HL+ TL KA +MS P F  +L TL PDLV+YDF
Sbjct  61    SIELVELHLPSFPDLPPHYHTTKGLPTHLISTLNKAFEMSTPFFSKILQTLNPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
               PW    A++ +IPAV FL+  AA  +   H+    P E +PFPE+YL ++E +  K+ 
Sbjct  121   NLPWAADCASSVNIPAVQFLTFSAAVIALGIHM-YDKPGEMFPFPEIYLHEYEMLIIKKA  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 +Q+ G        D  L  S  IIL+KT R +EGKY+D LS+LV K+ VPVG LV+
Sbjct  180   L---DQLPG---KKFPFDEALRRSRDIILVKTCRDIEGKYMDYLSSLVSKKVVPVGALVQ  233

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               +    + EI +WLD K + STVFVSFGSEYFL+++++  VA GLELSKVNF+WVIRFP
Sbjct  234   ESIDQDGHEEITQWLDKKDKGSTVFVSFGSEYFLSKDKIHVVAQGLELSKVNFIWVIRFP  293

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E      +  DALPEG+LERVG+RG ++EGWAPQ  IL+HSS+GGFVSHCGW+S+ME+
Sbjct  294   QGE----RISTQDALPEGFLERVGERGMILEGWAPQAKILQHSSVGGFVSHCGWNSLMES  349

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPMQ+DQP+NAR+V
Sbjct  350   MKFGVPIIAMPMQVDQPMNARLV  372



>ref|XP_008231983.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=460

 Score =   415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 221/388 (57%), Positives = 286/388 (74%), Gaps = 15/388 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             +  +SI VLM PWLAHGHI PFL LA+ LT KRNF+I+ICSTPVNL+SIK ++S K +  
Sbjct  4     SEHKSITVLMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK+A DMS   F  +L TLKPDLV+YD
Sbjct  64    IEFVELHLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTTLKPDLVIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             F+ PW P++A+ Q+IP+V F++  AA  S   H  + +P   +PFP +YLRD+E  +   
Sbjct  124   FIPPWAPSLASLQNIPSVRFVTTSAALSSLRVHHLK-NPRVNFPFPSIYLRDYEAKKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L EP      D++D +R+  C   S +IIL+KT R++E KY+D LS L+ K+ VPVGPLV
Sbjct  183   LLEPS---SNDINDGDRVQQCSARSCNIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLV  239

Query  440   RS---LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    L  D E   I +WL+ + R S V+V FGSEYFL+ E++EE+A GLELS V+F+WV
Sbjct  240   QEPMDLKVD-EETWIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSNVSFIWV  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVV-EGWAPQGMILEHSSIGGFVSHCGWS  93
             IRFP  E G++   + +  PEG+LERVG++G +V EGWAPQ  IL+HSS+GGFVSHCGWS
Sbjct  299   IRFPKEEKGKR---VEEVFPEGFLERVGEKGIIVLEGWAPQANILKHSSVGGFVSHCGWS  355

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SV+E++KFGVPIIAMPM LDQP+NAR+V
Sbjct  356   SVLESIKFGVPIIAMPMHLDQPINARLV  383



>ref|XP_006360518.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=437

 Score =   414 bits (1064),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 221/383 (58%), Positives = 273/383 (71%), Gaps = 17/383 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I VLM PWLAHGHI PFL LA+ L  +       +  VNL+SIKKRVSEK + 
Sbjct  1     MEAKKHTISVLMLPWLAHGHINPFLELAKKLANK------YNLMVNLNSIKKRVSEKYSQ  54

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+L+EL LPSLPDLPPHYHTTNGLPPHLM TLK A +++ P F  +L TL PDLV++D+
Sbjct  55    SIELIELHLPSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLHPDLVIHDY  114

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPWV   A++ +IPAV F +  A   +   H+   +  E++PFPE+YLR+HE I  K+ 
Sbjct  115   NQPWVTDSASSMNIPAVQFPTFSATVVALAIHMSE-NTEEKFPFPEIYLREHEMISLKK-  172

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                   ID   S     D  +  S  IIL+KT R  EGKYID LSNL  K+ VPVG LV+
Sbjct  173   -----DIDEVPSKKFPYDEAISRSHDIILVKTCRDFEGKYIDYLSNLTSKKIVPVGSLVQ  227

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               +   +  EI +WLD K + STVFVSFGSEYFL++EE+  VA GLELSKVNF+WVIRFP
Sbjct  228   ESMDQDDYEEIAQWLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFP  287

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+   I DALPEGYLERVG+RG ++EGWAPQ +IL+H SIGGFVSHCGWSS ME+
Sbjct  288   ---QGERLN-IRDALPEGYLERVGERGMIMEGWAPQALILQHPSIGGFVSHCGWSSFMES  343

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFGVPIIAMPM +DQP+NAR+V
Sbjct  344   MKFGVPIIAMPMHIDQPMNARLV  366



>ref|XP_009596289.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=451

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 274/384 (71%), Gaps = 12/384 (3%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKR-VSEKDAISI  972
             +Q  IRVLMFPWL HGHI PFL LA+    RNF IY+CSTP N +SIK++ +SE     I
Sbjct  3     NQEPIRVLMFPWLGHGHISPFLELAKTFVTRNFIIYLCSTPANFTSIKQKLISENLTEKI  62

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              LVEL+LPSLP+LP HYHTTNGLPPHLM TLKKA  MS P F  +++T+KPDL++YD LQ
Sbjct  63    YLVELRLPSLPNLPSHYHTTNGLPPHLMSTLKKAFKMSNPMFTKIINTIKPDLLLYDLLQ  122

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR--NKRL  618
             PW P  A   +IPAV+F++  +   SY+FH  R +P+ ++PFP +Y RD+E  R    + 
Sbjct  123   PWAPRDALENNIPAVVFVTSSSVMFSYMFHTFR-YPSSKFPFPSIYYRDYEITRMLENQD  181

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              EP EQ      D   +  C   SS+I+LIK F++++GKY + LS L KK+ +PVGPLV+
Sbjct  182   LEPIEQ---QQKDNTSVKLCFGRSSNIVLIKGFKEIDGKYSNYLSRLTKKKIIPVGPLVQ  238

Query  437   SLVADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
                ++ +N  +I  WL+ K + S+VFVSFGSEYFLT+E+ EE+A GLE S VNF+WV+RF
Sbjct  239   QPTSEDDNSSQILTWLNQKEKGSSVFVSFGSEYFLTKEDKEEIAHGLEQSGVNFIWVVRF  298

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P          +  ALPEG+ +RVG+RG VVE WAPQ  IL + +IGGFVSHCGW+SVME
Sbjct  299   PKG----GNLKLEQALPEGFFKRVGQRGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVME  354

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
              +KFGVPIIAMPM LDQPLNAR+V
Sbjct  355   GMKFGVPIIAMPMHLDQPLNARLV  378



>gb|KCW53337.1| hypothetical protein EUGRSUZ_J02585, partial [Eucalyptus grandis]
Length=432

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 283/384 (74%), Gaps = 12/384 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T++R+I VLM PWLAHGHI PFL LA+ L+KRNF+I++CS+PVNLSSIK  +  +   
Sbjct  1     MATTRRTISVLMLPWLAHGHIGPFLELAKKLSKRNFHIFLCSSPVNLSSIK--IPHEYCS  58

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             +I+LVEL +PSLP LPP YHTT GLPPHLMP LK A DM+ P   +++   +P+++++D+
Sbjct  59    AIELVELHVPSLPGLPPQYHTTRGLPPHLMPKLKMAFDMAGPNLSDIISDRQPNMLIFDY  118

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L PWVP +A +  IPA+ F S  A A S+  H  +  P +EYPF  + L+DH   + +  
Sbjct  119   LLPWVPEVARSHGIPAINFASVAAGASSFALHSIK-RPGDEYPFKAMSLQDHWMAKYRNQ  177

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  +  +  +SDTERI  C+D  S +I +KTFR+LEGKYID LS+L++K+ VPVGPLV+
Sbjct  178   ME--QASESGMSDTERIMRCIDQPSGLIFLKTFRELEGKYIDYLSDLLEKKVVPVGPLVQ  235

Query  437   SLVA-DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               V  DG++  I EWLD K R ST+FVSFG+EYFLTE+E EE+A GLELS VNF+W ++F
Sbjct  236   DPVQEDGDH--ITEWLDKKERSSTIFVSFGTEYFLTEKEREEIAYGLELSSVNFIWAVKF  293

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P     E+   + +ALP  +LERV  RG+V+EGWAPQ  IL H S+GGFVSHCGWSSVME
Sbjct  294   PV----EEHITLEEALPREFLERVRDRGQVIEGWAPQARILAHQSVGGFVSHCGWSSVME  349

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++KFGVPIIAMPM LDQPL+AR+V
Sbjct  350   SMKFGVPIIAMPMHLDQPLDARIV  373



>ref|XP_010033637.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=448

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 283/384 (74%), Gaps = 12/384 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T++R+I VLM PWLAHGHI PFL LA+ L+KRNF+I++CS+PVNLSSIK  +  +   
Sbjct  1     MATTRRTISVLMLPWLAHGHIGPFLELAKKLSKRNFHIFLCSSPVNLSSIK--IPHEYCS  58

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             +I+LVEL +PSLP LPP YHTT GLPPHLMP LK A DM+ P   +++   +P+++++D+
Sbjct  59    AIELVELHVPSLPGLPPQYHTTRGLPPHLMPKLKMAFDMAGPNLSDIISDRQPNMLIFDY  118

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L PWVP +A +  IPA+ F S  A A S+  H  +  P +EYPF  + L+DH   + +  
Sbjct  119   LLPWVPEVARSHGIPAINFASVAAGASSFALHSIK-RPGDEYPFKAMSLQDHWMAKYRNQ  177

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  +  +  +SDTERI  C+D  S +I +KTFR+LEGKYID LS+L++K+ VPVGPLV+
Sbjct  178   ME--QASESGMSDTERIMRCIDQPSGLIFLKTFRELEGKYIDYLSDLLEKKVVPVGPLVQ  235

Query  437   SLVA-DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               V  DG++  I EWLD K R ST+FVSFG+EYFLTE+E EE+A GLELS VNF+W ++F
Sbjct  236   DPVQEDGDH--ITEWLDKKERSSTIFVSFGTEYFLTEKEREEIAYGLELSSVNFIWAVKF  293

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P     E+   + +ALP  +LERV  RG+V+EGWAPQ  IL H S+GGFVSHCGWSSVME
Sbjct  294   PV----EEHITLEEALPREFLERVRDRGQVIEGWAPQARILAHQSVGGFVSHCGWSSVME  349

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++KFGVPIIAMPM LDQPL+AR+V
Sbjct  350   SMKFGVPIIAMPMHLDQPLDARIV  373



>ref|XP_010248422.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nelumbo 
nucifera]
Length=531

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/383 (56%), Positives = 279/383 (73%), Gaps = 10/383 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT      VLM PWLAHGHI PFL + + L+KRNF++Y CSTPVNL SI+ ++SEK   
Sbjct  1     MDTKPHCFTVLMLPWLAHGHISPFLEVGKRLSKRNFHVYFCSTPVNLCSIRDQLSEKIFP  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE+ LP+LP LPPHYHTT GLPPHLMPTLK+A DM+KP FLNLL TLKPDL++YDF
Sbjct  61    SIQLVEIHLPTLPGLPPHYHTTKGLPPHLMPTLKQAFDMAKPSFLNLLRTLKPDLLIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +QPW P +A++  IPAV FL  G A  ++ +H+ + +P  ++PFP +YL  HE   ++++
Sbjct  121   IQPWAPTLASSLDIPAVQFLITGGATSAFFYHICK-NPGVKFPFPAIYLEKHE---DRKI  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +  E     ++D  R+   +D SS  I+ KTFR++E KYID  S +  K  +PVGPLV 
Sbjct  177   TQLLESSANGLTDKVRLIQSIDQSSRFIMFKTFREIEEKYIDYYSVITGKEILPVGPLVL  236

Query  437   SLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
                 + +N   E  EWL+ K  CS VFVSFGSE+FL++ E+EE+A GLELS V+F+WV+R
Sbjct  237   DTTQNEDNQQWESMEWLNKKDPCSVVFVSFGSEFFLSKAELEEMAYGLELSGVSFIWVVR  296

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP    GEK  ++ +ALPEG+L +VG++G VVEGWAPQ  IL+HSSIGGFVSH G  SVM
Sbjct  297   FP---EGEKM-SLDEALPEGFLGKVGEKGIVVEGWAPQAQILDHSSIGGFVSHSGSGSVM  352

Query  83    EALKFGVPIIAMPMQLDQPLNAR  15
             E +KFGVP++AMPM LDQP N+R
Sbjct  353   EGMKFGVPLVAMPMHLDQPTNSR  375



>ref|XP_009795814.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=451

 Score =   412 bits (1060),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 215/384 (56%), Positives = 278/384 (72%), Gaps = 12/384 (3%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKR-VSEKDAISI  972
             +Q  IRVLMFPWL HGHI PFL LA+ L  RNF IY+CSTP N +SIK++ ++E     I
Sbjct  3     NQDPIRVLMFPWLGHGHISPFLELAKKLVTRNFIIYLCSTPANFTSIKQKLINENLTEKI  62

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              LVEL+LPSLP+LPPHYHTTNGLPPHLM TLKKA  MS P F  +++T+KPDL++YD LQ
Sbjct  63    YLVELRLPSLPNLPPHYHTTNGLPPHLMSTLKKAFKMSNPMFTKIVNTIKPDLLLYDLLQ  122

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR--NKRL  618
             PW P +A   +IPAV+F++  +   SY FH  R +P+ ++PFP +Y RD+E  R    + 
Sbjct  123   PWAPRIALENNIPAVVFVTSSSVMFSYTFHTFR-YPSSKFPFPFIYYRDYEITRMLENQD  181

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              EP EQ      D   +  C   SS+I+LIK F++++GKY + LS L KK+ +PVGPLV+
Sbjct  182   LEPIEQ---QQKDNTSVKLCFGRSSNIVLIKGFKEIDGKYSNYLSRLTKKKVIPVGPLVQ  238

Query  437   SLVADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
                ++ +N  +I  WL+ K + S+VFVSFGSEYFLT+E+ EE+A GLE S VNF+WV+RF
Sbjct  239   EPTSEDDNSSQILTWLNQKEKGSSVFVSFGSEYFLTKEDREEIAHGLEQSGVNFIWVVRF  298

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P    G K + +  ALPEG+ +RVG+RG +VE WAPQ  IL + +IGGF SHCGW+SVME
Sbjct  299   P---KGGKLK-LEQALPEGFFKRVGERGMIVEDWAPQAKILGNPNIGGFFSHCGWNSVME  354

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
              +KFGVPIIAMPM LDQPLNAR+V
Sbjct  355   GMKFGVPIIAMPMHLDQPLNARLV  378



>ref|XP_004244816.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=440

 Score =   412 bits (1058),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 273/383 (71%), Gaps = 14/383 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I VLM PWLAHGHI P+L LA+ L  RN +IYICSTPV LSSIKKRV+++ + 
Sbjct  1     MEAKKNTISVLMLPWLAHGHINPYLELAKKLANRNLHIYICSTPVCLSSIKKRVTQEYSQ  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI LV+  LPSLP+LPPHYHTTNGLPPHLM TLK   +MS P F  +L TL+PDLV+YDF
Sbjct  61    SIDLVDFHLPSLPNLPPHYHTTNGLPPHLMTTLKSTFEMSTPNFSKILQTLQPDLVIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
               PW    A++ +IPAVLFL+ GAA  +   HV    P E +PF E YL + E +  K  
Sbjct  121   NLPWAADCASSVNIPAVLFLTFGAAVIALGIHVC-DRPEEMFPFTEFYLHEQEILSLKNT  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
               P  +           D  L  S  I+LIKT R  EGKYID LS+LV K+ VPVG LV+
Sbjct  180   V-PGWKFP--------FDEGLRRSQDIVLIKTCRGFEGKYIDYLSSLVFKKIVPVGTLVQ  230

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   ++ +I +WLD K R S VFVSFGSEYFL++EE+ EVA GLELSKVNF+WVIRFP
Sbjct  231   ESTNKDDSEDIMQWLDKKHRGSAVFVSFGSEYFLSKEEIHEVAQGLELSKVNFIWVIRFP  290

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+ + I DALPEG+LERVG+RG + EGWAPQ  IL+H+SIGGFVSHCGWSS ME+
Sbjct  291   ---QGERTK-IRDALPEGFLERVGERGIIFEGWAPQATILQHTSIGGFVSHCGWSSFMES  346

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPMQ DQP+NA++V
Sbjct  347   MKCGVPIIAMPMQADQPMNAKLV  369



>ref|XP_009623061.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   408 bits (1049),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 216/358 (60%), Positives = 273/358 (76%), Gaps = 9/358 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+T +++IR++M PWLAHGHICPFL LA+AL+KRNF  Y+ +TPVNL+  K+R+S  D+I
Sbjct  1     METRKKNIRIVMLPWLAHGHICPFLELAKALSKRNFITYLFTTPVNLTFFKQRLSPIDSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHL-MPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              IKL+E+QLP+LP LPPHYHTTNGLPPHL M TLKKA  MSKP    +LDTLKPDL++YD
Sbjct  61    RIKLMEIQLPNLPQLPPHYHTTNGLPPHLIMNTLKKAFLMSKPDIFTILDTLKPDLIIYD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQP +P M A  +IPAVLFL+PGAA+ SY +H    +P+ +YPF E++ RD+E  +NK+
Sbjct  121   FLQPCIPTMVATLNIPAVLFLTPGAASNSYHYHRRNNNPSLDYPFREIFFRDYEHRKNKK  180

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             +F+  E  DG + +   +  C + S  I+LIKTF++LEGKYID LS L KK+ V VGPLV
Sbjct  181   IFDSLEN-DG-IDEKNGVTRCFERSHDIVLIKTFKELEGKYIDYLSILFKKKFVLVGPLV  238

Query  440   RSL-VADGE-NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             R +   DGE + EI EWL+ K +CST+FVSFGSE FL+ EE+EE+ALGLELS VNF+WV+
Sbjct  239   REIDREDGEKHCEIIEWLNEKEKCSTIFVSFGSECFLSNEEVEELALGLELSMVNFIWVV  298

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             RFP  E     + I + LP+ Y ERV  RG V+EGWAPQ  ILEHSSIGGFVSHCGWS
Sbjct  299   RFPMGE----KKNILEVLPKWYFERVENRGIVIEGWAPQERILEHSSIGGFVSHCGWS  352



>ref|XP_009601673.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=459

 Score =   412 bits (1058),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 281/387 (73%), Gaps = 7/387 (2%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             ++ +MD +Q+ +RVLMFPWL +GHI PFL LA+ L++RNF IY+CSTP+NLSSIKK +S 
Sbjct  1     MNGFMD-NQKPLRVLMFPWLGYGHISPFLELAKKLSQRNFTIYLCSTPINLSSIKKNLSP  59

Query  989   KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             + + SI+ +EL L +LP+LPP +HTTNGLPPHLM TLK+A D++ P F  +L TLKPDL+
Sbjct  60    EFSPSIQFLELNLQTLPNLPPCHHTTNGLPPHLMNTLKEAFDLASPDFTLILKTLKPDLL  119

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDFLQPW P  AA   IPAV F+S  A   SY+ HV   +P  ++PF  +  RD+E  R
Sbjct  120   IYDFLQPWAPKAAAELKIPAVEFISSSATMTSYMLHVF-NNPGIKFPFSSICYRDYEMAR  178

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
              ++  E    ++    D +R+  C   SS ++LIK+F+++EGKY D ++NL  K+ VP+G
Sbjct  179   IEK-DESSMPVEKLEEDKKRVRDCFYLSSDLVLIKSFKEIEGKYSDYITNLTGKKVVPLG  237

Query  449   PLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             PLV+    D    E+  WL+ K   ST+FVSFGSEYFL++E++ E+A GLE SKVNF+W 
Sbjct  238   PLVQEPTIDDGESELITWLNEKEEKSTIFVSFGSEYFLSKEDLLEIAYGLEKSKVNFIWP  297

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRF   E  E    + +ALP+G+  RVG RG V +GWAPQ  ILEHSSIGGFVSHCGWSS
Sbjct  298   IRFQKGEDLE----LEEALPKGFFNRVGNRGNVFKGWAPQAKILEHSSIGGFVSHCGWSS  353

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             VME++K+GVPIIAMPM +DQP+N+R+V
Sbjct  354   VMESMKYGVPIIAMPMHIDQPVNSRLV  380



>gb|EYU19795.1| hypothetical protein MIMGU_mgv1a019121mg [Erythranthe guttata]
Length=479

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 280/386 (73%), Gaps = 7/386 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT +RSIRVLM PWLAHGHI PFL LA++L  RNF  YICS+PVNL+SI++ +S K +I
Sbjct  1     MDTRERSIRVLMLPWLAHGHISPFLELAKSLAARNFVTYICSSPVNLASIRETLSPKHSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIKLV+L +P+  DLPPH HTTNGLPPHLMP+LK+ALD ++P F  LL TLKPDLVVYDF
Sbjct  61    SIKLVDLHIPATADLPPHRHTTNGLPPHLMPSLKRALDKARPAFSTLLKTLKPDLVVYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEE--YPFPELYLRDHEFIRNK  624
             LQPW P  AA Q IPAVLF + GAA  S L +     P  E  YPFP +Y R++EF    
Sbjct  121   LQPWAPEEAALQDIPAVLFFTTGAATTSLLLYHWFREPGSEYNYPFPGIYFRENEFGIYS  180

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
             R+        G+ +D +R+  C+  SS ++LIKTF  LEGKY+D LS L +K+ VP G L
Sbjct  181   RMI---HSAGGETNDDDRVRDCVKRSSDVVLIKTFGDLEGKYVDYLSQLCRKKFVPAGHL  237

Query  443   VRSLVAD-GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             V   + +  ++  + EWLD K R STVF SFG+EYFL+E E+EE+A GLE+S VNF+WV+
Sbjct  238   VNQDINNMKKDDSLIEWLDEKERRSTVFASFGTEYFLSENEVEEIACGLEMSGVNFIWVV  297

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFPA E G     I + LP G+LERVG RG VVEGWAPQ  IL H S+GGF+SHCGWSSV
Sbjct  298   RFPAGE-GRSRIEIEEKLPVGFLERVGGRGVVVEGWAPQRRILSHPSVGGFLSHCGWSSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             ME +  GVPI+A PM LDQPLNAR+V
Sbjct  357   MEGVYSGVPIVAAPMHLDQPLNARLV  382



>ref|XP_009337015.1| PREDICTED: LOW QUALITY PROTEIN: crocetin glucoside glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=457

 Score =   410 bits (1054),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 221/388 (57%), Positives = 282/388 (73%), Gaps = 12/388 (3%)
 Frame = -3

Query  1157  MDT-SQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSIKKRVSEKD  984
             MD+  QR   +LM P LAHGHI PFL L++ LT R NF+I+ CSTPVNL+SIK ++ +K 
Sbjct  1     MDSIQQRKTSILMTPXLAHGHISPFLELSKKLTSRGNFHIFFCSTPVNLNSIKPKLPQKY  60

Query  983   AISIKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             +  I+LVEL LP   LP+LPPHYHTTNGLPPHLMP LKKA DM+   F N+L TLKPDL+
Sbjct  61    SHCIELVELHLPCNELPELPPHYHTTNGLPPHLMPALKKAFDMASENFSNILKTLKPDLL  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDFLQPW P+ A +++IPAV F    AA  S+  H     P+  +PFP +YLRD+E ++
Sbjct  121   IYDFLQPWAPSRALSKNIPAVQFFPSCAAMASFGNHRHCKSPSARFPFPSIYLRDYELMK  180

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
                L + P      ++D ER+  C++ S  IILIK  +++E KYID L  L+ K  VPVG
Sbjct  181   FNNLGKSP---PNGLNDGERVQKCIEQSCKIILIKNSKEIEAKYIDYLRGLLGKVIVPVG  237

Query  449   PLVRS-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
              LV+  L  +GE  EI +WL+ + R S VFVSFG+EYFL++EE++E+ALGLELS V F+W
Sbjct  238   SLVQEPLDGEGEETEIIKWLNTRERSSVVFVSFGTEYFLSKEEIQEIALGLELSNVCFIW  297

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             VIRFP  E  +    I + L EG++ERVG+RG VVEGWAPQ  IL+HSSIGGFVSHCGWS
Sbjct  298   VIRFPVGETTK----IEEVLQEGFMERVGERGLVVEGWAPQAKILQHSSIGGFVSHCGWS  353

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SV+E++KF VPIIA+PM LDQPLNAR+V
Sbjct  354   SVVESIKFCVPIIAIPMHLDQPLNARLV  381



>gb|KCW51493.1| hypothetical protein EUGRSUZ_J01009 [Eucalyptus grandis]
Length=420

 Score =   408 bits (1049),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 218/383 (57%), Positives = 266/383 (69%), Gaps = 34/383 (9%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M     ++  LM PWLAHGHI PFL L + L++RNF+IY+CSTPVNLSSIK ++SEK + 
Sbjct  1     MRRENSTVHALMLPWLAHGHISPFLELGKRLSERNFHIYLCSTPVNLSSIKPKISEKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+ PGF N++  L P+L+VYDF
Sbjct  61    SIELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFSNIIKKLNPNLIVYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW P +A   ++PAV F S GA   S+ FH  + +  E +PF  + L D+E  +  RL
Sbjct  121   LQPWAPEIARLHNVPAVNFWSVGAGMVSFFFHAVQ-NVGEGFPFEAVRLHDYEQWKFDRL  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
             FE                                +LEGKY+D LS+LV K+ +PVGPLV+
Sbjct  180   FE-----------------------------NSAELEGKYLDYLSSLVGKKVIPVGPLVQ  210

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 +G N +I +WLD K  CS+VFVS G+EYFLT +E EE+A GLELS VNF+WVIRFP
Sbjct  211   DPGEEGGNDDIIKWLDEKEECSSVFVSCGTEYFLTVKEREEIAYGLELSNVNFIWVIRFP  270

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E+ E    + +ALP G+LERVG RG V EGWAPQ  ILEH SIGGFVSHCGWSS+ME+
Sbjct  271   IGESME----LEEALPAGFLERVGDRGLVREGWAPQTKILEHPSIGGFVSHCGWSSIMES  326

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPMQLDQPLNAR+V
Sbjct  327   MKSGVPIIAMPMQLDQPLNARIV  349



>ref|XP_006352206.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=450

 Score =   409 bits (1051),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 273/383 (71%), Gaps = 14/383 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  + +I VLM PWLAHGHI P+L LA+ L  RNF+IYICSTPV L SIKKRV+E+ + 
Sbjct  11    MEAKKNTISVLMLPWLAHGHINPYLELARKLANRNFHIYICSTPVCLRSIKKRVTEEYSQ  70

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI LV+  LPSLP+LPPHYHTTNGLPPHLM TLK   +MS P F  +L TL PDLV+YDF
Sbjct  71    SIDLVDFHLPSLPNLPPHYHTTNGLPPHLMTTLKNTFEMSTPNFSRILQTLHPDLVIYDF  130

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
               PW    A++ +IPAV FL+  AA  +   H+    P E +PFPELYLR+ E +  K  
Sbjct  131   NLPWAADCASSVNIPAVQFLTFSAAVIALGIHM-YDRPGEMFPFPELYLREQEILSLKNT  189

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
               P  +           D  L  S  I+L+KT R  EGKY+D L++LV K+ VPVG LV+
Sbjct  190   V-PGWKFP--------FDEGLRRSQDIVLMKTCRDFEGKYMDYLASLVSKKIVPVGTLVQ  240

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   ++ EI +WLD K R STVFVSFGSEYFL++EE+ EVA GLELSKVNF+WVIRFP
Sbjct  241   ESTNKDDSEEIMQWLDKKHRGSTVFVSFGSEYFLSKEEIHEVAQGLELSKVNFVWVIRFP  300

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
                 GE+   I DALPEG+LERVG+RG ++EG APQ  IL+H+SIGGFVSHCGWSS ME+
Sbjct  301   ---QGERIN-IRDALPEGFLERVGERGIIIEGLAPQATILQHTSIGGFVSHCGWSSFMES  356

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPMQ DQP+NA++V
Sbjct  357   MKCGVPIIAMPMQGDQPMNAKLV  379



>emb|CDP00191.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 276/383 (72%), Gaps = 17/383 (4%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
             +  +  VLM PWLAHGH+ P+L LA  LT RNF +Y+CS+P  LSS++ +++EK + SI 
Sbjct  3     NHATFNVLMLPWLAHGHVSPYLELAMKLTARNFNVYLCSSPATLSSVRSKLTEKFSQSIH  62

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
             LVEL LP LP+LP  YHTTNGLPPHLMPTLK A DM+KP F N+L +LKPDL++YD LQP
Sbjct  63    LVELHLPKLPELPAEYHTTNGLPPHLMPTLKDAFDMAKPNFCNVLKSLKPDLLIYDLLQP  122

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPE-LYLRDHE--FIRNKRL  618
             W P  A+A +IPAV+F+S  A   S+  H  + +P  +YP+   ++ RD+E  F+ N + 
Sbjct  123   WAPEAASAFNIPAVVFISSSATMTSFGLHFFK-NPGTKYPYGNTIFYRDYESVFVENLKK  181

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +          DT R+  C++ SS IILIK F+++EGKY D  S L  K+ VPVGPLV+
Sbjct  182   RD---------RDTYRVVNCMERSSKIILIKGFKEIEGKYFDYFSCLTGKKVVPVGPLVQ  232

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
               V D E+  I +WL+ K + STVFVSFGSEYFL++E+MEE+A GLELS V+F+WV+RFP
Sbjct  233   DPVLDDEDCRIMQWLNKKEKGSTVFVSFGSEYFLSKEDMEEIAHGLELSNVDFIWVVRFP  292

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E       I + LP+G+ ERVG+RG VV GWAPQ  IL H ++GGFVSHCGW+SVME+
Sbjct  293   KGE----NIVIEETLPKGFFERVGERGLVVNGWAPQAKILTHPNVGGFVSHCGWNSVMES  348

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +KFG+PI+AMPM LDQP+NAR++
Sbjct  349   MKFGLPIVAMPMHLDQPINARLI  371



>ref|XP_004238624.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=454

 Score =   407 bits (1047),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/385 (53%), Positives = 281/385 (73%), Gaps = 13/385 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKR-VSEKDAIS  975
             ++++SIRVLMFPWL HGHI PF  LA+ L KRNF I++ STP N  SIK++ + E     
Sbjct  4     SNEKSIRVLMFPWLGHGHISPFFELAKKLVKRNFTIFLVSTPANFISIKQKLIHENLCDK  63

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I L +L+LPSLPDLPPHYHTTNGLPPHLM TLKKA   S+P F  +++T++PDL++YD L
Sbjct  64    IHLFDLRLPSLPDLPPHYHTTNGLPPHLMSTLKKAFAKSRPIFTQIMNTIEPDLLLYDLL  123

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHE---FIRNK  624
             QPW P +A  ++IP+V+F++  A   SY+FH  R +P  ++PF  +Y RD+E    I+N+
Sbjct  124   QPWAPKVAKEKNIPSVVFVTSSATMFSYMFHNFR-YPNSQFPFSSIYYRDYELTRLIKNQ  182

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              +    E I+    D + +  C   S++I+LIK F++++G+Y + +S+L KKR VPVGPL
Sbjct  183   EM----ETIEQHQRDNKSVKMCFKRSTNIVLIKGFKEIDGQYCEYISSLTKKRVVPVGPL  238

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             V+   ++  N +I  WL+ K + ST+FVSFGSEYFL++E+ EE+A GLE S+VNF+WV+R
Sbjct  239   VQEQTSEDNNSQILTWLNQKSKGSTIFVSFGSEYFLSQEDREEIAHGLEQSRVNFIWVVR  298

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP    GEK + +  ALP  + ++VG+RG VVE WAPQ  IL + +IGGFVSHCGW+SV+
Sbjct  299   FP---KGEKLK-LEQALPRDFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVL  354

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++K GVPIIAMPM LDQPLNAR+V
Sbjct  355   ESMKIGVPIIAMPMHLDQPLNARLV  379



>ref|XP_008344515.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=437

 Score =   407 bits (1045),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 285/387 (74%), Gaps = 16/387 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT--KRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
              RSI +LM PWLAHGHI PFL LA+ LT  + N   YICSTPVNL+SIK ++SEK +  I
Sbjct  7     HRSISILMLPWLAHGHISPFLELAKKLTHKRNNLXFYICSTPVNLTSIKPKLSEKYSHCI  66

Query  971   KLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             + VEL LP   LP+LPPHYHTTNGLPPHLM TLKKA DMS   F N+L TLKPDL++YDF
Sbjct  67    EFVELHLPHDELPELPPHYHTTNGLPPHLMSTLKKAFDMSSSNFSNVLQTLKPDLLIYDF  126

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW P++A + +IPAV F +  AA    +F     + + ++PFP ++LRD+E     R+
Sbjct  127   LQPWAPSLALSHNIPAVEFCTINAATIISIFANHFKNSSLKFPFPGIHLRDYEI----RM  182

Query  617   FEPPEQIDGD-VSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             F+   +   + + D +RI  C   S +IIL KT R++E KYID LS+LV K+ VPVGPLV
Sbjct  183   FKNQVEFSSNGLKDGDRIQQCSSSSCNIILAKTSREIEAKYIDYLSDLVGKKIVPVGPLV  242

Query  440   RSLV---ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +  +    D E+P I +WL+ + + S V+VSFGSEYFL++EE+EE+A GLELSKV+F+WV
Sbjct  243   QDPLDQKTDEESP-IIQWLNKREKSSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWV  301

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP     +K   + + LP+G++ERVG+RG +VEG APQ  IL+H S+GGFVSHCGWSS
Sbjct  302   IRFPKE---DKTTKVEEVLPKGFVERVGERGMIVEGXAPQAKILQHPSVGGFVSHCGWSS  358

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             V+E++KFGVPIIA+PMQLDQP+NA++V
Sbjct  359   VLESIKFGVPIIALPMQLDQPVNAKLV  385



>ref|XP_008345539.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=451

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 279/382 (73%), Gaps = 13/382 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT--KRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
              RSI +LM  WLAHGHI PFL LA+ LT  + N + YICSTPVNL+SIK ++SEK +  I
Sbjct  7     HRSISILMLXWLAHGHISPFLELAKKLTHKRNNLHFYICSTPVNLTSIKPKLSEKYSHCI  66

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             + VEL LP   +LPPHYHTTNGLPPHL+ TLKKA DMS   F N+L TLKPDL++YDFLQ
Sbjct  67    EFVELHLPH-DELPPHYHTTNGLPPHLISTLKKAFDMSSSNFSNILQTLKPDLLIYDFLQ  125

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
             PW P++A + +IPAV F +  AA     F +   + + ++PFP ++LRD+E    K    
Sbjct  126   PWAPSLALSHNIPAVEFCTMNAATIISTFVIHFNNSSLKFPFPXIHLRDYEIKMXKNQM-  184

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL  432
               E +   + D +RI  C   S +IIL+KT R++E KYID LS LV K+ VPVGPLV+  
Sbjct  185   --EFLSNGLXDGDRIQQCCSSSCNIILVKTSREIEAKYIDYLSXLVGKKIVPVGPLVQDP  242

Query  431   V---ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
             +    D E+P I +WL+ + +CS V+VSFGSEYFL++EE+EE+A GLELSKV+F+WVIRF
Sbjct  243   LGQKTDEESP-IIQWLNKREKCSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWVIRF  301

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P     +K   + + LP+ ++ERVG+RG +VEGWAPQ  IL+H S+GGFVSHCGWSSV+E
Sbjct  302   PKE---DKTTKVEEVLPKWFVERVGERGXIVEGWAPQAKILQHPSVGGFVSHCGWSSVLE  358

Query  80    ALKFGVPIIAMPMQLDQPLNAR  15
             ++KFGVPIIAMPMQLDQP+NA+
Sbjct  359   SIKFGVPIIAMPMQLDQPVNAK  380



>ref|XP_009796593.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=458

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 278/384 (72%), Gaps = 12/384 (3%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKR-VSEKDAISI  972
             +Q+ +R+LMFPWL HGHI PFL LA+ L  RNF I++CSTP N  SIK++ ++E     I
Sbjct  9     NQKPVRILMFPWLGHGHISPFLELAKKLITRNFTIFLCSTPANFISIKQKLINENLTEKI  68

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              +VEL+LPS PDLPPHYHTTNGLPPHLM TLKKA   S+P F  +L+T++PDL++YD LQ
Sbjct  69    HVVELRLPSFPDLPPHYHTTNGLPPHLMSTLKKAFAKSRPIFSQILNTVEPDLLLYDLLQ  128

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPF-PELYLRDHEFIR--NKR  621
             PW P +A  ++IPAV+F++  A   SY+FH  R +P  E+PF   +Y RD+E  R    +
Sbjct  129   PWAPKLALEKNIPAVVFVTSSATMFSYMFHTFR-YPNMEFPFSSSIYYRDYELTRMLKNQ  187

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
               EP EQ   D +    +  C   S  I+LIK F++++GKY D +S+L KK+ +PVGPLV
Sbjct  188   DLEPIEQQQKDKTS---VKLCFKRSFDIVLIKGFKEIDGKYCDYISSLTKKKIIPVGPLV  244

Query  440   RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
             +   ++  N +I  WL+ K + STVFVSFGSEYFL++E+ EE+A GLE S+VNF+WV+RF
Sbjct  245   QEPTSEDGNSQILTWLNQKEKGSTVFVSFGSEYFLSQEDREEIAHGLEQSRVNFIWVLRF  304

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P    GEK + +  ALP+G+ ++VG+RG VVE WAPQ  IL + +IGGFVSHCGW+SVME
Sbjct  305   P---KGEKLK-LEQALPQGFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVME  360

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++K GVPIIAMPM LDQPLN R+V
Sbjct  361   SMKLGVPIIAMPMHLDQPLNTRLV  384



>emb|CDO99874.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/387 (54%), Positives = 277/387 (72%), Gaps = 11/387 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  Q S  VLMFPWLAHGHI PFL LA+ L++RNF +Y+CSTP  L SIK +++E  + 
Sbjct  1     MEYHQDSFSVLMFPWLAHGHISPFLELAKKLSQRNFKVYLCSTPACLVSIKPKLAENFSA  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LP+LP LPP YHTTNGLP HLM TLK+A DM+ P F+ +L+T++PDL+VYD 
Sbjct  61    SIQLVELHLPTLPGLPPEYHTTNGLPSHLMATLKQAFDMASPNFIKILETIEPDLLVYDM  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW P  A+A +IPAV F+S      S++ HV + +P  ++PF  ++  D E I   +L
Sbjct  121   LQPWAPTAASALNIPAVEFISSSTTMTSFMLHVLKNNPGTKFPFSNIFHGDLEAILANKL  180

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 + +     +  R+   L  SS IILIK+F+++EGKYID LS L  K+ VPVGPLV+
Sbjct  181   H---DDVKFRSKEINRVVQSLQLSSKIILIKSFKEIEGKYIDYLSLLSGKKVVPVGPLVQ  237

Query  437   SLVA----DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
                +      +N EI EWLD K + STVFV FG+EYFL++E+ EE+A GLELS VNF+W 
Sbjct  238   DPSSTHGNSDDNLEIMEWLDKKEKKSTVFVCFGTEYFLSQEDREEIAHGLELSNVNFIWA  297

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IR+P  E  +    + +ALP+G+L RVG+RG VV+GW PQ  IL HSS+GGFVSHCGW+S
Sbjct  298   IRYPKGENLQ----LEEALPKGFLARVGERGMVVDGWVPQAKILGHSSVGGFVSHCGWNS  353

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             VME++K GVPI+A+PM LDQP+NAR++
Sbjct  354   VMESMKSGVPIVAIPMHLDQPVNARLI  380



>ref|XP_010658726.1| PREDICTED: crocetin glucoside glucosyltransferase-like isoform 
X2 [Vitis vinifera]
Length=419

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 271/382 (71%), Gaps = 40/382 (10%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             Q  I+VL+ PWLAHGHI PFL L++ L K+ FYIY CS+PVNLS IK +++   + SI+L
Sbjct  7     QSRIKVLVLPWLAHGHISPFLELSKQLMKQKFYIYFCSSPVNLSRIKGKLTGNYSHSIQL  66

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPSLP+LPPHYHTTNGLPPHLMPTLK ALDM+ P F N+L TL PDL++YDF+QPW
Sbjct  67    VELHLPSLPELPPHYHTTNGLPPHLMPTLKMALDMASPSFTNILKTLSPDLLIYDFIQPW  126

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
              PA AA+  IP+V FLS GAAA +++ H                     F++        
Sbjct  127   APAAAASLGIPSVQFLSNGAAATAFMIH---------------------FVKK-------  158

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-SLV  429
                     D E+   CL+ SS++ILI++F+++E ++ID LSNL  K  VPVGPL++  L 
Sbjct  159   -------PDKEKARQCLEQSSNVILIRSFKEIEERFIDFLSNLNAKTVVPVGPLLQDQLD  211

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              +    E+ EWL  K   S+VFVSFGSEYFL++EE+EEVA GLELSKVNF+WV+RFP   
Sbjct  212   EEDAETEMVEWLSKKDPASSVFVSFGSEYFLSKEELEEVAYGLELSKVNFIWVVRFPM--  269

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              G+K R + +ALPEG+L RVG +G VVEGWAPQ  IL HSSIGGFVSHCGW SVME++ F
Sbjct  270   -GDKTR-VEEALPEGFLSRVGDKGMVVEGWAPQKKILRHSSIGGFVSHCGWGSVMESMNF  327

Query  68    GVPIIAMPMQLDQPLNARVVAA  3
             GVPI+AMPM LDQP NA++V A
Sbjct  328   GVPIVAMPMHLDQPFNAKLVEA  349



>ref|XP_007220461.1| hypothetical protein PRUPE_ppa005526mg [Prunus persica]
 gb|EMJ21660.1| hypothetical protein PRUPE_ppa005526mg [Prunus persica]
Length=456

 Score =   405 bits (1041),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 211/385 (55%), Positives = 284/385 (74%), Gaps = 12/385 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + QR + +LM PWLAHGHI P+L LA+ LT KRNF+I+ICSTPVNLSSIK ++S+K +  
Sbjct  4     SDQRKLTILMLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK+A DMS   F N+L TL PDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSNILKTLSPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW P++A+ Q+ P++ F++ GAA  S+     + +P+ ++PFP +YL+D+E  +   
Sbjct  124   FLQPWAPSLASLQNFPSIEFITMGAAFTSFSIQHLK-NPSVKFPFPSIYLQDYEAEKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             + E        + D +R+  C   S +IIL+KT R +E KYID LS+L+ K+ VPVG LV
Sbjct  183   VLESSA---NGIKDGDRVQQCSARSCNIILVKTSRGIEEKYIDYLSDLMGKKIVPVGTLV  239

Query  440   RSLVADGENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             +  V    + E  I +WL+   R S V+V FGSEYFL++E++EE+A GLELSKV+F+WVI
Sbjct  240   QEPVDQKVDEETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVI  299

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RF   E   K   + + LPEG+L+RVG++G ++EGWAPQ  IL+HSS+GGFVSHCGW+SV
Sbjct  300   RFSKEE---KNTRVEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARV  12
             +E++KFGVPIIAMPM LDQP+NAR+
Sbjct  357   LESIKFGVPIIAMPMHLDQPINARL  381



>emb|CDO99872.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 278/381 (73%), Gaps = 20/381 (5%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPS  945
             M PWLAHGH+ PFL LA+ L K+NF+IY+CST VNLSSIK +++ K + SI+ VELQLP 
Sbjct  1     MLPWLAHGHMSPFLELAKRLAKKNFHIYLCSTSVNLSSIKNQIAGKYSDSIEPVELQLPC  60

Query  944   LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
             LPDLPPHYHTTNGLPPHLM TLK A +MS P F N+L TL PDLV+YDF QPW   +A++
Sbjct  61    LPDLPPHYHTTNGLPPHLMTTLKTAYEMSAPNFSNILTTLHPDLVMYDFNQPWAAEIASS  120

Query  764   QSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI----RNKRLFEPPEQI  597
             Q+IPAV FL  GA+  ++  ++ + +P +E P+PE+Y+RD+E      R+ R+       
Sbjct  121   QNIPAVQFLPFGASMTAFGLYMIK-YPGKELPYPEIYIRDYEIAKVRSRDARV-------  172

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD--  423
               DVSD +R    LD S  I+L+K+F+++E +++D LS    K+ VPVGPLV+ +  D  
Sbjct  173   -NDVSDGQRFLQGLDLSCKILLVKSFKEIEERFMDFLSVASGKKVVPVGPLVQDISLDDI  231

Query  422   -GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
               E  EI  WLD K   S VFVSFGSEYFLTE+E  E+A GLELS VNF+WVIRFP    
Sbjct  232   QDEEMEIINWLDQKENASVVFVSFGSEYFLTEDERSEIARGLELSNVNFIWVIRFP---F  288

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
             G K   +  ALPEG+LERVG RGK+V+GWAPQ  IL+H++ G F+SHCGWSS+ME++KFG
Sbjct  289   GGKI-TVEKALPEGFLERVGDRGKIVDGWAPQARILKHANTGAFLSHCGWSSMMESMKFG  347

Query  65    VPIIAMPMQLDQPLNARVVAA  3
             VP+IA+PM +DQPLNAR++ A
Sbjct  348   VPMIALPMNIDQPLNARLIEA  368



>ref|XP_010032103.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=452

 Score =   404 bits (1037),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 278/383 (73%), Gaps = 8/383 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  QR I+VLM PWLAHGHI PFL LA+ L+ RNF+I++CSTPVNLSSIK ++S+K + 
Sbjct  1     MENMQRPIKVLMLPWLAHGHISPFLELAKRLSTRNFHIHLCSTPVNLSSIKPKISDKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+  GF +++ +L PDL++ D 
Sbjct  61    SIELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASLGFSDIVKSLGPDLLICDL  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPW   +A +  +P V+F   GA   S++FH+ + + + ++PF  +   D+E     ++
Sbjct  121   FQPWAAEVAKSHGLPTVVFFIVGARTISFMFHMIK-NASSKFPFEAIRFHDYEL---AKI  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +  +     V D +R+   ++ SS+ IL+KTFR+++GKY+D LS+L  K+ + VGPLV 
Sbjct  177   GKAADDSTARVKDEDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLSGKKVLTVGPLVE  236

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   +   I EWLD + + ST+FVSFGSEYFLTE+E EE+A GLELS VNF+WVIRFP
Sbjct  237   DPDNMEDGDSIIEWLDKREQSSTIFVSFGSEYFLTEKEREEIAHGLELSNVNFIWVIRFP  296

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E+ E    + +ALP+G+LERV  RG V++GWAPQG ILEH SIGGFVSHCGW S+ME+
Sbjct  297   VGESIE----LEEALPKGFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSLMES  352

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K GVPIIAMPM  DQPLNAR+V
Sbjct  353   MKSGVPIIAMPMLHDQPLNARMV  375



>ref|XP_008345567.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=464

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/383 (56%), Positives = 283/383 (74%), Gaps = 12/383 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              R+I +LM PWL HGHI PFL LA+ LT  R+F+I+ICSTPVNLSSIK ++ +K +  I+
Sbjct  7     HRNISILMLPWLGHGHISPFLELAKKLTSLRDFHIFICSTPVNLSSIKPKLPQKYSHCIE  66

Query  968   LVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
              VEL LP   LP+LPPHYHTTNGLPPHLMPTLKKA DMS   F ++L TLKPDL++YDFL
Sbjct  67    FVELHLPHDELPELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSDILKTLKPDLLIYDFL  126

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLF  615
             QPW P++A + +IPAV F++  AA  S   H  + +P  ++P+  +YLRD+E  +   L 
Sbjct  127   QPWAPSLALSHNIPAVEFITTNAALMSLSVHQLK-NPNAQFPYTSIYLRDYEAKKFSNLL  185

Query  614   EPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS  435
             E        + D ER+    D S +IIL+KT  ++E KY+D LS L++K+ VPVG LV+ 
Sbjct  186   ESSA---NGIKDGERVLLSSDRSRNIILVKTSGEIESKYVDYLSELMEKKIVPVGSLVQD  242

Query  434   LVAD--GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
              +     E   I +WL+ + R S VFVSFGSEYFL++EE++E+A GLELS+V+F+WVIRF
Sbjct  243   PMDQKVDEESXIIKWLNERERSSVVFVSFGSEYFLSKEEIQEIAHGLELSQVSFIWVIRF  302

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E   ++ ++ + LP+G+ ERVG+RG ++EGWAPQ  IL+HSS+GGFVSHCGWSSV+E
Sbjct  303   PKEE---RSTSVEEVLPKGFGERVGERGVIMEGWAPQXKILKHSSVGGFVSHCGWSSVLE  359

Query  80    ALKFGVPIIAMPMQLDQPLNARV  12
             ++KFGVPIIAMPMQLDQP+NAR+
Sbjct  360   SIKFGVPIIAMPMQLDQPVNARL  382



>ref|XP_007218014.1| hypothetical protein PRUPE_ppa005830mg [Prunus persica]
 gb|EMJ19213.1| hypothetical protein PRUPE_ppa005830mg [Prunus persica]
Length=441

 Score =   402 bits (1033),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 276/379 (73%), Gaps = 14/379 (4%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRN--FYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             +RVLM PWLAHGHI PFL LA+ LT +N  FYI+ICSTPVNLSSIK ++SE+ +  I+ V
Sbjct  2     VRVLMLPWLAHGHISPFLELAKKLTNKNKDFYIFICSTPVNLSSIKPKLSEEYSHCIEFV  61

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL LP   DLPPHYHTTNGLPPHLM TLKK  DM+ P F N+L TLKPDL++YDFLQPW 
Sbjct  62    ELHLPH-DDLPPHYHTTNGLPPHLMATLKKTFDMASPNFSNILKTLKPDLLIYDFLQPWA  120

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
             P++A  Q+IPA+ F    AA  S +      +P  ++P   L+LRD++    ++     E
Sbjct  121   PSLALLQNIPAIEFSIMNAALLSSVCAHDLNNPTAKFP---LHLRDYDI---RKFHNQCE  174

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD  423
                  + D +RI  C   S  IIL+KT R++E KY+D LS+LVKK+ VPVGPLV+  +  
Sbjct  175   FSSNGIKDGDRIQQCCARSCKIILVKTSREIEAKYVDYLSDLVKKKIVPVGPLVQDPMGQ  234

Query  422   GENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
               + E  I +WL+ + R S V+VSFGSEYFL++EE+E++A GLELSKV+F+WVIRFP  E
Sbjct  235   TLDEETWIMKWLNKRERSSVVYVSFGSEYFLSKEEIEDIAHGLELSKVSFIWVIRFPKEE  294

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              G +   + + LPEG+ ERVG++G +VEGWAPQ  ILEH S+GGFVSHCGWSSV+E++KF
Sbjct  295   KGTR---VEEVLPEGFSERVGEKGMIVEGWAPQSKILEHYSVGGFVSHCGWSSVLESIKF  351

Query  68    GVPIIAMPMQLDQPLNARV  12
             GVPIIA+PM  DQP+NAR+
Sbjct  352   GVPIIALPMLYDQPINARL  370



>gb|KCW51489.1| hypothetical protein EUGRSUZ_J01005 [Eucalyptus grandis]
Length=465

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 213/375 (57%), Positives = 266/375 (71%), Gaps = 9/375 (2%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS-IKLVELQ  954
             +LM PWLAHGHI PFL L++    R  +IY CS+PVNL+SIK ++      S I+LVEL 
Sbjct  11    ILMLPWLAHGHISPFLELSKRFADRGIHIYFCSSPVNLASIKPKLVGTTYFSKIELVELH  70

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LPSLP+LPP  H+T  LPPHLMPTLKKA DMS PGF ++L  L P LVVYDFLQPW PA+
Sbjct  71    LPSLPELPPRNHSTKTLPPHLMPTLKKAFDMSSPGFADILKLLDPALVVYDFLQPWAPAI  130

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A++  IPAV FL   A  C+++ H     P  ++P+P +YL DHE  +   L E      
Sbjct  131   ASSMGIPAVEFLCTSATMCAFVNHANM-KPGNKFPYPGIYLHDHEVDQFANLLECSAN--  187

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-SLVADGE  417
               + D +R+  C + S  +I+IK+ R++EGKYID LS L+ K  VPVGPLV  +   D E
Sbjct  188   -GIKDRDRVFQCYERSRDMIMIKSIREIEGKYIDYLSFLIDKSVVPVGPLVEDTAFEDCE  246

Query  416   NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEK  237
               EI +WLD K   STVFVSFGSEYFL+++EM E+A GLE SKVNF+WV+RF   E    
Sbjct  247   KSEILDWLDNKEEKSTVFVSFGSEYFLSKQEMTEIAHGLEASKVNFVWVVRFHDGE--RD  304

Query  236   ARAIGDA-LPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVP  60
             A A G++ LPEG+L+RV  RG V+EGWAPQ  IL+HSS+GGFVSHCGWSSVME+++FGVP
Sbjct  305   AAANGESYLPEGFLKRVAGRGLVLEGWAPQAAILQHSSVGGFVSHCGWSSVMESMRFGVP  364

Query  59    IIAMPMQLDQPLNAR  15
             IIAMPM LDQP+NAR
Sbjct  365   IIAMPMHLDQPVNAR  379



>ref|XP_009335994.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=466

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 218/388 (56%), Positives = 279/388 (72%), Gaps = 18/388 (5%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT +R+F+I ICSTPVNLS IK ++ +K +  I+
Sbjct  7     HRSISILMLPWLGHGHISPFLELAKKLTDRRDFHILICSTPVNLSCIKPKLPQKYSHCIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F  +L TLKPDL++YDFLQP
Sbjct  67    FVELHLPH-DELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSQILSTLKPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A++ +IPAV F +  AA  S+  H  + +P   +P+P +YLRD+E    K+    
Sbjct  126   WAPSLASSHNIPAVEFFTTSAAVISFYVHHLK-NPNVLFPYPSIYLRDYE---TKKFSSV  181

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
              E     + D ER   C D S +IIL+KT  ++E KYID LS L++K+ VPVG LV+  +
Sbjct  182   LESSANGIKDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVGSLVQDPM  241

Query  428   AD--GENPEIKEWLDMKPR-------CSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
                  E   I +WL+ + R        S VFVSFGSEYFL++EE++E+ALGLELS+V+F+
Sbjct  242   DQKVDEESSIIKWLNERERXXXXXERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFI  301

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WVIRFP  E   K+  + D LP+G+ ERVG+RG +VE WAPQ  IL+HSS+GGFVSHCGW
Sbjct  302   WVIRFPKEE---KSTRVEDVLPKGFGERVGERGMIVEDWAPQAKILKHSSVGGFVSHCGW  358

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARV  12
             SSV+E++KFGVPIIAMPMQLDQPLNAR+
Sbjct  359   SSVLESIKFGVPIIAMPMQLDQPLNARL  386



>ref|XP_008231995.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=441

 Score =   399 bits (1025),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 275/379 (73%), Gaps = 14/379 (4%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRN--FYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             +RVLM PWLAHGHI PFL LA+ L  +N  FYI+ICSTPVNLSSIK ++SE+ +  I+ V
Sbjct  2     VRVLMLPWLAHGHISPFLELAKKLANKNNNFYIFICSTPVNLSSIKPKLSEEYSHCIEFV  61

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL LP   DLPPHYHTTNGLPPHLM TLKKA DM+ P F N+L TLKPDL++YDFLQPW 
Sbjct  62    ELHLPH-DDLPPHYHTTNGLPPHLMATLKKAFDMASPNFSNILKTLKPDLLIYDFLQPWA  120

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
             P++A  Q+IPA+ F    AA  S +      +P  ++P   L+LRD++    ++     E
Sbjct  121   PSLALLQNIPAIEFSIMNAALLSSVCTHDFNNPTAKFP---LHLRDYDI---RKFHNQCE  174

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD  423
                  + D +RI  C   S  +IL+KT R++E KY+D LS LVKK+ VPVGPLV+  +  
Sbjct  175   FSSNGIKDGDRIQQCCARSCKMILVKTSREIEAKYVDYLSGLVKKKIVPVGPLVQDPMDQ  234

Query  422   GENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
               + E  I +WL+ + R S V+VSFGSEYFL++EE+E++A GLELSKV+F+WVIRFP  E
Sbjct  235   TLDEETWIMKWLNKRERSSVVYVSFGSEYFLSKEEIEDIAHGLELSKVSFIWVIRFPKEE  294

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              G +   + + LPEG+ ERVG++G +VEGWAPQ  ILEH S+GGFVSHCGWSSV+E++KF
Sbjct  295   KGTR---VEEVLPEGFSERVGEKGMIVEGWAPQSKILEHYSVGGFVSHCGWSSVLESIKF  351

Query  68    GVPIIAMPMQLDQPLNARV  12
             GVPIIA+PM  DQP+NAR+
Sbjct  352   GVPIIALPMLYDQPINARL  370



>ref|XP_008375609.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=460

 Score =   399 bits (1026),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 278/381 (73%), Gaps = 11/381 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT +R+F+I ICS+PVNLSSIK ++ +K +  I+
Sbjct  7     HRSISILMLPWLGHGHISPFLELAKKLTDRRDFHILICSSPVNLSSIKPKLPQKYSHCIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F ++L TLKPDL++YDFLQP
Sbjct  67    FVELHLPH-EELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILRTLKPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A++ +IPAV F +  AA  S+L H  + +P   +P+P +YLRD+E    K+    
Sbjct  126   WAPSLASSHNIPAVEFFTTSAAVISFLVHHLK-NPNVIFPYPSIYLRDYE---TKKFSSV  181

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
              E     + D ER   C D S +IIL+KT  ++E KYID LS L++K+ VPV  LV+  +
Sbjct  182   LESSANGIKDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVSSLVQDPM  241

Query  428   AD--GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
                  E   I +WL+ + R S VFVSFGSEYFL++EE++E+ALGLELS+V+F+WVIRFP 
Sbjct  242   DQKVDEESSIIKWLNERERASVVFVSFGSEYFLSKEELQEIALGLELSQVSFIWVIRFPK  301

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
                 EK+  + D LP+G+ ERVG+RG +VE WA    IL+HSS+GGFVSHCGWS V+E++
Sbjct  302   E---EKSTRVEDVLPKGFGERVGERGMIVEDWAXXVKILKHSSVGGFVSHCGWSXVLESI  358

Query  74    KFGVPIIAMPMQLDQPLNARV  12
             KFGVPIIAMPMQLDQPLNAR+
Sbjct  359   KFGVPIIAMPMQLDQPLNARL  379



>ref|XP_008231981.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=455

 Score =   399 bits (1025),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 282/384 (73%), Gaps = 11/384 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + QRS+ +LM PWLAHGHI P+L LA+ LT KRN +I+ICSTPVNLSSIK ++S+K +  
Sbjct  4     SDQRSLTILMLPWLAHGHISPYLELAKKLTTKRNLHIFICSTPVNLSSIKPKLSQKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK A DMS   F N+L TL PDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFDMSSNNFSNILKTLSPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              LQPW P++A+ Q+ P++ F+  GAA  S+     + +P+ ++PFP +YL+D+E  +   
Sbjct  124   VLQPWAPSLASLQNFPSIEFIPMGAALTSFNIQHLK-NPSVKFPFPSIYLQDYEAEKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C   S  IIL+KT R++E KYID LS+L+ K+ VPVG LV
Sbjct  183   LSESSA---NGIKDGDRLQQCSARSCDIILVKTSREIEEKYIDYLSDLMGKKIVPVGTLV  239

Query  440   RS-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             +  +    +   I +WL+   R S V+V FGSEYFL++E++EE+A GLELSKV+F+WVIR
Sbjct  240   QEPMDQKVDETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIR  299

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP AE   ++  + + LPEG+L+RVG++G ++EGWAPQ  IL+HSS+GGFVSHCGW+SV+
Sbjct  300   FPKAE---RSTRVEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSVL  356

Query  83    EALKFGVPIIAMPMQLDQPLNARV  12
             E++KFGVPIIAMPM L QP+NAR+
Sbjct  357   ESIKFGVPIIAMPMHLAQPINARL  380



>ref|XP_008344699.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=461

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 279/381 (73%), Gaps = 11/381 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT  R+F+I+ICSTPVNLSSIK ++ +K +  I+
Sbjct  7     NRSISILMLPWLGHGHISPFLELAKKLTSHRDFHIFICSTPVNLSSIKPKLPKKYSHCIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F ++L TLKPDL+VYDFLQP
Sbjct  67    FVELLLPH-DELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILKTLKPDLLVYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A + +IPAV F +  A+  S  FH  + +P  ++P+P +YLRD+E      L E 
Sbjct  126   WAPSLALSHNIPAVEFTTTSASLMSLWFHHLK-NPNVQFPYPSIYLRDYEIKEFSNLIES  184

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
                    +++ ER+  C   S +IIL+KT  ++E K +D LS L +K+ VPVG LV+  +
Sbjct  185   SA---NGITNGERVLLCSHRSRNIILVKTSGEIESKCVDYLSKLTEKKIVPVGSLVQDPM  241

Query  428   AD--GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
                  E   I +WL+ + R S VFVSFGSEYFL++EE++E+ALGLELS+V+F+WVIRFP 
Sbjct  242   DQKVDEESSIIKWLNERERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPK  301

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
              E   K+  + D LP+G+ ERVG+RG +VE WAPQ  IL+HSS+GGFVSHCGWSSV+E++
Sbjct  302   EE---KSTRVEDVLPKGFGERVGERGMIVEDWAPQAKILKHSSVGGFVSHCGWSSVLESI  358

Query  74    KFGVPIIAMPMQLDQPLNARV  12
             KFGVPIIAMPMQLDQP+NAR+
Sbjct  359   KFGVPIIAMPMQLDQPVNARL  379



>gb|AHZ30598.1| ufgt, partial [Prunus domestica]
Length=423

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 281/379 (74%), Gaps = 12/379 (3%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQ  954
             +LM PWLAHGHI P+L LA+ LT K NF+++ICSTPVNLSSIK ++S+K +  I+ VEL 
Sbjct  2     ILMLPWLAHGHISPYLELAKKLTTKSNFHVFICSTPVNLSSIKPKLSQKYSHCIEFVELH  61

Query  953   LP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             LP   LP+LPPHYHTTNGLPPHLM TLK A DMS   F N+L TL PDL++YD LQPW P
Sbjct  62    LPHDDLPELPPHYHTTNGLPPHLMSTLKTAFDMSSNNFSNILKTLSPDLLIYDVLQPWAP  121

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
             ++A+ Q+ P++ F+  GAA  S+     + +P+ ++PFP +YL+D+E  +   L E    
Sbjct  122   SLASLQNFPSIEFIPMGAALTSFSIQHLK-NPSVKFPFPSIYLQDYEAEKFNNLSESSA-  179

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADG  420
                 + D +R+  C   S +IIL+KT R++E KYID LS+L+ K+ VPVG LV+  +   
Sbjct  180   --NGIKDGDRLQQCGARSCNIILVKTSREIEEKYIDYLSDLMGKKIVPVGTLVQEPMDQK  237

Query  419   ENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
              + E  I +WL+   R S V+V FGSEYFL++E++EE+A GLELSKV+F+WVIRFP AE 
Sbjct  238   VDEETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFPKAE-  296

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
               ++  + + LPEG+L+RVG++G ++EGWAPQ  IL+HSS+GGFVSHCGW+SV+E++KFG
Sbjct  297   --RSTRVEEVLPEGFLQRVGEKGVIMEGWAPQARILQHSSVGGFVSHCGWNSVLESIKFG  354

Query  65    VPIIAMPMQLDQPLNARVV  9
             VPIIA+PM LDQP+NAR+V
Sbjct  355   VPIIAVPMHLDQPINARLV  373



>gb|AEJ88222.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Prunus persica]
Length=456

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/385 (54%), Positives = 280/385 (73%), Gaps = 12/385 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + QRS+ +LM PWLAHGHI P+L LA+ LT KRNF+I+ICSTPVNLSSIK ++S+K +  
Sbjct  4     SDQRSLTILMLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK A  MS   F N+L TL PDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFSMSSNNFSNILKTLSPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              LQPW P++A+ Q+ P++ F + GAA  S+     + +P+ ++PFP +YL+ +E  +   
Sbjct  124   VLQPWAPSLASLQNFPSIEFTTMGAAFTSFSIQHLK-NPSVKFPFPSIYLQHYEAEKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C   S +IIL+KT  ++E KYID LS+L  K+ VPVG LV
Sbjct  183   LLESSA---NGIKDGDRVQQCSARSCNIILVKTSSEIEEKYIDYLSDLTGKKIVPVGTLV  239

Query  440   RSLVADGENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             +  +    + E  I +WL+   R S V+V FGSEYFL++E++EE+A GLELSKV+F+WVI
Sbjct  240   QEPMDQKVDEETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVI  299

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RF   E   ++  + + LPEG+L+RVG++G ++EGWAPQ  IL+HSS+GGFVSHCGW+SV
Sbjct  300   RFSKEE---RSTRVEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARV  12
             +E++KFGVPIIAMPM LDQP+NAR+
Sbjct  357   LESIKFGVPIIAMPMHLDQPINARL  381



>gb|EYU31926.1| hypothetical protein MIMGU_mgv1a021717mg, partial [Erythranthe 
guttata]
Length=456

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 273/380 (72%), Gaps = 12/380 (3%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             ++I VLMFPWLAHGHI P+L LA+ L+KRNF I++CST  NLSSIK ++ +K + SI+LV
Sbjct  7     KTIHVLMFPWLAHGHISPYLELAKRLSKRNFIIHLCSTKANLSSIKSKIGDKFSHSIRLV  66

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL L +   LP  YHTTNGLPP+LMP+LK A + SKP F N+L ++KPDL+VYDFLQPW 
Sbjct  67    ELDLGT-DLLPSCYHTTNGLPPNLMPSLKLAFENSKPQFSNILASIKPDLLVYDFLQPWA  125

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELY-LRDHEFIRNKRLFEPP  606
             P +A+   +PAV F++  +   +Y+F+  +G P  E+P  +L   RD+EF+    L    
Sbjct  126   PLVASIHHVPAVEFITSSSTMTAYMFNFFKGKPMTEFPHHDLIAYRDYEFVHRANLLASN  185

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
             E +  +          +  S+ IILIK F+++EG+YID L NL+ K+ VPVGPLV+    
Sbjct  186   EAVKRNAFLG------IARSNRIILIKGFKEIEGEYIDYLGNLLGKKIVPVGPLVQDPTH  239

Query  425   DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
             + E  +I EWLD K +CSTV+VSFGSEYFL  E++ E+ALGLELS VNF+WV+RFP  E 
Sbjct  240   ETEGSKIMEWLDGKGKCSTVYVSFGSEYFLKPEDLRELALGLELSGVNFVWVVRFPKGEK  299

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
                 + + ++LP G+LERVG RG VVEGWAPQ  IL H SIGGFVSHCG SS+ME++KFG
Sbjct  300   ----KTLEESLPLGFLERVGGRGLVVEGWAPQAQILVHESIGGFVSHCGCSSMMESMKFG  355

Query  65    VPIIAMPMQLDQPLNARVVA  6
             VPIIAMPM LDQPLNAR+V 
Sbjct  356   VPIIAMPMHLDQPLNARLVG  375



>ref|XP_004250481.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=463

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 211/387 (55%), Positives = 273/387 (71%), Gaps = 9/387 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  +++IR++MFPWLA GHI  FL LA+AL KRNF  YI +T  NL+  K  +S ++  
Sbjct  1     MDERKKNIRIVMFPWLARGHISAFLELAKALAKRNFITYIYTTHANLAYFKDTLSPEETR  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              +KL+++ LP LP LP   HTT GL PHL+ TLK      KP F  +L+TLKPDL++YDF
Sbjct  61    HVKLMDIVLPYLPHLPRTSHTTAGLHPHLINTLKLIFLKGKPDFFTILETLKPDLIIYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L P +P MA+    PAVLFL+ GAAA SY +HV   +P+ +YPFPE++ +DHE  RNKR+
Sbjct  121   LLPCIPLMASTLHFPAVLFLTSGAAANSYHYHVRDNNPSIDYPFPEIFFKDHEHRRNKRI  180

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
             F+  E  D  + +   I  C + S  IILIKTF++LEGK+ID L+ L  KR VPVGPLVR
Sbjct  181   FDSLE--DDGIDEKNGITRCFERSKGIILIKTFKELEGKFIDYLTFLFNKRFVPVGPLVR  238

Query  437   SL--VADGE-NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             +      GE N +I EWL+ K +CST+F+SFGSE + T+E+++E+ALGLELS VNF+WVI
Sbjct  239   AFDQTDSGEYNDKIIEWLNEKEKCSTIFISFGSELYFTKEQIQEMALGLELSMVNFIWVI  298

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP     E    I + LPEG+ ER    G +VE WAPQG IL+HSSI GFVSHCGW+SV
Sbjct  299   RFPGTYKME----IREVLPEGFYERNWNTGLIVEEWAPQGRILKHSSIAGFVSHCGWNSV  354

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVA  6
             MEAL  GVPIIA+P+Q +QPLNAR++ 
Sbjct  355   MEALGCGVPIIALPVQHEQPLNARLLV  381



>ref|XP_009336996.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=461

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/381 (56%), Positives = 275/381 (72%), Gaps = 11/381 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT  R+F+I+ICSTPVNLSSIK ++ +K +  I+
Sbjct  7     NRSISILMLPWLGHGHISPFLELAKKLTSHRDFHIFICSTPVNLSSIKPKLPKKYSHFIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F ++L TLKPDL++YDFLQP
Sbjct  67    FVELHLPH-DELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILKTLKPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A + +IPAV F +  AA+ S   H  +  P  ++P P +YLRD+E      L E 
Sbjct  126   WAPSLALSHNIPAVEFTTTSAASMSLFLHHHKN-PNVQFPHPSIYLRDYETKEFSNLLES  184

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
                    +++ ER+  C D S +IIL+KT  ++E K +D LS L +K+ VPVG LV+  +
Sbjct  185   SA---NGITNVERVLLCSDLSRNIILVKTSGEIESKCVDYLSQLTEKKIVPVGSLVQDPM  241

Query  428   AD--GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
                  E   I +WL    R S VFVSFGSEYFL++EE++E+ALGLELS+V+F+WVIRFP 
Sbjct  242   DQQVDEESSIIKWLXXXERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPK  301

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
              +   K+  + D LP+G+ ERVG+RG +V+ W PQ  IL+HSS+GGFVSHCGWSSV+E++
Sbjct  302   ED---KSTRVEDVLPKGFGERVGERGMIVDDWTPQAKILKHSSVGGFVSHCGWSSVLESI  358

Query  74    KFGVPIIAMPMQLDQPLNARV  12
             KFGVPIIAMPMQLDQP+NAR+
Sbjct  359   KFGVPIIAMPMQLDQPVNARL  379



>ref|XP_007220460.1| hypothetical protein PRUPE_ppa005520mg [Prunus persica]
 gb|EMJ21659.1| hypothetical protein PRUPE_ppa005520mg [Prunus persica]
Length=456

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 206/385 (54%), Positives = 280/385 (73%), Gaps = 12/385 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             + QRS+ +L+ PWLAHGHI P+L LA+ LT KRNF+I+ICSTPVNLSSIK ++S+K +  
Sbjct  4     SDQRSLTILLLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHC  63

Query  974   IKLVELQLP--SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             I+ VEL LP   LP+LPPHYHTTNGLPPHLM TLK A  MS   F N+L TL PDL++YD
Sbjct  64    IEFVELHLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFSMSSNNFSNILKTLSPDLLIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              LQPW P++A+ Q+ P++ F + GAA  S+     + +P+ ++PFP +YL+ +E  +   
Sbjct  124   VLQPWAPSLASLQNFPSIEFTTMGAAFTSFSIQHLK-NPSVKFPFPSIYLQHYEAEKFNN  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L E        + D +R+  C   S +IIL+KT  ++E KYID LS+L  K+ VPVG LV
Sbjct  183   LLESSA---NGIKDGDRVQQCSARSCNIILVKTSSEIEEKYIDYLSDLTGKKIVPVGTLV  239

Query  440   RSLVADGENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             +  +    + E  I +WL+   R S V+V FGSEYFL++E++EE+A GLELSKV+F+WVI
Sbjct  240   QEPMDQKVDEETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVI  299

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RF   E   ++  + + LPEG+L+RVG++G ++EGWAPQ  IL+HSS+GGFVSHCGW+SV
Sbjct  300   RFSKEE---RSTRVEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSV  356

Query  86    MEALKFGVPIIAMPMQLDQPLNARV  12
             +E++KFGVPIIAMPM LDQP+NAR+
Sbjct  357   LESIKFGVPIIAMPMHLDQPINARL  381



>ref|XP_010327003.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=452

 Score =   394 bits (1013),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 269/387 (70%), Gaps = 6/387 (2%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             ++ + +   + + VLMFPWL +GHI PFL LA+ L++RNF I +CSTPV L+ I+K++S 
Sbjct  1     MNGFTNNGDKCVNVLMFPWLGYGHISPFLELAKKLSQRNFIICLCSTPVILNCIEKKLSP  60

Query  989   KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             + + SI L+EL L +LPDLPP +HTTNGLPPHLM TLK+A D++ P F  +L TLKPDL+
Sbjct  61    EFSPSIHLLELNLQNLPDLPPSHHTTNGLPPHLMNTLKEAFDLASPDFALILKTLKPDLL  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDFLQPW P  AA   IPAV F+S  +   +Y+ H     P  ++PF  +  RD+E  R
Sbjct  121   IYDFLQPWAPKAAAELKIPAVEFISSSSTMTAYMLH-EFNKPGIKFPFSSICYRDYEKAR  179

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
              ++  E    ++    D  R+  C   S  I+LIK+F+++EGKY D ++NL  KR VP+G
Sbjct  180   IEKQ-EATMSVEKLEEDKRRVRECFYLSCDIVLIKSFKEIEGKYSDYITNLTGKRVVPLG  238

Query  449   PLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             PLV+    +    E+  WL+ K + ST+FVSFGSEYFL++E+  E+A GLE SKVNF+W 
Sbjct  239   PLVQEPTLEDSESELITWLNEKEKRSTIFVSFGSEYFLSKEDFVEIAYGLENSKVNFIWP  298

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRF   E  E    + + LP+G+  RVG RGKV  GWAPQ  ILEHSSIGGFVSHCGWSS
Sbjct  299   IRFQKGENLE----LEETLPKGFFNRVGNRGKVFNGWAPQAKILEHSSIGGFVSHCGWSS  354

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             VME++K+GVPIIAMPM +DQP+N R+V
Sbjct  355   VMESMKYGVPIIAMPMHIDQPINCRLV  381



>ref|XP_010110161.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
 gb|EXC25399.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
Length=465

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/394 (54%), Positives = 275/394 (70%), Gaps = 26/394 (7%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS--  975
             SQ  + +LM PWLAHGH+ P+L LA+ L ++NF++Y CSTP NL SIK ++  K +    
Sbjct  7     SQHFMSILMLPWLAHGHVSPYLELAKRLAEKNFHVYFCSTPANLVSIKTKIPNKYSDHEN  66

Query  974   -----IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
                  I+LVEL LP LPDLP HYHTTNGLPPHLMPTLKKA DMS P F  +LD L+P+L+
Sbjct  67    HSLGIIELVELHLPELPDLPRHYHTTNGLPPHLMPTLKKAFDMSSPSFEKILDDLEPELL  126

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDFLQPW P +A+ ++IPAV FLS  A+  S+  H  R     E+PFP ++L+ +E   
Sbjct  127   IYDFLQPWAPTLASQRNIPAVEFLSCSASMTSFCLH-WRSKRGVEFPFPTIHLKGYEVSG  185

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
                L E       DV D +R+  C + S +I+L+K+F  +E KYID LS L+ K+ VPVG
Sbjct  186   FNNLLESSA---NDVKDKDRVRRCSEQSCTIVLVKSFSDVEDKYIDYLSVLLGKKIVPVG  242

Query  449   PLVRSLVADGENP-------EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLS  291
                 SLV DG++         + +WLD K + S VFVSFGSEYFL+++EM E+A GLELS
Sbjct  243   ----SLVDDGKDSNDLQDYNNVIKWLDSKEKSSVVFVSFGSEYFLSKDEMREIAYGLELS  298

Query  290   KVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFV  111
              V+F+WV+RFP    GEK   I +ALP G+L+RV ++G ++E WAPQ  +L+  SIGGFV
Sbjct  299   GVSFIWVVRFP---VGEKMN-IEEALPNGFLKRVERKGMIIEKWAPQREVLKSKSIGGFV  354

Query  110   SHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SHCGWSSVME++KFGVPIIAMPM LDQP+NAR+V
Sbjct  355   SHCGWSSVMESMKFGVPIIAMPMHLDQPINARLV  388



>ref|XP_009337016.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=454

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 213/381 (56%), Positives = 275/381 (72%), Gaps = 16/381 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT +R+F+I ICSTPVNLS IK ++ +K +  I+
Sbjct  7     HRSISILMLPWLGHGHISPFLELAKKLTDRRDFHILICSTPVNLSCIKPKLPQKYSHCIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F  +L TLKPDL++YDFLQP
Sbjct  67    FVELHLPH-DELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSQILSTLKPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A++ +IPAV F +  AA  S+  H  + +P   +P+P +YLRD+E    K+    
Sbjct  126   WAPSLASSHNIPAVEFFTTSAAVISFYVHHLK-NPNVLFPYPSIYLRDYE---TKKFSSV  181

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
              E     + D ER   C D S +IIL+KT  ++E KYID LS L++K+ VPVG LV+  +
Sbjct  182   LESSANGIKDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVGSLVQDPM  241

Query  428   AD--GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
                  E   I +WL+       VFVSFGSEYFL++EE++E+ALGLELS+V+F+WVIRFP 
Sbjct  242   DQKVDEESSIIKWLN-----EIVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPK  296

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
              +   K+  + D LP+G+ ERVG+RG +V+ W PQ  IL+HSS+GGFVSHCGWSSV+E++
Sbjct  297   ED---KSTRVEDVLPKGFGERVGERGMIVDDWTPQAKILKHSSVGGFVSHCGWSSVLESI  353

Query  74    KFGVPIIAMPMQLDQPLNARV  12
             KFGVPIIAMPMQLDQPLNAR+
Sbjct  354   KFGVPIIAMPMQLDQPLNARL  374



>ref|XP_010525697.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Tarenaya 
hassleriana]
Length=454

 Score =   392 bits (1007),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 273/383 (71%), Gaps = 13/383 (3%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             +S+ VLMFPWLAHGH+ PFL LA+ +++RNF +Y  ST VNL+S + ++  K +  I+LV
Sbjct  7     KSLSVLMFPWLAHGHVSPFLELAKEMSERNFQVYFVSTLVNLNSFRPKIGSKYSEYIQLV  66

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL+LP+L +LPPHYHTTNGLPPHL+ TL KALDM+   FL+LL TL PDLV+YDF+Q WV
Sbjct  67    ELKLPNLSELPPHYHTTNGLPPHLINTLHKALDMASFNFLSLLKTLNPDLVIYDFMQQWV  126

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN-KRLFEPP  606
             P M ++ +IP+V FLS  AA  SYL H     P E++PFP L        R   R+ + P
Sbjct  127   PEMVSSLNIPSVHFLSSSAAFTSYLLHPNL-RPNEKFPFPNLSDIQGCLDRGIARISQKP  185

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
                D +VSD ER    L+ SS +IL+K+FR+LEG+ +D L +L+ K+ VPVGPLVR    
Sbjct  186   S--DNEVSDIERFAMSLERSSRLILVKSFRELEGECLDYLQSLLNKKMVPVGPLVRQSET  243

Query  425   DGENPEIK----EWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
             D EN E      EWLD K + STVFVSFGSE FL+ E++EE+A GLELS VNF+WVIRFP
Sbjct  244   D-ENDETSKSCIEWLDKKEKGSTVFVSFGSEIFLSAEDIEEIAFGLELSGVNFIWVIRFP  302

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
             + E     +   + LP+G+ ERV +RG ++E WAPQ  IL H S+GGF+SHCGWSS+ME+
Sbjct  303   SGE----EKTTKETLPKGFTERVNERGIIIEKWAPQARILRHESVGGFLSHCGWSSIMES  358

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             LK GVPIIA P+  DQP+NA++V
Sbjct  359   LKLGVPIIASPVHNDQPVNAKLV  381



>ref|XP_002270285.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase 
[Vitis vinifera]
Length=453

 Score =   392 bits (1006),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 266/385 (69%), Gaps = 9/385 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD   +S RVLM PWL HGHI PFL LA+ L +RNFYIY+CSTP+NL  ++  +  + + 
Sbjct  1     MDAKHQSRRVLMLPWLGHGHISPFLELAKKLAQRNFYIYLCSTPINLKPLRDNLCHRGST  60

Query  977   --SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
               SI+L+++ LPS  +LP HYHTT  LPPHLM TLK A D ++P F ++L T+KP LV+Y
Sbjct  61    ISSIQLIDIHLPSSSELPSHYHTTKDLPPHLMSTLKAAFDAARPAFCDILKTIKPSLVIY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             D+LQPW    A  ++I A++FLS GAA CS+  H    +P E+YPFP L   +   I  +
Sbjct  121   DYLQPWASMAACEENIRAIVFLSSGAACCSFYCHGSLDNPGEKYPFPALCFPE---IERR  177

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
             ++ +        +++ ER  G +  SS+I+LIKT +++E KYID LS LV K  +PVGPL
Sbjct  178   KITQFLHYTANGLTNMERFRGSMARSSNIVLIKTSKEIEAKYIDYLSVLVGKTIIPVGPL  237

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             V+      ++  I +WL  K   S VFVSFG+EYFL+ EE+EE+A GLELS V FLWV+R
Sbjct  238   VQDAANRDDDTVIMDWLSKKNPFSVVFVSFGTEYFLSVEEIEEIAHGLELSTVGFLWVVR  297

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             F     G   + I + LPEG+L+R+G+RG VVEGWAPQ  IL HSSIGGFVSHCGWSS +
Sbjct  298   F----HGGDEKTIHEVLPEGFLQRIGERGMVVEGWAPQAKILCHSSIGGFVSHCGWSSTL  353

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             EA+ FGVPIIA PM LDQPLNA++V
Sbjct  354   EAIMFGVPIIATPMHLDQPLNAKLV  378



>ref|XP_009793442.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=456

 Score =   388 bits (997),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 205/387 (53%), Positives = 277/387 (72%), Gaps = 11/387 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT   ++RVLMFPWLAHGHI P+L +A+ L  R FY+Y+CSTPVNL+ IKK++ +K +I
Sbjct  1     MDTEHSTLRVLMFPWLAHGHISPYLTVAKKLACRGFYVYLCSTPVNLNFIKKKIPQKYSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE  LP LP+LP  YHTTNG+PPHL+ TLKKA+ MSKP F  +++ LKP++++YD 
Sbjct  61    SIQLVEFHLPDLPELPLSYHTTNGIPPHLVSTLKKAVKMSKPNFYKIIENLKPNMLIYDI  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQPW   +A + +IPAV+ L+  AA  SY  H  +  P  E+PFP LYLR  E  + + +
Sbjct  121   LQPWAKEVANSYNIPAVMLLTFCAAMLSYRLHPVK-KPGTEFPFPALYLRKIERQQREEM  179

Query  617   FEP-PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
              E   ++ D D  D    +  ++    IIL+ T R  E KYID  + L++ + +PVGP V
Sbjct  180   LEKAAKEKDPDDKDPFAEEETMN---KIILMSTSRATEAKYIDYFTELIQWKIIPVGPPV  236

Query  440   RSLVA--DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             +      DG+  ++ +WL  K   STVFVSFGS+YFL++E++EE+ALGLELS VNF+WV+
Sbjct  237   QETTNEYDGDVDDLIDWLGNKYENSTVFVSFGSQYFLSKEDLEEIALGLELSNVNFIWVV  296

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP    GE+ R + +ALPEG+LER+G RG+VV+GWAPQ  IL H S GGFVSHCGW+SV
Sbjct  297   RFP---KGEEVR-VEEALPEGFLERIGDRGRVVDGWAPQLRILSHPSTGGFVSHCGWNSV  352

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVA  6
             ME++ F VPIIA+PM LDQP+NAR++ 
Sbjct  353   MESIDFRVPIIALPMHLDQPINARLIV  379



>ref|XP_009609108.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=454

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/385 (53%), Positives = 275/385 (71%), Gaps = 9/385 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT    ++  +FPWLA+GHI PFL LA+ L+ R F I +CSTP+NLS I+KR+ +  + 
Sbjct  1     MDTEHTKLKAFLFPWLAYGHISPFLELAKKLSDRGFLIELCSTPINLSFIQKRIPQSYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             +I+LVEL LP  P LPPHYHTTNGLP HL  TL KAL ++KP    +L T KPDL++YD 
Sbjct  61    TIQLVELILPEFPQLPPHYHTTNGLPLHLNSTLHKALKLAKPNLFTILKTRKPDLIIYDV  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +Q W   +A++ +IP+  F + GAA CSY  H+ +     EYPFP L+L D+E  R ++L
Sbjct  121   MQLWTFGVASSLNIPSARFFTSGAAMCSYFVHLYKNLEV-EYPFPALHLYDYEIERARKL  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +  ++ + +  D    +  +     I+LI T R+LEGKY++ L+ +++ R  P+G LV+
Sbjct  180   VQRNDKENENKDDQPEEE--MPPQEGIMLISTSRELEGKYMNYLAEIIETRIFPIGTLVQ  237

Query  437   SLVADG-ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               VA G EN  I +WLD K   STVFVSFGSEYFLT+EE EE+ALGLELS+VNF+WV+RF
Sbjct  238   DPVASGDENMNIMQWLDSKKELSTVFVSFGSEYFLTKEEREEIALGLELSQVNFIWVVRF  297

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P    GEK + + +ALP+G+LERVG RG +VE WAPQ  IL HSSIGGFVSHCGW+S+ E
Sbjct  298   P---KGEK-QNLEEALPQGFLERVGDRGMIVE-WAPQAKILTHSSIGGFVSHCGWNSISE  352

Query  80    ALKFGVPIIAMPMQLDQPLNARVVA  6
             +++FGVPIIA+PMQLDQP+NA+++ 
Sbjct  353   SIEFGVPIIAIPMQLDQPMNAKLLV  377



>ref|XP_006367683.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 203/378 (54%), Positives = 266/378 (70%), Gaps = 11/378 (3%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++RVLMFP+LA+GHI PFL +A+ L  R F IY+CSTP+NL    K++ EK A SI+LVE
Sbjct  11    TLRVLMFPFLAYGHISPFLNVAKKLADREFLIYLCSTPINLKYASKKIPEKYADSIQLVE  70

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTN LPPHL  TL+KAL MSKP F  +L  LKPDLV+YD LQ W  
Sbjct  71    LHLPELPELPPHYHTTNDLPPHLHSTLQKALKMSKPNFSKILQNLKPDLVIYDILQQWAE  130

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A   +IPAV  L+ GA   SY F +    P + +PFPE+YLR  E ++     +  +Q
Sbjct  131   RVANEHNIPAVKLLTSGATVFSY-FTISLNKPGDVFPFPEIYLRKSEQVKMNETLKCAKQ  189

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-SLVAD  423
             I+ D  D +      DG+  I+L+ T R +E KYID  +  +  + +PVGP V+ S+  D
Sbjct  190   IEPDDGDRQA-----DGNRQIMLMSTSRIIEAKYIDYCTEFLNLKVIPVGPPVQDSITDD  244

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVA GLELS VNF+WV RFP  E  
Sbjct  245   ADDMELIDWLGTKDEDSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGE--  302

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                R + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+SVME++ FGV
Sbjct  303   --ERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESIDFGV  360

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMPM L+QP+NAR++
Sbjct  361   PIIAMPMHLEQPMNARLI  378



>gb|KCW51496.1| hypothetical protein EUGRSUZ_J01013 [Eucalyptus grandis]
Length=423

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 264/379 (70%), Gaps = 34/379 (9%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             QR I+VLM PWLAHGHI PFL LA+ L+ RNF+I++CSTPVNLSSIK ++S+K + SI+L
Sbjct  2     QRPIKVLMLPWLAHGHISPFLELAKRLSTRNFHIHLCSTPVNLSSIKPKISDKYSSSIEL  61

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPSLPDLPPHYHTT GLPPHLM TLK A DM+  GF +++ +L PDL++ D  QPW
Sbjct  62    VELHLPSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASLGFSDIVKSLGPDLLICDLFQPW  121

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
                +A +  +P V+F   GA   S++FH+                     I+N       
Sbjct  122   AAEVAKSHGLPTVVFFIVGARTISFMFHM---------------------IKNA------  154

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
                   V D +R+   ++ SS+ IL+KTFR+++GKY+D LS+L  K+ + VGPLV     
Sbjct  155   ---STRVKDEDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLSGKKVLTVGPLVEDPDN  211

Query  425   DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
               +   I EWLD + + ST+FVSFGSEYFLTE+E EE+A GLELS VNF+WVIRFP  E+
Sbjct  212   MEDGDSIIEWLDKREQSSTIFVSFGSEYFLTEKEREEIAHGLELSNVNFIWVIRFPVGES  271

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
              E    + +ALP+G+LERV  RG V++GWAPQG ILEH SIGGFVSHCGW S+ME++K G
Sbjct  272   IE----LEEALPKGFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSLMESMKSG  327

Query  65    VPIIAMPMQLDQPLNARVV  9
             VPIIAMPM  DQPLNAR+V
Sbjct  328   VPIIAMPMLHDQPLNARMV  346



>dbj|BAG80557.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=454

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 204/380 (54%), Positives = 269/380 (71%), Gaps = 10/380 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + ++RVLMFPWLA+GHI PFL +A+ L  R F IY+CST +NL S  K++ EK + SI+L
Sbjct  9     KNTLRVLMFPWLAYGHISPFLNVAKKLVDRGFLIYLCSTAINLKSTIKKIPEKYSDSIQL  68

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             +EL LP LP+LPPHYHTTNGLPPHL  TL+KAL MSKP F  +L  LKPDLV+YD LQ W
Sbjct  69    IELHLPELPELPPHYHTTNGLPPHLNHTLQKALKMSKPNFSKILQNLKPDLVIYDLLQQW  128

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
                +A  Q+IPAV  L+ GAA  SY F++ +  P  E+PFP +YLR +E    +++ E  
Sbjct  129   AEGVANEQNIPAVKLLTSGAAVLSYFFNLVK-KPGVEFPFPAIYLRKNEL---EKMSELL  184

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
              Q   D  + + +D   DG+  ++L+ T R +E KYID  S L   + VPVGP V+  +A
Sbjct  185   AQSAKD-KEPDGVDPFADGNMQVMLMSTSRIIEAKYIDYFSGLSNWKVVPVGPPVQDPIA  243

Query  425   -DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              D +  E+ +WL  K   STVFVSFGSEYFL++E+ EE+A GLELS VNF+WV RFP  E
Sbjct  244   DDADEMELIDWLGKKDENSTVFVSFGSEYFLSKEDREEIAFGLELSNVNFIWVARFPKGE  303

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
                  + + DALP+G+LER+G RG+V++ +APQ  IL H S GGF+SHCGW+SVME++ F
Sbjct  304   ----EQNLEDALPKGFLERIGDRGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDF  359

Query  68    GVPIIAMPMQLDQPLNARVV  9
             GVPIIAMP+ LDQP+NAR++
Sbjct  360   GVPIIAMPIHLDQPMNARLI  379



>ref|XP_009775011.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=455

 Score =   384 bits (987),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 203/390 (52%), Positives = 268/390 (69%), Gaps = 15/390 (4%)
 Frame = -3

Query  1157  MDTS-----QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVS  993
             MDT        +++VLMFPWLA+GHI PFL +A+ L  + F IY+CSTP+NL S+ K++ 
Sbjct  1     MDTQVTECGNSNLKVLMFPWLAYGHISPFLNVAKKLADKGFLIYLCSTPINLKSVVKKIP  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
             EK  +SI+L+E  LP  P+LPPHYHTTNGLPPHL  TL+KAL MSKP F  +L+ LKPDL
Sbjct  61    EKYFVSIQLIEYHLPESPELPPHYHTTNGLPPHLNHTLQKALKMSKPNFSKILENLKPDL  120

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             VVYD LQ W   +A  Q+IPAV  L+ GAA  SY F++ +  P  E+PFP +YLR  E +
Sbjct  121   VVYDILQQWAEDVANEQNIPAVKLLTSGAAVFSYFFNLVK-KPEVEFPFPAVYLRKIELV  179

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             +   +            +++ +D   +G+  I+L+ T R +E KYID    L     +PV
Sbjct  180   KLGEMMAK----SAKEKESDDVDPFTEGNMQIMLMSTSRIIEAKYIDYFIELSNWNVIPV  235

Query  452   GPLVR-SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             GP V+ S+  D ++ E+ +WL  K   STVFVSFGSEYFLT+E+ EE+A GLE+S VNF+
Sbjct  236   GPPVQDSMGNDTDDVELFDWLGKKDENSTVFVSFGSEYFLTKEDREEIAFGLEISNVNFI  295

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WV+RFP  E     + + +ALP+G+LER+GKRGKV+  WAPQ  IL H + GGF+SHCGW
Sbjct  296   WVVRFPKGE----EQNLENALPQGFLERIGKRGKVLNKWAPQPRILNHPNTGGFISHCGW  351

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             +SVME++ FGVPIIAMPM LDQPLNAR+  
Sbjct  352   NSVMESVDFGVPIIAMPMHLDQPLNARLTV  381



>ref|XP_009616666.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=455

 Score =   384 bits (986),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 201/390 (52%), Positives = 273/390 (70%), Gaps = 15/390 (4%)
 Frame = -3

Query  1157  MDTS-----QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVS  993
             MDT        ++RV+MFPWLA+GHI PFL +++ L  R F IY+CSTP+NL SI K++ 
Sbjct  1     MDTQVTERGNTNLRVIMFPWLAYGHISPFLNVSKKLVDRGFLIYLCSTPINLKSIVKKIP  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
             EK ++SI+L+E  LP  P+LPPHYHTTNGLPPHL  TL+KA  +SKP F  +L  LKPDL
Sbjct  61    EKYSVSIQLIEYHLPESPELPPHYHTTNGLPPHLNYTLQKASKLSKPNFSKILKNLKPDL  120

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             VVYD LQ W   +A   +IPAV  L+ GAA  SY F++ +  P  E+PFP +YLR+ E +
Sbjct  121   VVYDVLQQWAEGVANEHNIPAVKLLTSGAAVFSYYFNLVKT-PGIEFPFPAIYLRNIELV  179

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             +   +            +++ +D   +G+  I+L+ T R +E KYID  S L   + +PV
Sbjct  180   KLGEVMAK----SAKQKESDDVDLFTEGNMQIMLMSTSRIIEAKYIDYFSELSNWKVIPV  235

Query  452   GPLVR-SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             GP V+ S+ +D ++ E  +WL  K   STVFVSFGSEYFLT+E+MEE+A GLE+S VNF+
Sbjct  236   GPPVQDSMASDADDVEFFDWLGKKDENSTVFVSFGSEYFLTKEDMEEIAFGLEISNVNFI  295

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WV+RFP  E     + + +ALP+G+LER+G+RG+V++ WAPQ  IL H +IGGF+SHCGW
Sbjct  296   WVVRFPKGE----EQNLENALPQGFLERIGERGRVLKKWAPQPRILNHPNIGGFISHCGW  351

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             +SVME++ FGVPIIAMP+ LDQPLNAR++ 
Sbjct  352   NSVMESVDFGVPIIAMPIHLDQPLNARLMV  381



>ref|XP_006367680.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/378 (54%), Positives = 267/378 (71%), Gaps = 10/378 (3%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++ V+MFPWLA+GHI PFL +A+ L  R F IY+CSTP+NL S  K++ EK A SI+L+E
Sbjct  12    NLSVVMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIKKIPEKYADSIQLIE  71

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNGLPPHL  TLKKAL MSKP F  +L  LKPDLV+YD +Q W  
Sbjct  72    LHLPELPELPPHYHTTNGLPPHLNHTLKKALKMSKPNFSKILQNLKPDLVIYDIMQQWAE  131

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A  Q+IPAV  L+ G A  SY F++ +  P  E+PFP +Y    E ++   +     +
Sbjct  132   RVANEQNIPAVRLLTFGVAVLSYFFNLVK-KPGVEFPFPAIYFSKIEQVKLGEMMARSAK  190

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA-D  423
              D +  D    D   DG++ I L+ T R +E KYID LS L   + VPVGP V+ L+  D
Sbjct  191   -DQEPDDD---DQTADGTTQIALMCTSRIIEAKYIDFLSELSNWKVVPVGPPVQDLITND  246

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVA GLELS V+F+WV RFP  E  
Sbjct  247   ADDKELMDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVDFIWVARFPKGE--  304

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                + + DALP+G+LER+G+RG+V++ +APQ  IL H+S GGF+SHCGW+SVME++ FGV
Sbjct  305   --EQNLEDALPKGFLERIGERGRVLDKFAPQLRILNHTSTGGFISHCGWNSVMESIDFGV  362

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMPM LDQP+NAR++
Sbjct  363   PIIAMPMHLDQPMNARLI  380



>ref|XP_004249995.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=453

 Score =   383 bits (983),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 269/378 (71%), Gaps = 10/378 (3%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++RV+MFPWLA+GHI PFL +A+ L  R F IY+CSTP+NL S  +++ EK A SI L+E
Sbjct  12    NLRVVMFPWLAYGHISPFLYVAKKLADRGFLIYLCSTPINLKSTIEKIPEKYADSIHLIE  71

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNGLPPHL  TL+KAL MSKP    +L  LKPDL++YD LQ W  
Sbjct  72    LHLPELPELPPHYHTTNGLPPHLNHTLQKALKMSKPNLSKILKNLKPDLMIYDVLQQWAE  131

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A  QSIPAV  L+ GAA  SY  ++ +  P  E+PFP++YLR  E ++   + E   +
Sbjct  132   RVANEQSIPAVRLLTFGAAVFSYFCNLVK-KPGVEFPFPDIYLRKIEQVKLGEMLEKSAK  190

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA-D  423
              D D  D ER+   +D    I LI T R +E KYID L  L   + VPVG  V+ L+  D
Sbjct  191   -DQDPDDEERL---VDEYKQIALICTSRTIEAKYIDFLLELSNLKVVPVGSPVQDLITND  246

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVALGLELS VNF+WV RFP  E  
Sbjct  247   ADDMELIDWLGSKDENSTVFVSFGSEYFLSKEDMEEVALGLELSNVNFVWVARFPKGE--  304

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                + + DALP+G+LER+G+RG+V++ +APQ  IL H+S GGF+SHCGW+SVME++ FGV
Sbjct  305   --EQNLEDALPKGFLERIGERGRVLDKFAPQLRILNHTSTGGFISHCGWNSVMESIHFGV  362

Query  62    PIIAMPMQLDQPLNARVV  9
             PI+AMPM LDQP+NAR++
Sbjct  363   PIVAMPMHLDQPMNARLI  380



>ref|XP_009763810.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=454

 Score =   381 bits (979),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 270/385 (70%), Gaps = 9/385 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT    ++  +FPWLA+GHI PFL LA+ L+ R F I +CSTP+NLS I+KR+ +  + 
Sbjct  1     MDTENTKLKAFLFPWLAYGHISPFLELAKKLSDRGFLIELCSTPINLSFIQKRIPKSYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             +I+LVEL LP  P LP HYHTTNGLP HL   L KAL ++KP    +L T KPD+++YD 
Sbjct  61    TIQLVELILPEFPQLPSHYHTTNGLPLHLNSILHKALKLAKPNLFTILKTRKPDIIIYDV  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +Q W   +A+  +IP+  F + GAA CSY  H+ +     EYPFP L+L D+E  R ++L
Sbjct  121   MQLWTFGIASLLNIPSAQFFTSGAAMCSYFVHLYKNLDV-EYPFPALHLLDYEIERARKL  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 E+ + +  D    +  +     I+LI T R+LEGKY+D L+ +++ R +P+G LV+
Sbjct  180   VHKNEKENENKDDQPEEE--MPPQEGIMLISTCRELEGKYMDYLAEIIETRILPIGTLVQ  237

Query  437   SLVADGE-NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               +A GE N  I +WLD K   STVFVSFGSEYFLT+EE EE+ALGLELS+VNF+WV+RF
Sbjct  238   DPLASGEGNMNIMQWLDSKKELSTVFVSFGSEYFLTKEEREEIALGLELSQVNFIWVVRF  297

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E     + + +ALP+G+LERVG RG +VE WAPQ  IL HSSIGGFVSHCGW+S+ E
Sbjct  298   PKGE----KQNLEEALPQGFLERVGDRGMIVE-WAPQAKILTHSSIGGFVSHCGWNSISE  352

Query  80    ALKFGVPIIAMPMQLDQPLNARVVA  6
             +++FGVPIIA+PMQLDQP+NA+++ 
Sbjct  353   SIEFGVPIIAIPMQLDQPMNAKLLV  377



>sp|F8WKW8.1|UGT9_GARJA RecName: Full=Beta-D-glucosyl crocetin beta-1,6-glucosyltransferase; 
AltName: Full=UDP-glucose glucosyltransferase 9; Short=GjUGT9; 
AltName: Full=UDP-glycosyltransferase 94E5 [Gardenia 
jasminoides]
 dbj|BAK55744.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=444

 Score =   381 bits (978),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 269/377 (71%), Gaps = 14/377 (4%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPS  945
             MFPWLA+GHI P+L LA+ LT R F IYICSTP+NL  IKKR++ K +++IKLVEL LP 
Sbjct  1     MFPWLAYGHISPYLELAKRLTDRGFAIYICSTPINLGFIKKRITGKYSVTIKLVELHLPD  60

Query  944   LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
              P+LPPHYHTTNGLPPHLM TLK+AL+ +KP   N+L TLKPD V+YD  Q W  A+  A
Sbjct  61    TPELPPHYHTTNGLPPHLMATLKRALNGAKPELSNILKTLKPDFVIYDATQTWTAALTVA  120

Query  764   QSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDV  585
              +IPAV FL+   +  +Y  H+    P  E+PFP +YL D E  +  R      + D + 
Sbjct  121   HNIPAVKFLTSSVSMLAYFCHLFM-KPGIEFPFPAIYLSDFEQAK-ARTAAQDARADAEE  178

Query  584   SD--TERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD--GE  417
             +D   ER +   D   SI L+K+ R +EGKYID L +L+K + +PVG LV   V D  G+
Sbjct  179   NDPAAERPNRDCD---SIFLVKSSRAIEGKYIDYLFDLMKLKMLPVGMLVEEPVKDDQGD  235

Query  416   NP-EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGE  240
             N  E+ +WL  K + STV VSFG+EYFLT+EEMEE+A GLELS+VNF+WV+RF     G+
Sbjct  236   NSNELIQWLGTKSQRSTVLVSFGTEYFLTKEEMEEIAHGLELSEVNFIWVVRFA---MGQ  292

Query  239   KARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVP  60
             K R   +ALPEG+LERVG RG++VEGWAPQ  +L H S GGF+ HCGW+SV+E+++FGVP
Sbjct  293   KIRP-DEALPEGFLERVGDRGRIVEGWAPQSEVLAHPSTGGFICHCGWNSVVESIEFGVP  351

Query  59    IIAMPMQLDQPLNARVV  9
             +IAMPM LDQPLNAR+V
Sbjct  352   VIAMPMHLDQPLNARLV  368



>dbj|BAO51835.1| UDP-glycosyltransferase 94P1 [Camellia sinensis]
Length=453

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 269/386 (70%), Gaps = 12/386 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD+ +  + VLM PWLA GHI PFL LA+ LT +NF+IY CSTP+NL SIKKR+++K ++
Sbjct  1     MDSKKSKMNVLMLPWLAQGHITPFLELAKKLTNKNFHIYFCSTPINLISIKKRITDKYSL  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE+ LPSLP+LPPHYHTTNGLP HL  TLK A +M+   F  +L+TL PDLV+YD 
Sbjct  61    SIELVEIHLPSLPELPPHYHTTNGLPIHLNSTLKTAFEMASTSFSTILNTLSPDLVIYDV  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
                W  + A +  IPAV  +  GA   S+  H+ +   + E+PFP + L+     + +  
Sbjct  121   SPSWAQSTALSFDIPAVQLMITGATVVSFGQHMIKHCGSVEFPFPAIKLQGFHETQFRHF  180

Query  617   FEP--PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              E    E  D  V+       C     + +L  TFR+LEGKYID L  + +K+ VPVGPL
Sbjct  181   VETVVKEYNDKQVASVNDQPSC-----NFMLYNTFRELEGKYIDYLPVIGEKKVVPVGPL  235

Query  443   VRSLVAD-GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             V+ +  D  E+ EI +WLD K   ST+FVSFGSEYF+++EE+EE+A GLELS VNF+WV+
Sbjct  236   VQGIDDDENEHSEIIQWLDNKGEYSTLFVSFGSEYFMSKEEIEEIAHGLELSMVNFIWVV  295

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP  E  E    + +ALP+G+++RVG+RG VVEGWAPQ  IL HSS GGFVSHC W+SV
Sbjct  296   RFPEVEKVE----LEEALPKGFIDRVGERGLVVEGWAPQARILTHSSTGGFVSHCEWNSV  351

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             +E+LKFGVP++A+PMQ +QPLNA++V
Sbjct  352   LESLKFGVPMVAIPMQYEQPLNAKLV  377



>ref|XP_004250482.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   379 bits (974),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/385 (53%), Positives = 265/385 (69%), Gaps = 14/385 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD    +I V+M PW+AHGHI PFL LA+ L+KRNF+IY+CSTP+NLSSIKK ++++ + 
Sbjct  1     MDVKNNTINVVMLPWIAHGHISPFLELAKKLSKRNFHIYLCSTPINLSSIKKNITKEYSQ  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPS P+ PPHYHTTNGLP HL  TL +A   + P F  +L TL PDLV+YD 
Sbjct  61    SIELVELHLPSSPNFPPHYHTTNGLPHHLKETLVEAFFSAGPAFSKILQTLNPDLVIYDL  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
                WV  +A++ +IPAV FL+          H+    P  E+PFPE+YLR+HE I  ++L
Sbjct  121   NITWVAELASSINIPAVQFLTFSIGMIVLFLHM-FSKPGVEFPFPEIYLREHEVIPMQKL  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              +    I+   +  E I    D    IIL+K F   E KY+D  S LV K+ VP+G LV 
Sbjct  180   AKGYSNINIKDTFMESIRQSRD----IILVKDF---EVKYMDYFSQLVSKKIVPIGSLVN  232

Query  437   SLV--ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             + +   D     I +WLD K + S+VFVSFGSE+FL++EE+ +VA GLELSKVNF+WVIR
Sbjct  233   NSIDQIDEHALSITQWLDKKEKGSSVFVSFGSEWFLSKEEIHQVAQGLELSKVNFVWVIR  292

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP  E      +I D LP+G+LERVG+RG V++ WAPQ  IL+H SIGGFVSHCGW S+ 
Sbjct  293   FPQDE----KISIDDVLPQGFLERVGERGMVLDKWAPQSTILQHKSIGGFVSHCGWGSIT  348

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++KFGVPIIAMP+  DQP+NAR+V
Sbjct  349   ESMKFGVPIIAMPIYNDQPINARIV  373



>ref|XP_006367533.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   379 bits (974),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 207/382 (54%), Positives = 264/382 (69%), Gaps = 10/382 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT+  S+RVLMFPWLAHGHI P+L +++ L  R F I +CSTPVNL+ IKKR+ +K ++
Sbjct  1     MDTTT-SLRVLMFPWLAHGHISPYLTVSKKLADRGFDILLCSTPVNLNLIKKRIPKKYSV  59

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LP LPDLPP YHTTNGLPPHL  TLKKA+ MSKPGF  +L  LKPDLV++D 
Sbjct  60    SIQLVELCLPELPDLPPEYHTTNGLPPHLNSTLKKAVKMSKPGFSKILRDLKPDLVIHDV  119

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQ W   +A + +IPA+  ++ G A  SY  H  R  P  E+PFP +YL     I  KR+
Sbjct  120   LQVWAKEIANSYNIPAITLVTFGGAVLSYFMHPMR-KPGIEFPFPAIYLTK---IEQKRM  175

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  EQ+  D    +      D +  I+L+ T   +E KYID L+ L + + VPVGP ++
Sbjct  176   REMMEQVGKDKDPDDGDPFAEDPTQVILLMSTSLSIESKYIDYLNELTQAKYVPVGPPIQ  235

Query  437   S-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               +  D  + E+ +WL  K   STVFVSFGSEYFLT+E+M+E+A GLE S VNF+WV+RF
Sbjct  236   EPMNEDDGDIELIDWLGKKEEHSTVFVSFGSEYFLTKEDMKEIAYGLEHSNVNFIWVVRF  295

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E       + +ALP G+LER+  RG+VV GWAPQ  IL H S GGFVSHCGW+SVME
Sbjct  296   PKGEEVN----LEEALPTGFLERIENRGRVVNGWAPQPRILSHPSTGGFVSHCGWNSVME  351

Query  80    ALKFGVPIIAMPMQLDQPLNAR  15
             ++ FGVPIIAMPM +DQP+NAR
Sbjct  352   SIDFGVPIIAMPMHIDQPINAR  373



>ref|XP_006436669.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
 gb|ESR49909.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
Length=435

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 268/390 (69%), Gaps = 31/390 (8%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSIKKRVSEKDA  981
             M+  QR+  VLMFPWLAHGH+ PFL L +  TKR NFYIY CSTP  L SIK  +S+  +
Sbjct  1     MNNRQRNYCVLMFPWLAHGHVFPFLELTKKFTKRSNFYIYFCSTPAILDSIK--LSDNFS  58

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             +SI+L+EL LPSLP+LPPHYHTT GLP HLMPTLKKA DM+   F N+L  + PDL++YD
Sbjct  59    LSIQLIELHLPSLPELPPHYHTTKGLPLHLMPTLKKAFDMASSSFFNILKNVNPDLLIYD  118

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAE---EYPFPELYLRDHEFIR  630
             F+QPW P +A + +IP+VLFL+  A    +LFH     P+E   E+PF  +++  HE+++
Sbjct  119   FIQPWAPTLALSLNIPSVLFLTSSATMGGFLFHTFEKTPSEDDGEFPFSSIFI--HEYMK  176

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
              K         +G + D ++   C D S ++ILIKTFR L+GKYID LS L+KK+ VPVG
Sbjct  177   PKFSHLVDSSSNG-IKDKDKFLQCCDSSCNVILIKTFRDLQGKYIDYLSVLMKKKLVPVG  235

Query  449   PLVRSLVADG---ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNF  279
             PLV   V +    E  EI +WLD K R STVFVSFGSEYFL +EEME +ALGLE S V+F
Sbjct  236   PLVEDPVEEDDHEEGIEIIQWLDKKERSSTVFVSFGSEYFLPKEEMEGIALGLEFSGVDF  295

Query  278   LWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCG  99
             +WV+RFP   +G K + + + LP+ +LER  +R  VVE               GFVSHCG
Sbjct  296   IWVVRFP---SGVKVK-VDEELPKHFLERTKERAMVVE---------------GFVSHCG  336

Query  98    WSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             WSSVME++K GVPIIAMPM LDQPLNAR+V
Sbjct  337   WSSVMESMKLGVPIIAMPMHLDQPLNARLV  366



>ref|XP_009593727.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=482

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 277/387 (72%), Gaps = 9/387 (2%)
 Frame = -3

Query  1160  YMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             +MDT Q  +RVLMFPWLA+GHI P+L +A+ L  R FY+Y+CSTPVNL+ IKK++ +K +
Sbjct  24    FMDTEQSILRVLMFPWLAYGHISPYLTVAKKLACRGFYVYLCSTPVNLNFIKKKIPQKYS  83

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              SI+LVE  LP LP+LPP YHTTNG+PPHL  TLKKAL MSKP F  +++ LKP++++YD
Sbjct  84    FSIQLVEFHLPDLPELPPSYHTTNGIPPHLNYTLKKALKMSKPNFYKIIENLKPNMLIYD  143

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              LQPW   +A + +IPAV+ L+  AA  SY+FH  +  P  E+PFP LYLR+ E  R + 
Sbjct  144   ILQPWAKEVANSYNIPAVMLLTFSAAMLSYIFHPVK-KPGTEFPFPALYLREIERQRREE  202

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             + E   + + D  D +      +  + IILI T R  E KYID  + L++ +  PVGP V
Sbjct  203   MMEKAAK-EKDPDDKDPFAEEEEPMNKIILISTSRATEAKYIDYFTELIQWKIAPVGPPV  261

Query  440   RSLVAD---GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    +     + ++ +WL  K   STVFVSFGS+YFL++E++EE+ALGLELS VNF+WV
Sbjct  262   QETTNEYDGDLDDDLIDWLGKKYENSTVFVSFGSQYFLSKEDLEEIALGLELSNVNFIWV  321

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP    GE+ R + +ALPEG+LER+G RG+VV GWAPQ  IL H S GGFVSHCGW+S
Sbjct  322   VRFP---KGEEVR-VEEALPEGFLERIGDRGRVVNGWAPQLRILSHPSTGGFVSHCGWNS  377

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             VME++ FGVPIIA+PM LDQP+NAR++
Sbjct  378   VMESIDFGVPIIALPMHLDQPINARLI  404



>ref|XP_004234916.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=453

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 205/382 (54%), Positives = 265/382 (69%), Gaps = 10/382 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDTS  S+RVLMFPWLAHGHI P+L +++ L  R F I +CSTPVNL+ IKKR+ +K ++
Sbjct  1     MDTST-SLRVLMFPWLAHGHISPYLTVSKKLADRGFDILLCSTPVNLNLIKKRIPKKYSV  59

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL+LP LP+LPP YHTTNGLPPHL  TLKKA+ MSKP F  +L  LKPDLV++D 
Sbjct  60    SIQLVELRLPELPNLPPEYHTTNGLPPHLNSTLKKAVKMSKPEFSKILQDLKPDLVIHDV  119

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             LQ W   +A + +IPA+  ++ G A  SY  H  R  P  E+PFP +YL     I  KR+
Sbjct  120   LQVWAKKIANSYNIPAITLVTFGGAVLSYFMHPMR-KPGTEFPFPAIYLTK---IEQKRM  175

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  EQ+  D    +      D +  I+L+ T   ++ KYID L+ L +   VP+GP ++
Sbjct  176   REMMEQVYKDKDPDDGDPFAEDPTQVILLMSTSLSIDSKYIDYLNELTQANYVPIGPPIQ  235

Query  437   S-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               +  DG + E+ +WL  K   STVFVSFGSEYFLT+E+MEE+A GLE S VNF+WV+RF
Sbjct  236   EPMNEDGGDIELIDWLGKKEEHSTVFVSFGSEYFLTKEDMEEIAYGLEHSNVNFIWVVRF  295

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E  +    + +AL  G+LER+  RG+VV+GWAPQ  IL H S GGFVSHCGW+SVME
Sbjct  296   PKGEEVD----LEEALSTGFLERIENRGRVVDGWAPQPRILSHPSTGGFVSHCGWNSVME  351

Query  80    ALKFGVPIIAMPMQLDQPLNAR  15
             ++ FGVPIIAMPM +DQP+NAR
Sbjct  352   SIDFGVPIIAMPMHIDQPINAR  373



>ref|XP_006363504.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=446

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 267/383 (70%), Gaps = 15/383 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             ++ I VLMFPWL +GHI PFL LA+ L++RNF I++CST  NL+ I  R  +  + SIKL
Sbjct  4     EKPISVLMFPWLGYGHISPFLELAKKLSQRNFIIHLCSTKANLTPI--RAKQYSSSSIKL  61

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             +EL L +  +LPPH HTTNG PPHLM TLK+A D S P F  +L TLKPDL++YDFLQPW
Sbjct  62    LELPLLT-TNLPPHQHTTNGFPPHLMDTLKQAFDSSTPQFTKILKTLKPDLLIYDFLQPW  120

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAE-EYPFPE-LYLRDHEF--IRNKRL  618
              P  A+  +IPAV F+S  +   +Y++H     P   E+PF   +Y RD+E   I   + 
Sbjct  121   APLAASQLNIPAVEFISSSSTMTAYMWHDLLKKPKGIEFPFSSTIYYRDYEMASIERSKA  180

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
               P E+I+   +D  R+      S+ I+LIK+F ++EGKY + +++L  K+ VPVGPLV+
Sbjct  181   VIPLEKIE---ADKNRVGQSFVLSNHIVLIKSFDEIEGKYSNYITSLTGKKIVPVGPLVQ  237

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 D  N  + +WL+ K + STVFVSFGSEYFL+ E++ E+A GLE SKVNF+W +RF 
Sbjct  238   EPTPDDTNSNLIKWLNTKDKRSTVFVSFGSEYFLSNEDLLEIAYGLESSKVNFIWPLRFA  297

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E       I +ALP+G++ RVG RG+V +GWAPQ  ILEHSSIGGFVSHCGWSSVME+
Sbjct  298   KEEV-----EIEEALPKGFVNRVGDRGRVFKGWAPQAKILEHSSIGGFVSHCGWSSVMES  352

Query  77    LKFGVPIIAMPMQLDQPLNARVV  9
             +K+GVPIIAMPM LDQP+N+R++
Sbjct  353   MKYGVPIIAMPMHLDQPMNSRLI  375



>ref|XP_004250485.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=442

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 264/378 (70%), Gaps = 15/378 (4%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++RVLMFPWLA+GHI PFL +A+ L  R F IY+CST +NL SI K++ EK A SI L+E
Sbjct  4     NLRVLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTRINLESIIKKIPEKYADSIHLIE  63

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             LQLP LP+LPPHYHTTNGLPPHL PTL KAL MSKP F  +L  LKPDL++YD LQPW  
Sbjct  64    LQLPELPELPPHYHTTNGLPPHLNPTLHKALKMSKPNFSRILQNLKPDLLIYDVLQPWAE  123

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A  Q+IPA   L+  AA  SY F   R +P  E+PFP ++L + E ++ + +     +
Sbjct  124   HVANEQNIPAGKLLTSCAAVFSYFFSF-RKNPGVEFPFPAIHLPEVEKVKIREILAKEPE  182

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA-D  423
               G      R+D   +G+  ++L+ T R +E KYID  + L   + VPVGP  + L+  D
Sbjct  183   EGG------RLD---EGNKQMMLMCTSRTIEAKYIDYCTELCNWKVVPVGPPFQDLITND  233

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              +N E+ +WL  K   STVFVSFGSEYFL++E+MEEVA  LELS VNF+WV RFP  E  
Sbjct  234   ADNKELIDWLGTKHENSTVFVSFGSEYFLSKEDMEEVAFALELSNVNFIWVARFPKGE--  291

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                R + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+S ME++ FGV
Sbjct  292   --ERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESIDFGV  349

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMP+  DQP+NA+++
Sbjct  350   PIIAMPIHNDQPINAKLM  367



>ref|XP_004249992.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=470

 Score =   376 bits (966),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 264/378 (70%), Gaps = 6/378 (2%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             +++VLMFP+LA+GHI P+L +A+ L  R F IY CSTP+NL S  +++ EK A SI L+E
Sbjct  26    TLKVLMFPFLAYGHISPYLNVAKKLADRGFLIYFCSTPINLKSTIEKIPEKYADSIHLIE  85

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP LPPHYHTTNGLPP+L   L+KAL MSKP F  +L  LKPDLV+YD LQ W  
Sbjct  86    LHLPELPQLPPHYHTTNGLPPNLNQVLQKALKMSKPNFSKILQNLKPDLVIYDILQRWAK  145

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A  Q+IPAV  L+ GAA  SY F+V +  P  E+PFP +YLR  E +R   +    ++
Sbjct  146   HVANEQNIPAVKLLTSGAAVFSYFFNVLK-KPGVEFPFPGIYLRKIEQVRLSEMMSKSDK  204

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA-D  423
                   D +  D  +DG+  I+L+ T R +E KYID  + L   + VPVGP V+ L+  D
Sbjct  205   EKELEDDDDDDDLLVDGNMQIMLMSTSRTIEAKYIDFCTALTNWKVVPVGPPVQDLITND  264

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVA  LELS VNF+WV RFP  E  
Sbjct  265   VDDMELIDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFALELSNVNFIWVARFPKGE--  322

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                R + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+S ME++ FGV
Sbjct  323   --ERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESIDFGV  380

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMPM LDQP+NAR++
Sbjct  381   PIIAMPMHLDQPMNARLI  398



>ref|XP_006361192.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=436

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 265/378 (70%), Gaps = 20/378 (5%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++RVLMFPWLA+GHI PFL +A+ L  R F IY+CSTP+NL S  K++ EK A SI+L+E
Sbjct  3     TLRVLMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIKKIPEKYADSIQLIE  62

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNG PPHL  TL KAL+MSKP F  +L  LKPDLV+YD LQ W  
Sbjct  63    LHLPELPELPPHYHTTNGFPPHLNNTLHKALEMSKPNFSKILQNLKPDLVIYDMLQQWAE  122

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A  Q+IPAV  ++ GAA  SYLF++ +  P   +PFP + L     I  ++++     
Sbjct  123   HVANEQNIPAVKLITFGAAVFSYLFYLVK-KPEAVFPFPAINLSK---IEQEKMY-----  173

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-LVAD  423
                   D E  D  +DG+  I+LI T R +E KYID  + L+  + VPVGP V+  +  +
Sbjct  174   ----AKDFE--DRLVDGNIQIMLISTSRTIEAKYIDHCTELINWKVVPVGPPVQDPITNN  227

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVA GLELS VNF+WV RFP  E  
Sbjct  228   ADDKELMDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGE--  285

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                + + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+SVME++ FGV
Sbjct  286   --DQNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDFGV  343

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMP+Q DQP NAR++
Sbjct  344   PIIAMPIQYDQPSNARLI  361



>ref|XP_010034307.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=415

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 264/387 (68%), Gaps = 46/387 (12%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  QR I+VLM PWLAHGHI PFL LA+ L+ RNF+I++CSTPVNLSSIK ++S+K + 
Sbjct  1     MDNMQRPIKVLMLPWLAHGHISPFLELAKRLSARNFHIHLCSTPVNLSSIKPKISKKYSS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGL--PPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
             SI+LVEL +PSLPDLPPHYHTT GL  PPH  P                           
Sbjct  61    SIELVELHIPSLPDLPPHYHTTKGLASPPHENP---------------------------  93

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
                 PW P +A +  +P+V+F   GA + S+L HV + +   E+PF E++L D+E  +  
Sbjct  94    ---HPWAPEVAKSHGVPSVVFFVSGAGSSSFLLHVTK-NTCNEFPFGEIFLHDYELAKII  149

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
             +  E       D +D  R   C++ SS+ IL+KTFR+LEGKYID LS+   K+ VPVGPL
Sbjct  150   KAAEDSR----DAADY-RTPQCVERSSNFILMKTFRELEGKYIDYLSSYSGKKVVPVGPL  204

Query  443   VR--SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             V   S + DG++  I EWLD + + STVFVSFG+EYFLTE++ EE+A GLELS VNFLWV
Sbjct  205   VEDPSNIEDGDS--IIEWLDKRDKLSTVFVSFGTEYFLTEKDREEIAHGLELSNVNFLWV  262

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP  E+ E    + +ALP G+LERV  RG V++GWA QG ILEH SIGGFVSHCGW S
Sbjct  263   IRFPVGESIE----LEEALPGGFLERVRDRGSVIDGWAAQGKILEHPSIGGFVSHCGWGS  318

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             VME++K GVPIIAMPMQLDQP+NAR+V
Sbjct  319   VMESMKSGVPIIAMPMQLDQPMNARLV  345



>gb|AFK79036.1| glycosyltransferase UGT4 [Bupleurum chinense]
Length=453

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 196/386 (51%), Positives = 262/386 (68%), Gaps = 8/386 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M   + S+RVLM PWLAHGHI PFL L++ L  RN +IY CSTPVNL++IKK+V +  + 
Sbjct  1     MGEQETSLRVLMLPWLAHGHISPFLHLSKKLINRNIFIYFCSTPVNLNTIKKKV-DNFSQ  59

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LPSLPDLPP+ HTTNGLPPHL+PTL  A  +SK    N +  LKPD+V+ D 
Sbjct  60    SIELVELHLPSLPDLPPNQHTTNGLPPHLIPTLHMAYSLSKEKMSNTVKNLKPDVVICDA  119

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPWV  +  +  IP   F +  A   SY  ++  G    EYP+PE+++R++E      +
Sbjct  120   SQPWVEGVVLSLGIPCCFFNTSSAVTVSYFSNLLSG-AGVEYPYPEIFVREYEMAAIHAI  178

Query  617   FEPPEQIDGDVSDTERIDGCLDGSS-SIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                 + +    ++ +    CL   S +++ +KTF ++EGKYI  L  L K + +PVGPLV
Sbjct  179   IAQKDSLSRTRNNDDEGKECLSRESCNVVFVKTFEEIEGKYIKYLGQLSKMKVIPVGPLV  238

Query  440   RSLV-ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               +V  D  + EI EWL+ K  CSTVFVSFGSEYFL+ ++MEE+A GLELS VNF+WV+R
Sbjct  239   EDVVDNDDTDAEILEWLNEKNPCSTVFVSFGSEYFLSNKDMEEIAQGLELSNVNFIWVVR  298

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             F A E      ++ D LP+G+ ERV  RG +VEGWAPQ  IL+HSS+GGFV+HCGW+S++
Sbjct  299   FTAGEK----HSLEDVLPKGFKERVRDRGIIVEGWAPQAKILKHSSVGGFVTHCGWNSIL  354

Query  83    EALKFGVPIIAMPMQLDQPLNARVVA  6
             E++K GV I+A PMQLDQ  NAR+V 
Sbjct  355   ESMKLGVAIVATPMQLDQYFNARLVV  380



>ref|XP_006367682.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=447

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/376 (54%), Positives = 263/376 (70%), Gaps = 20/376 (5%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             VLMFPWLA+GHI PFL +A+ L  R F IY+CSTP+NL S  K++ EK A SI+L+EL L
Sbjct  17    VLMFPWLAYGHISPFLNIAKKLADRGFLIYLCSTPINLKSTIKKIPEKYADSIQLIELHL  76

Query  950   PSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMA  771
             P LP+LPPHYHTTNGLPPHL  TL KAL+MSKP F  +L  LKPDLV+YD LQ W   +A
Sbjct  77    PELPELPPHYHTTNGLPPHLNHTLHKALEMSKPNFSKILQNLKPDLVIYDMLQQWAEHVA  136

Query  770   AAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDG  591
               Q+IPAV  ++ GAA  SYLF++ +  P   +PFP + L     I  +++F        
Sbjct  137   NEQNIPAVKLITFGAAVFSYLFYLVK-KPEAVFPFPAINLSK---IEQEKMF--------  184

Query  590   DVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-LVADGEN  414
                D E  D  +DG+  I+L+ T R +E KYID  + L+  + VPVGP V+  ++ + ++
Sbjct  185   -AKDFE--DRLVDGNIQIMLMSTSRTIEAKYIDHCTELINWKVVPVGPPVQDPIINNADD  241

Query  413   PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKA  234
              E+  WL  K   STVFVSFGSEYFL++E+MEEVA GLELS VNF+WV RFP  E     
Sbjct  242   KELMNWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGE----D  297

Query  233   RAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPII  54
             + + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+SVME++ FGVPII
Sbjct  298   QNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDFGVPII  357

Query  53    AMPMQLDQPLNARVVA  6
             AMP+Q DQP NAR++ 
Sbjct  358   AMPIQYDQPSNARLIV  373



>ref|XP_004250484.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=436

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 267/378 (71%), Gaps = 20/378 (5%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             +++VLMFPWLA+GHI PFL +A+ L  R F IY+CSTP+NL S  +++ EK A SI L+E
Sbjct  3     TLKVLMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIEKIPEKYADSIHLIE  62

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNGLP HL  TL KAL+MSKP F  +L  LKPDLV+YD LQ W  
Sbjct  63    LHLPELPELPPHYHTTNGLPLHLNHTLHKALEMSKPNFAKILQNLKPDLVIYDMLQQWAE  122

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A+ Q+IPAV  ++ GAA  SYLF++ +  P   +PFP + L  +E    ++++     
Sbjct  123   HVASEQNIPAVKLITFGAAVFSYLFYLVK-KPEAVFPFPAINLSKNE---QEKMY-----  173

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-LVAD  423
                  +D E  D  +DG+  I+LI T R +E KYID  + L+  + VPVGP V+  +  +
Sbjct  174   ----ANDFE--DRLVDGNIQIMLISTSRTIEAKYIDHCTELINWKVVPVGPPVQDPITNN  227

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              ++ E+ +WL  K   STVFVSFGSEYFL++E+MEEVA GLELS VNF+WV RFP  E  
Sbjct  228   ADDKELMQWLGTKDVNSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGE--  285

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
                + + DALP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+SVME++ FGV
Sbjct  286   --DQNLEDALPKGFLERIGERGRVLDKFAPQPRILNHLSTGGFISHCGWNSVMESVDFGV  343

Query  62    PIIAMPMQLDQPLNARVV  9
             PIIAMPMQ DQP NAR++
Sbjct  344   PIIAMPMQYDQPSNARLI  361



>emb|CDP13368.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 260/384 (68%), Gaps = 45/384 (12%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+ +Q    +LM PWLAHGH+ P+L LA+ LT RNF IY+CSTP+NLSSI+ ++S K   
Sbjct  1     MEENQTISSILMLPWLAHGHVSPYLELAKKLTARNFNIYLCSTPINLSSIRSKISPKFGK  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+L+EL LP+LP+LPP YHTTNGLPPHLM TLK+A +M+ P F  +L TL PDL++YD 
Sbjct  61    SIQLIELNLPTLPNLPPQYHTTNGLPPHLMVTLKEAFEMASPNFCKILRTLMPDLLIYDL  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPE-LYLRDHEFIRNKR  621
             LQPW P  A+  +IPAV F++  A   S + H  +  P  ++P+   ++ RD++      
Sbjct  121   LQPWAPEAASYYNIPAVEFITCSATMTSCMLHFFQT-PGIQFPYSSTIFFRDYD------  173

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                                              F+++EGKY D +S L  K+ VPVGPLV
Sbjct  174   ---------------------------------FKEIEGKYNDYVSCLSGKKVVPVGPLV  200

Query  440   RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
             +  V D E+  I EWL+ K + STVFVSFGSEYFL++E++E VA GLELS +NF+WV+RF
Sbjct  201   QDPVHDNEDSTIMEWLNTKGKYSTVFVSFGSEYFLSKEDLEGVAHGLELSSLNFVWVVRF  260

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E       + +ALP+G+L+RVG+RGK+V GWAPQ  IL HSSIGGFVSHCGW+SV+E
Sbjct  261   PKGE----NIIVEEALPKGFLKRVGERGKIVNGWAPQAKILNHSSIGGFVSHCGWNSVLE  316

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
              ++FGVPIIA+PM LDQP+NAR++
Sbjct  317   GMRFGVPIIAVPMHLDQPVNARLL  340



>ref|XP_006367681.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=441

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/381 (53%), Positives = 262/381 (69%), Gaps = 19/381 (5%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++RVLMFPWLA+GHI PFL +A+ L  R F IY+CST +NL SI K++ EK + SI+ VE
Sbjct  3     TLRVLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTLINLESIIKKIPEKYSESIRFVE  62

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNGLPPHL  TL KAL MSKP F  +L  LKPDLV+YD LQPW  
Sbjct  63    LHLPELPELPPHYHTTNGLPPHLNHTLHKALKMSKPNFSKILQNLKPDLVIYDILQPWAE  122

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLF--EPP  606
              +   Q+IPAV  L+ GAA  SY F+  + +P  E+PFP +YL   E ++ + +F  EP 
Sbjct  123   HVVNEQNIPAVKILTSGAALFSYFFNFLK-NPGVEFPFPAIYLPKVEQVKMREMFEKEPN  181

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-LV  429
             E+           D   +G+  I+L+ T R +E KY+D  + L   + VPVGP  +  + 
Sbjct  182   EE-----------DRLAEGNMQIMLMCTSRTIEAKYLDYCTELSNWKVVPVGPPFQDPIT  230

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              D ++ E+ +WL  K   STVFV FGSEYFL+ E+MEEVA GLELS VNF+WV RFP  E
Sbjct  231   NDVDDMELIDWLGTKDENSTVFVCFGSEYFLSREDMEEVAFGLELSNVNFIWVARFPKGE  290

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
                  + + D LP+G+LER+G+RG+V++ +APQ  IL H S GGF+SHCGW+SVME+L F
Sbjct  291   ----EQNLEDVLPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESLDF  346

Query  68    GVPIIAMPMQLDQPLNARVVA  6
             GVPIIAMPM  DQP+NA+++ 
Sbjct  347   GVPIIAMPMHNDQPINAKLIV  367



>ref|XP_006436664.1| hypothetical protein CICLE_v10033373mg [Citrus clementina]
 gb|ESR49904.1| hypothetical protein CICLE_v10033373mg [Citrus clementina]
Length=443

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 207/397 (52%), Positives = 275/397 (69%), Gaps = 37/397 (9%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSIKKRVSEKDA  981
             M  +QR+  VLMFPWLAHGH  PFL LA+ L KR NF+I  CSTP  L+SIK+  S+K +
Sbjct  1     MSNTQRNYSVLMFPWLAHGHAFPFLELAKKLAKRSNFHICFCSTPSILNSIKQ--SDKFS  58

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             +SI+L+EL LPS P+LPP YHTT GLPPHLMPTLKKA DM+   F N+L  L PD+++YD
Sbjct  59    LSIQLIELHLPSSPELPPQYHTTKGLPPHLMPTLKKAFDMASSSFFNILKNLSPDILIYD  118

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-------EEYPFPELYLRDH  642
              +QPW PA+A++ +IPAV FL   AA  +++ H  + + +       EE+ F  +++  +
Sbjct  119   LIQPWAPALASSLNIPAVYFLVSSAATSAFMVHAIKKNSSGDAYNDDEEFSFSSIFMH-Y  177

Query  641   EFIRN--KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
              ++++    + E P         T+R+  C + S +I+LIK+FR+LEGKYID LS+L+KK
Sbjct  178   YYMKSYFSNMVESP--------STKRLLQCFERSCNIVLIKSFRELEGKYIDYLSDLIKK  229

Query  467   RCVPVGPLVRSLVADGEN----PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgl  300
             + VPVGPLV+  +   ++     EI +WLD K R STVFVSFGSEYFL++EEME++ALGL
Sbjct  230   KVVPVGPLVQDPIEQSDHEKGVTEIIQWLDKKERSSTVFVSFGSEYFLSKEEMEDIALGL  289

Query  299   eLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIG  120
             ELS V+            G K + + + LPE +LER  +R  V+EGWAPQ  IL H SIG
Sbjct  290   ELSGVSL-----------GVKVK-VDEELPESFLERTKERAMVIEGWAPQMKILGHPSIG  337

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GFVSH GWSSVME++K GVPIIAMPM +DQPLNAR+V
Sbjct  338   GFVSHSGWSSVMESMKLGVPIIAMPMHVDQPLNARLV  374



>ref|XP_011075272.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 275/386 (71%), Gaps = 10/386 (3%)
 Frame = -3

Query  1157  MDTSQ-RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MD ++ +SI+VLMFPWLA+GHI P+L LA+ LT R F I +CSTP  L  + K+++ K +
Sbjct  1     MDANKNQSIQVLMFPWLAYGHITPYLELAKKLTSRGFNISLCSTPATLCCVDKKITNKLS  60

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              SIKLV L LP LP LPP  HTTNGLPPH+MP+LK+A D+S   F N+L  LKP +++YD
Sbjct  61    QSIKLVPLFLPPLPGLPPELHTTNGLPPHVMPSLKEAFDLSINDFSNILKQLKPHMLIYD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW P +A  Q IPAV F++  +   S++FH  R  P  E+PFP +Y RD+E+   K+
Sbjct  121   FLQPWAPVVAKEQKIPAVEFVTSSSTMSSFMFHYFR-KPWIEFPFPNIYFRDYEYSNMKK  179

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L     +   D  + ++    ++ S  I+LIK FR +EGKYID +++LV K+ VPVGPLV
Sbjct  180   LL----RCASDPRERDKASEGVERSCKIVLIKGFRDIEGKYIDYVTSLVGKKFVPVGPLV  235

Query  440   RSLVADGENPE---IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +    D ++ E      WLDMK R STVFVSFGSEYFLT+E+++E+A GLELSK+NF+WV
Sbjct  236   QEPSPDEKDDESLCTFSWLDMKERKSTVFVSFGSEYFLTKEDIDEIAYGLELSKINFIWV  295

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP    G     +G  LP G LERVG RGK++EGWAPQ  IL H SIGGFVSHCGW+S
Sbjct  296   LRFPKGANGHNG-LLGKTLPRGVLERVGDRGKILEGWAPQTKILGHESIGGFVSHCGWNS  354

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             V+E++ FGVPIIA+PM LDQP+NAR+
Sbjct  355   VIESMNFGVPIIAVPMHLDQPINARL  380



>gb|AGR44632.1| UDP-glucosyltransferase 94B1 [Panax ginseng]
Length=442

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 202/387 (52%), Positives = 255/387 (66%), Gaps = 22/387 (6%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD     I + + P+LAHGHI PF  LA+ L KRN  +++CSTP+NLSSIK + S   + 
Sbjct  1     MDNQNGRISIALLPFLAHGHISPFFELAKQLAKRNCNVFLCSTPINLSSIKDKDS---SA  57

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIKLVEL LPS PDLPPHYHTTNGLP HLM  L+ A + + P F  +L TL PDL++YDF
Sbjct  58    SIKLVELHLPSSPDLPPHYHTTNGLPSHLMLPLRNAFETAGPTFSEILKTLNPDLLIYDF  117

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
                W P +A++ +IPAV FL+  AA+ S   H  + +P E+YPFP+ Y        N  +
Sbjct  118   NPSWAPEIASSHNIPAVYFLTTAAASSSIGLHAFK-NPGEKYPFPDFY-------DNSNI  169

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                P   D ++        C + S  IILIK+FR+LEGKYID LS L  K  VPVGPLV+
Sbjct  170   TPEPPSAD-NMKLLHDFIACFERSCDIILIKSFRELEGKYIDLLSTLSDKTLVPVGPLVQ  228

Query  437   SLVADGENP---EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
               +   E+P   +I  WLD +   + VFV FGSEYFL+ EE+EEVA+GLE+S VNF+W +
Sbjct  229   DPMGHNEDPKTEQIINWLDKRAESTVVFVCFGSEYFLSNEELEEVAIGLEISTVNFIWAV  288

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             R      GEK       LPEG+++RVG RG VVEGWAPQ  IL HSS GGFVSHCGWSS+
Sbjct  289   RLI---EGEKK----GILPEGFVQRVGDRGLVVEGWAPQARILGHSSTGGFVSHCGWSSI  341

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVA  6
              E++KFGVP+IAM   LDQPLN ++ A
Sbjct  342   AESMKFGVPVIAMARHLDQPLNGKLAA  368



>emb|CDO99873.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 258/384 (67%), Gaps = 34/384 (9%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
             TSQ  ++VLMFPWLA+GHI P L LA+ LT R F IYICSTP+NL  IK++++ K + +I
Sbjct  9     TSQ--LKVLMFPWLAYGHISPSLELAKRLTDRGFSIYICSTPINLGFIKQKIAGKYSATI  66

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             KLVEL LP  P+LP HYHTTNGLPPHLM TLK+AL+ +KP   ++L TLKPDLV+YD  Q
Sbjct  67    KLVELHLPDTPELPSHYHTTNGLPPHLMSTLKRALNRAKPELSSILKTLKPDLVIYDVTQ  126

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
              W  A+ AA +IPAV FL+   +  +Y  H     P  E+PFP +YL       +     
Sbjct  127   TWTGALTAAHNIPAVKFLTSTVSMMAYFSH-SFMKPGLEFPFPAIYL-------DPAAER  178

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL  432
             P  + D                  IIL K+ R +EGKYID L +L K + +PVG L+   
Sbjct  179   PNRECD-----------------RIILTKSSRAIEGKYIDYLFDLTKLKMLPVGTLLEEP  221

Query  431   VADGE---NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
             + D +   N E+ +WL  K   STVFVSFG+EYFLT EEMEE+A GLELS VNF+WV+RF
Sbjct  222   IKDDQGDNNDELIQWLGTKSERSTVFVSFGTEYFLTREEMEEIAYGLELSDVNFIWVVRF  281

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P    G K R   +ALPEG+LERVG RG++ EGWAPQ  +L H    GFV HCGW+SV+E
Sbjct  282   P---LGHKTRP-EEALPEGFLERVGDRGRIAEGWAPQAKVLAHPGTAGFVCHCGWNSVVE  337

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             +++FGVPIIAMP+QLDQPLNAR+V
Sbjct  338   SIEFGVPIIAMPVQLDQPLNARLV  361



>ref|XP_004238697.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=446

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 262/381 (69%), Gaps = 13/381 (3%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             +++VLMFP+LA+GHI P+L +A+ L  R F IY+CSTP+NL S   ++ EK A SI+L+E
Sbjct  4     TLKVLMFPFLAYGHISPYLNVAKKLADRGFLIYLCSTPINLKSTINKIPEKYADSIQLIE  63

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP LP+LPPHYHTTNGLPP+L   L++AL MSKP F  ++  LKPDL++YD LQ W  
Sbjct  64    LHLPELPELPPHYHTTNGLPPNLNHILRRALKMSKPNFSKIMQNLKPDLLIYDILQQWAE  123

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A   +IPAV  L+ G A  SY F++ +  P  E+P+P +YLR  E +R         +
Sbjct  124   DVATELNIPAVKLLTSGVAVFSYFFNLTK-KPEVEFPYPAIYLRKIELVRWCETLSKHNK  182

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV---  429
              +G+  D    DG   G+  I+L+ T + LE KYID    L   + VPVG LV+  +   
Sbjct  183   -EGEEHD----DGLAYGNMQIMLMSTSKILEAKYIDYCIELTNWKVVPVGSLVQDSITND  237

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
             A  ++ E+ +WL  K   STVFVSFGSEYFL++E++EEVA GLELS VNF+WV+RFP  E
Sbjct  238   AADDDMELIDWLGTKDENSTVFVSFGSEYFLSKEDVEEVAFGLELSNVNFIWVVRFPKGE  297

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
                  + + D LP+G+ ER+G+RG+V++ +APQ  IL H S GGF+SHCGW+S ME++ F
Sbjct  298   ----EKNLEDVLPKGFFERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESIDF  353

Query  68    GVPIIAMPMQLDQPLNARVVA  6
             GVPI+AMPMQLDQP+NAR++ 
Sbjct  354   GVPIVAMPMQLDQPMNARLIV  374



>dbj|BAG80553.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=454

 Score =   363 bits (931),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 195/385 (51%), Positives = 267/385 (69%), Gaps = 9/385 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T   +++VLMFPWLAHGHI P+L +++ L  R +Y+Y+CSTPVNL+ IKKR+ +  ++
Sbjct  1     MGTEGSTLKVLMFPWLAHGHISPYLTVSKKLADRGWYVYLCSTPVNLNFIKKRILQNYSL  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVEL LP LP+LPP YHTTNGLPPHL  TLK+A  MSKP F  +L+ LKPDL+++D 
Sbjct  61    SIQLVELHLPELPELPPSYHTTNGLPPHLNATLKRAAKMSKPEFSRILENLKPDLLIHDV  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             +QPW   +A + +IPA+  ++ GAA  SY  H  +  P  ++ +P +YLR    I  +RL
Sbjct  121   VQPWAKGVANSHNIPAIPLITFGAAVISYFIHQMK-KPGIDFRYPAIYLRK---IEQQRL  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  + +  D    +  D   +  + IIL+ +    E KYID L+ L + + V VGP V+
Sbjct  177   QEMMKNVAKDKDPDDDEDPFAEDPTRIILLMSSSATEAKYIDYLTELTQSKYVSVGPPVQ  236

Query  437   S-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
               +  D  + ++ +WL  K   STV+VSFGSEYFLT+E+MEE+A GLELS +NF+WV+RF
Sbjct  237   EPMNEDDGDMDLIDWLGKKDEHSTVYVSFGSEYFLTKEDMEEIAYGLELSNINFIWVVRF  296

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P    GE+ + + +ALP+G+LER+  RG+VV GWAPQ  IL H S GGFVSHCGW+SVME
Sbjct  297   P---KGEEVK-LEEALPQGFLERIENRGRVVSGWAPQPRILSHPSTGGFVSHCGWNSVME  352

Query  80    ALKFGVPIIAMPMQLDQPLNARVVA  6
             ++ FGVPII MPM LDQP NAR++ 
Sbjct  353   SIDFGVPIIPMPMHLDQPFNARLMV  377



>dbj|BAH80312.1| UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase [Catharanthus 
roseus]
Length=454

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 263/393 (67%), Gaps = 18/393 (5%)
 Frame = -3

Query  1157  MDTSQR----SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             M T Q+    S ++LMFPWLA GHI  FL LA+ L+ R FY YICSTP+NL SIK ++++
Sbjct  1     MATEQQQASISCKILMFPWLAFGHISSFLQLAKKLSDRGFYFYICSTPINLDSIKNKINQ  60

Query  989   KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
               + SI+LV+L LP+ P LPP  HTTNGLPPHLM TLK AL  + P    ++ ++KPDL+
Sbjct  61    NYSSSIQLVDLHLPNSPQLPPSLHTTNGLPPHLMSTLKNALIDANPDLCKIIASIKPDLI  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YD  QPW  A+A+  +IPAV F +  A + +Y+ H+   +P  E+PF  ++L D E   
Sbjct  121   IYDLHQPWTEALASRHNIPAVSFSTMNAVSFAYVMHMFM-NPGIEFPFKAIHLSDFE---  176

Query  629   NKRLFEPPEQIDGDVSDTE-RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
               R  E  E    D S  +  + G     +S  ++++ R++EGKY+D LS ++K + +PV
Sbjct  177   QARFLEQLESAKNDASAKDPELQGSKGFFNSTFIVRSSREIEGKYVDYLSEILKSKVIPV  236

Query  452   GPLVRSLVAD-----GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSK  288
              P++     D      +  EI +WLD K   S+VFVSFGSEYFL  +E+EE+A+GLELS 
Sbjct  237   CPVISLNNNDQGQGNKDEDEIIQWLDKKSHRSSVFVSFGSEYFLNMQEIEEIAIGLELSN  296

Query  287   VNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVS  108
             VNF+WV+RFP  E  +    I + LPEG+L+RV  +G++V GWAPQ  IL H SIGGFVS
Sbjct  297   VNFIWVLRFPKGEDTK----IEEVLPEGFLDRVKTKGRIVHGWAPQARILGHPSIGGFVS  352

Query  107   HCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             HCGW+SVME+++ GVPIIAMPM LDQP NAR+V
Sbjct  353   HCGWNSVMESIQIGVPIIAMPMNLDQPFNARLV  385



>gb|AFJ53042.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=482

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 266/391 (68%), Gaps = 16/391 (4%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             +   VL+ P L  GHI P+L L++ L+  NF +Y+CSTP NL+ +K ++  + + +I LV
Sbjct  13    KRTTVLLLPSLGPGHISPYLELSKRLSSHNFNVYLCSTPANLNPLKPKLLAESS-TITLV  71

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALD--MSKPGFLNLLDTLKPDLVVYDFLQP  789
             EL LPS P LPPHYHTTNGLPPHLMP LK A D   ++  F ++L ++ PDL++YDFLQP
Sbjct  72    ELHLPSTPQLPPHYHTTNGLPPHLMPHLKLAFDSAATRSAFSSILMSVSPDLLIYDFLQP  131

Query  788   WVPAMAAAQ-SIPAVLFLSPGAAACSYL---FHVGRGHPAEEYPFP---ELYLRDHEFIR  630
             W P +A++   IPAVLFLS GAA  ++    +  GR +   E  FP    +YLRD    R
Sbjct  132   WAPQLASSLLHIPAVLFLSTGAAMFAFAAHAYKFGRDNINNEASFPFASSIYLRDDREER  191

Query  629   N--KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
                 R+ EP      +++D   +  C + S SIILIKTFR++EGKY+D +S L  KR VP
Sbjct  192   AFVSRMLEP--TCGNEINDHNWVQLCQERSCSIILIKTFREIEGKYLDYISELAGKRHVP  249

Query  455   VGPLVRSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             VGPL++   +  E+    I +WLD K   STVFVSFGSE+FL+ + + E+A GLELS  N
Sbjct  250   VGPLLQKTTSSEEDGGRRISKWLDAKQTSSTVFVSFGSEFFLSPDLIHEIAHGLELSGAN  309

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP  +      A  +ALP G+L+RVG++G VVEGWAPQ  IL H S+GGFVSHC
Sbjct  310   FVWVLRFPLEDQKSPNSAAAEALPPGFLDRVGEKGLVVEGWAPQSAILAHDSVGGFVSHC  369

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GWSSVME++ +GVPI+AMPM LDQPLNAR+V
Sbjct  370   GWSSVMESMWYGVPIVAMPMHLDQPLNARLV  400



>ref|XP_011076906.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=454

 Score =   358 bits (920),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 195/386 (51%), Positives = 262/386 (68%), Gaps = 18/386 (5%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T     +V+M PWLA+GHI PFL LA+ L+ RN   Y+CSTP NLSSIK ++  K + 
Sbjct  1     MGTENSCWKVMMLPWLAYGHISPFLELAKRLSNRNIQTYLCSTPANLSSIKNKIPGKYSS  60

Query  977   SIKLVELQLPS-LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             SI L+EL LP  LP LPPH HTTNGLPP+L+  L+KALD SK  F  ++ +L+PDL+++D
Sbjct  61    SIHLLELHLPDFLPQLPPHNHTTNGLPPNLISILRKALDSSKLDFSTIMKSLQPDLLIHD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLR--DHEFIR-  630
              L  W   +A + +IP+V FL+ GAA  S+ +H        EYPFP +     +H+ I  
Sbjct  121   TLIEWAAGVAFSNNIPSVSFLTSGAAMFSFYYHSLMKPDVVEYPFPAIKFTGPEHDMING  180

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
             N   F    Q + D+ + E        ++ ++LIK+ +++EGKYID LS L +++ VPVG
Sbjct  181   NIESFRKRSQ-ERDLDNQE--------ATELLLIKSSKEIEGKYIDYLSQLTERKIVPVG  231

Query  449   PLVRSLVA-DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
             PLV +    D EN ++ EWL  K   STVFVSFGSEYFL  EE+EE+A  LELS VNF+W
Sbjct  232   PLVSADRGPDDENSDLMEWLGKKSEFSTVFVSFGSEYFLKTEEIEEIAYALELSDVNFVW  291

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             V+RFP    G++ + + DALP G+LER  ++GK++E WAPQ  IL H S+GGFVSHCGW+
Sbjct  292   VVRFP----GDEEKRVQDALPGGFLERTQEKGKIMEKWAPQAKILGHPSVGGFVSHCGWN  347

Query  92    SVMEALKFGVPIIAMPMQLDQPLNAR  15
             SV+E++ FGVPIIAMPMQ DQP+NA+
Sbjct  348   SVIESIHFGVPIIAMPMQFDQPINAK  373



>gb|AED99884.1| glycosyltransferase [Panax notoginseng]
Length=454

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/386 (51%), Positives = 262/386 (68%), Gaps = 14/386 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT+  S RV+MFPWLA+GH+ PFL LA+ L+ +NF +Y CSTP+ L  IK ++S  +  
Sbjct  1     MDTNSNSFRVVMFPWLAYGHVSPFLELAKKLSTKNFSVYFCSTPITLKPIKNKIS--NYK  58

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI+LVE  L S P+ PPH HT+NGLPPHLMPTLKK  + +   F  ++ TL P LV+YD+
Sbjct  59    SIELVEYPLESTPEFPPHLHTSNGLPPHLMPTLKKYFENASHNFSQIIKTLSPHLVIYDY  118

Query  797   LQP-WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             L P WVP  A++  IPAV F   G A  +Y   + R  P   +    + L+  E ++   
Sbjct  119   LMPSWVPKFASSHQIPAVHFHIFGVANLAYFTCLVRDIPGFSFQSKTVCLKPSEIMK---  175

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L + P   D   ++   +  C+ GS+ + LIK+ R++EGKY+D  ++L KK+ VPVGPL 
Sbjct  176   LVQAPR--DNVEAEENELSDCIIGSTEMFLIKSNREIEGKYLDFAADLFKKKIVPVGPLF  233

Query  440   RSL-VADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             + + V + EN  EI  WL+ K   STV+VSFG+E +L+++ MEE+A GLELSKVNF+WVI
Sbjct  234   QEISVNNQENDEEIFRWLNKKEEFSTVYVSFGTESYLSKKGMEELANGLELSKVNFIWVI  293

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             +FP    GEK  A  +ALPEG+LERVG++G +VE W PQ  IL H SIGGFVSHCGWSSV
Sbjct  294   KFPE---GEKINA-AEALPEGFLERVGEKGMIVERWVPQAKILGHKSIGGFVSHCGWSSV  349

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             ME+   GVPIIA+PM  DQP+NAR+V
Sbjct  350   MESASVGVPIIALPMHHDQPVNARLV  375



>ref|XP_008456584.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis melo]
Length=507

 Score =   358 bits (918),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 191/395 (48%), Positives = 269/395 (68%), Gaps = 12/395 (3%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             L  +     + +++LM PWLAHGH+ PFL L++ L  +NF+I+ CST + L SI+ ++ +
Sbjct  3     LDGHQRNETKVMKILMLPWLAHGHVSPFLELSKLLATKNFHIFFCSTSIILHSIQSKLPQ  62

Query  989   K--DAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
                 + +I+LVEL LP+  DLP   HTT GLPPHLM +LK+A D +   F +++  L+PD
Sbjct  63    NLLSSSNIELVELTLPTSADLPRCRHTTAGLPPHLMFSLKRAFDSAASAFDSIVRNLRPD  122

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYP--FPELYLRDH  642
             LV+YDFLQPW PA+A +  IPAV+F   GA   + + ++ +  P  ++P  FPE+ L   
Sbjct  123   LVIYDFLQPWAPAVALSADIPAVMFQCTGALMAALVTNMLK-FPNSDFPSMFPEIRLSVF  181

Query  641   EFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRC  462
             E  + K LF        D  D +RI  C + S  I+L+K+FR++E KYID LS  ++ + 
Sbjct  182   EIKQLKNLFRSSV---NDAKDKQRIQECYERSCGILLLKSFREIEAKYIDFLSTSLQIKV  238

Query  461   VPVGPLVRSLVADGE--NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSK  288
             +PVGPLV     D E     I++WL+ K + S + VSFGSE++L++ +MEE+A GLELS 
Sbjct  239   IPVGPLVEEQDEDIEVLAESIEKWLNKKEKKSCILVSFGSEFYLSKGDMEEIAHGLELSH  298

Query  287   VNFLWVIRFPAAEAGEKAR--AIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGF  114
             +NF+WV+RFPA+  GE+ +   + + LP+G+LERVG+RG VVE W PQ  IL+H S GGF
Sbjct  299   LNFIWVVRFPASGEGERKKRNNVEEELPKGFLERVGERGMVVEEWVPQAQILKHRSTGGF  358

Query  113   VSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             +SHCGWSSV+E+LKFGVPIIA PMQLDQPLNAR+V
Sbjct  359   LSHCGWSSVLESLKFGVPIIAAPMQLDQPLNARLV  393



>ref|XP_011084223.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=444

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 188/385 (49%), Positives = 257/385 (67%), Gaps = 11/385 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M + +  ++VLMFPWLAHGHI PFL LA+ L+ RNF+ YICSTP NL+SI  ++ +K + 
Sbjct  1     MGSDKECLKVLMFPWLAHGHITPFLELAKRLSDRNFHCYICSTPANLTSIANKIPQKYSN  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI L+ L LPS P LPPHYHTTNGLP HL   L+ AL  +KP F N+L TL+P L+++D 
Sbjct  61    SIHLLHLHLPSSPHLPPHYHTTNGLPLHLHSALRSALRAAKPDFSNILTTLQPHLLIHDI  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L  W  A+A+ + IP+V F + GAA  SY  H+G+     E+P+P + L + E       
Sbjct  121   LLRWAGAIASKKDIPSVTFFTSGAAMFSYFCHLGQ-RRGVEFPYPAIRLTEFELSMAIGA  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  +  + D  +    +     S   I++ + R+++GKY+D LS ++ +  VPVG LVR
Sbjct  180   LESSKNEEKDPDEEAGWN-----SGRTIIVNSSREIDGKYMDYLSEMLNREFVPVGSLVR  234

Query  437   SLVADGENPEI-KEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
                 D  +  +  +WL  K + S VFVSFG+EYFL  EE+EEVA GLELS VNF+W++RF
Sbjct  235   DYDDDDADEAVLMDWLSQKDKFSCVFVSFGTEYFLKREEIEEVAYGLELSNVNFIWILRF  294

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  +       + + LP G+LERVG RG++VE WA Q  IL HSS+GGFVSHCGW+S+ E
Sbjct  295   PKGD----GTTVAETLPAGFLERVGGRGRIVEKWASQAKILNHSSVGGFVSHCGWNSLTE  350

Query  80    ALKFGVPIIAMPMQLDQPLNARVVA  6
             +++FGVPIIAMPM LDQP+NA++VA
Sbjct  351   SIEFGVPIIAMPMHLDQPMNAKLVA  375



>emb|CDP06965.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 190/389 (49%), Positives = 261/389 (67%), Gaps = 12/389 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN--FYIYICSTPVNLSSIKKRVSEKD  984
             MD+ +  IR+LM PWLAHGH+ PFL LA+ LT RN  F +YICSTPVNLS  ++ ++ K 
Sbjct  1     MDSKEDVIRILMLPWLAHGHVSPFLELARKLTSRNPNFQVYICSTPVNLSPFRENLAVKF  60

Query  983   AIS--IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
              +S  I+ +++ LPS  +LPP YH+T  LPPHLMP LK A D +K  FL++L  LKP L+
Sbjct  61    ELSSSIQFIDILLPSTSELPPEYHSTKNLPPHLMPALKTAFDGAKDCFLDILKDLKPHLL  120

Query  809   VYDFLQPWVPAMAAAQS-IPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             +YDFLQPW PA A  ++ IP+V F+S  A+  ++LFH    +P  +YP PEL   +   I
Sbjct  121   IYDFLQPWAPAAAQEENNIPSVHFMSCSASIGAFLFHCTE-YPDLDYPIPELNFPE---I  176

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
               + L +    +   +++ ER   C++ S+   L+KT  ++E K++D  S + KK  +PV
Sbjct  177   TRQELVQFMYNVSNGLTNKERYSQCIEKSTDFFLVKTLSEIEQKHMDYFSEMTKKEVIPV  236

Query  452   GPLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
             GPLV+       +    EWL  +   S VFVSFG+EYFL++EE+E +A GLELS V+F+W
Sbjct  237   GPLVQEPENRSSDMVFLEWLSKRGPSSVVFVSFGTEYFLSKEEIEVIASGLELSMVSFIW  296

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             V+RF      E   ++ + LPEG+ +RV +RG VVEGWAPQ  IL H SIGGF SHCGWS
Sbjct  297   VVRF---HGRENVTSLLEVLPEGFQKRVAERGMVVEGWAPQVKILSHPSIGGFASHCGWS  353

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             S +E++ FGVPIIA+PMQLDQPL +R+VA
Sbjct  354   STLESIAFGVPIIAIPMQLDQPLTSRLVA  382



>ref|XP_011084222.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
isoform X1 [Sesamum indicum]
Length=444

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 188/385 (49%), Positives = 257/385 (67%), Gaps = 11/385 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M + +  ++VLMFPWLAHGHI PFL LA+ L+ RNF+ YICSTP NL+SI  ++ +K + 
Sbjct  1     MGSDKECLKVLMFPWLAHGHITPFLELAKRLSDRNFHCYICSTPANLTSIANKIPQKYSN  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI L+ L LPS P LPPHYHTTNGLP HL   L+ AL  +KP F N+L TL+P L+++D 
Sbjct  61    SIHLLHLHLPSSPHLPPHYHTTNGLPLHLHSALRSALRAAKPDFSNILTTLQPHLLIHDI  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L  W  A+A+ + IP+V F + GAA  SY  H+G+     E+P+P + L + E       
Sbjct  121   LLRWAGAIASKKDIPSVTFFTSGAAMFSYFCHLGQ-RRGVEFPYPAIRLTEFELSMAIGA  179

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E  +  + D  +    +     S   I++ + R+++GKY+D LS ++ +  VPVG LVR
Sbjct  180   LESSKNEEKDPDEEAGWN-----SGRTIIVNSSREIDGKYMDYLSEMLNREFVPVGSLVR  234

Query  437   SLVADGENPEI-KEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
                 D  +  +  +WL  K + S VFVSFG+EYFL  EE+EEVA GLELS VNF+W++RF
Sbjct  235   DYDDDDADEAVLMDWLSQKDKFSCVFVSFGTEYFLKREEIEEVAYGLELSNVNFIWILRF  294

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  +       + + LP G+LERVG RG++VE WA Q  IL HSS+GGFVSHCGW+S+ E
Sbjct  295   PKGD----GTTVAETLPAGFLERVGGRGRIVEKWASQAKILNHSSVGGFVSHCGWNSLTE  350

Query  80    ALKFGVPIIAMPMQLDQPLNARVVA  6
             +++FGVPIIAMPM LDQP+NA++VA
Sbjct  351   SIEFGVPIIAMPMHLDQPMNAKLVA  375



>gb|EYU18697.1| hypothetical protein MIMGU_mgv1a006194mg [Erythranthe guttata]
Length=453

 Score =   355 bits (912),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 269/396 (68%), Gaps = 23/396 (6%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN--FYIYICSTPVNLSSIKKRV  996
             + +  +  +R+IRVLMFPWLA+GHI P+L LA+ L  +N  F +Y+CSTP  L+ I K+V
Sbjct  1     MESNKNERRRTIRVLMFPWLAYGHITPYLELAKKLVTKNDSFAVYMCSTPATLTCIDKKV  60

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
              +  + SIKLV   LP+   LP ++HTTNGLP HL+PTL++ LD S   F  +L+ L PD
Sbjct  61    PQNLSNSIKLVPFHLPNTQGLPSNFHTTNGLPSHLIPTLREMLDSSANEFSRVLEKLTPD  120

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPE-LYLRDHE  639
             LV+YD  QPW  ++A  + I AV FL+ GAA+  +L+H    HP  E+PF + +Y RD  
Sbjct  121   LVIYDCFQPWAASVAKDRKIAAVEFLTSGAASTGHLYH-QLLHPGIEFPFSKSIYHRD--  177

Query  638   FIRNKRLFEPPEQIDGDVSDTERIDGCLDG---SSSIILIKTFRQLEGKYIDQLSNLVKK  468
                    ++    +   ++  ER    L+G   S  I+LIK  R++EGKYID  S+L+ K
Sbjct  178   -------YDDMTFVLETIASVERTKNVLEGARVSDKIVLIKGCREIEGKYIDYASSLMGK  230

Query  467   RCVPVGPLV----RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgl  300
             + VPVGPLV     S   DG++  I  WLD K + STVFVSFGSE F+T+E++ EVA GL
Sbjct  231   KFVPVGPLVILESSSNPNDGKDNGIMSWLDKKEKKSTVFVSFGSECFITKEDIYEVAYGL  290

Query  299   eLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIG  120
             ELSK NF+WV+R P    G+ + +I + LP G+L+RV  RG+V+EGWAPQ MIL H+++G
Sbjct  291   ELSKTNFIWVVRLP---KGDASSSIEEILPIGFLDRVKGRGRVLEGWAPQTMILGHANVG  347

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
             GFVSHCGW+S+ME++ FGVPIIAMPM +DQP+NAR+
Sbjct  348   GFVSHCGWNSLMESMYFGVPIIAMPMHVDQPVNARL  383



>ref|XP_006351221.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=473

 Score =   354 bits (908),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 258/386 (67%), Gaps = 14/386 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T     +V +FPWLA+GHI PFL LA+ L  R F + +CS+ +NLS I+ R+ E    
Sbjct  1     MCTKSTKWKVFLFPWLAYGHISPFLELAKKLVDRGFLVDLCSSSINLSFIRTRIPETYCS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SI LVELQLP L +LPPHYHT NGLP HL  TL+KAL MSKP  LN+L+  KPDL+++D 
Sbjct  61    SIHLVELQLPDLQELPPHYHTANGLPLHLHSTLQKALKMSKPNLLNILEARKPDLLIHDV  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR-NKR  621
              Q W   +A+   IPAV F +  AA CSY  H+    P  E+PF  L L  +E  + +K 
Sbjct  121   KQLWTAGVASTLDIPAVRFFTSCAAMCSYFSHLFV-KPNVEFPFQALRLHPYELTKAHKV  179

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             + E  E  D +V   E   G       ++LI T R++EGKYID +S ++K + +P+G LV
Sbjct  180   VKEHREDDDPEVRAPEEFTG-------VMLIGTSREMEGKYIDYMSEIIKFKVLPIGTLV  232

Query  440   RS-LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             +  + +   N EI EWL  K + ST+ VSFGS YFLT +E+EEVA GLELS+VNF+WV+R
Sbjct  233   QDPMTSVDGNMEIMEWLGKKDKFSTILVSFGSGYFLTNQELEEVAFGLELSQVNFIWVVR  292

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP  E      ++ +ALP+G+ ER+G RG V+ GWAPQ  IL HSSIGGFVSHCGW+S+ 
Sbjct  293   FPKGE----NLSLEEALPQGFFERIGHRGMVMGGWAPQAKILTHSSIGGFVSHCGWNSIS  348

Query  83    EALKFGVPIIAMPMQLDQPLNARVVA  6
             E++ +G+PIIAMPM LDQP+NA+++ 
Sbjct  349   ESIDYGIPIIAMPMDLDQPMNAKLLV  374



>ref|XP_011032816.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Populus 
euphratica]
Length=440

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 263/385 (68%), Gaps = 23/385 (6%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MDTS +S IRVLMFPWLA+ HI  FL LA+ L+K NFYIY+CSTP NL+ IK++      
Sbjct  1     MDTSSKSNIRVLMFPWLAYSHIHAFLELAKKLSKSNFYIYLCSTPANLAHIKEKEP----  56

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              S++ VEL LPSLP+LPPH HTT GLP HL+  L KALDMS+  F  +L  LKPDL++ D
Sbjct  57    -SVEFVELHLPSLPELPPHNHTTKGLPRHLLSNLMKALDMSRCSFSGILTALKPDLLISD  115

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW PA A +  IP VLF+   A    +L  + +   +   P    Y  ++++  +  
Sbjct  116   FLQPWAPAKALSLKIPTVLFMVSAAMPYCFLLDLVKISGSTALPLRSNYPHEYDYEND--  173

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                       +++  +R+  CL+GSS+++LI++ R+LEGKY+D+LS L  K+ V VGPLV
Sbjct  174   ----------NLTLQDRLLQCLEGSSNLMLIRSLRELEGKYVDELSVLAMKKIVLVGPLV  223

Query  440   RSLV-ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             + L   + E  EI EWL+ K  CS +FVSFGSE +L++E+ EE+A GL LS V+F+WV+ 
Sbjct  224   QELSEEEDEKTEIIEWLNKKDPCSVLFVSFGSECYLSKEDREELAHGLLLSNVSFIWVLS  283

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP    GEK  A  +ALPEG +E V ++G ++E WAPQ  IL+H SIGGF+SHCGW S++
Sbjct  284   FP---QGEKISA-EEALPEGLVEMVAEKGFLIEDWAPQKRILDHPSIGGFLSHCGWGSII  339

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++K GVPIIAMPM +DQP NA+++
Sbjct  340   ESMKTGVPIIAMPMHVDQPCNAKLL  364



>gb|EYU39888.1| hypothetical protein MIMGU_mgv1a022198mg [Erythranthe guttata]
Length=458

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 267/381 (70%), Gaps = 11/381 (3%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVEL  957
             I+V+MFPWL +GHI P+L LA+ LT RNF IY+CST   L+ I+++++ K + SIKLV L
Sbjct  11    IKVVMFPWLGYGHITPYLELAKKLTTRNFKIYLCSTIATLTCIEEKITPKLSHSIKLVPL  70

Query  956   QLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
              LP LP LP   HTTNGLPPHLMP LK+ALD S   F N+L  +KPDL++YDFLQPW P 
Sbjct  71    LLPVLPGLPRKLHTTNGLPPHLMPKLKEALDSSVDEFSNILADIKPDLLIYDFLQPWAPL  130

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQI  597
             +A  Q+IPAV F++  +    ++FH  + +P  E+P   +  RD+E  + ++L      +
Sbjct  131   VANEQNIPAVQFITSSSTMTCFMFHYFK-NPETEFPSKTIRFRDYESDKMEKLLACGRNL  189

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGE  417
             +     T+ + G  + S  I+LIK FR +EG+YID L+ LV K+ VPVGPLV+    D +
Sbjct  190   E---ERTKAVVG-FERSLKIVLIKGFRDIEGEYIDYLTELVGKKFVPVGPLVQEPTPDEK  245

Query  416   NPEIKE----WLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
               EI +    WLD K   STVFVSFGSEYFLT+ +++E+A GLE+SK+NF+WV+RFP   
Sbjct  246   GDEISDEILSWLDKKEEKSTVFVSFGSEYFLTKGDLDEIAYGLEMSKLNFIWVVRFPKGG  305

Query  248   AGEKARA--IGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
             +   +    +   LP G+L+RVG+RG V++GWAPQ  ILEH S+GGFVSHCGW+SV+E++
Sbjct  306   SNGLSNGLLLEKTLPRGFLDRVGERGMVLQGWAPQAKILEHPSVGGFVSHCGWNSVLESM  365

Query  74    KFGVPIIAMPMQLDQPLNARV  12
              FGVPIIA+PM LDQP+NAR+
Sbjct  366   NFGVPIIAVPMHLDQPINARL  386



>dbj|BAH80313.1| UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase [Catharanthus 
roseus]
Length=468

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/398 (48%), Positives = 263/398 (66%), Gaps = 25/398 (6%)
 Frame = -3

Query  1157  MDTSQR----SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE  990
             M T Q+    S+++LMFPWLA GH+ PFL LA+ L+ R FYIYICSTP+NL SIK  +S+
Sbjct  1     MATEQQEAPNSLKILMFPWLAFGHVSPFLQLAKKLSDRGFYIYICSTPINLDSIKNNISQ  60

Query  989   KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
               + SI+LV L LP+ P LPP  HTTN LPPHLM TLK AL  +KP    ++ +LKPDL+
Sbjct  61    NYSSSIQLVHLHLPNSPQLPPSLHTTNALPPHLMSTLKSALIEAKPELCKIMASLKPDLI  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             ++D  Q W   +A+ Q+IPAV F +  A + +Y+ H+    P  E+PF  +YL D E   
Sbjct  121   IHDVHQQWTAVLASKQNIPAVSFSTMNAVSFAYIMHMFM-QPGSEFPFKAIYLSDFE---  176

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGS-----SSIILIKTFRQLEGKYIDQLSNLVKKR  465
               RL+E  +      S  +  D  ++G+     +S  ++++ R++EGKY+D ++   K++
Sbjct  177   KARLWERLKSDHDQASSAKEKDPEIEGTKGSDFNSAFIVRSSREIEGKYLDYITEFSKRK  236

Query  464   CVPVGPLVRS-------LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeeval  306
              +PV  L  S         ++ +  E+ +WL+ K   S+VFVSFGSEYFL ++E EE++L
Sbjct  237   VMPVC-LANSPDNNNHQEQSNKDGDELIQWLETKSERSSVFVSFGSEYFLNKQEFEEISL  295

Query  305   gleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             GLELS VNF+WV+RFP  E     + I   LPEGYLERV  RG++V+GWAPQ  IL H +
Sbjct  296   GLELSNVNFIWVLRFPKGE----DKKIEQVLPEGYLERVEGRGRIVQGWAPQAKILGHPN  351

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
             IGGFVSHCGW+SVME+++ GVPIIA+PM  DQP NAR+
Sbjct  352   IGGFVSHCGWNSVMESIEIGVPIIAIPMITDQPFNARL  389



>ref|XP_011090910.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=466

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 254/387 (66%), Gaps = 12/387 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE--KD  984
             M+  +   R+LMFPWLAHGHI PFL LA+ L++RNF IY+CST +NL SI+    +   D
Sbjct  1     MEKKEAKFRILMFPWLAHGHIFPFLELAKRLSRRNFSIYLCSTAINLDSIRTNTGKDVSD  60

Query  983   AISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
                I+LVEL +P   +LPP  HTT  LP +L+ TL +AL MS   F N+++++ PDL++Y
Sbjct  61    DPLIQLVELHIPPSSELPPELHTTKNLPSNLLTTLIQALQMSSSSFSNIMNSVNPDLLIY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             DF QPW P +A+++ IP+V F S GA   ++  H+     +  +P+  +YL DHE   N 
Sbjct  121   DFFQPWAPKLASSKGIPSVFFSSAGATLFAFYHHIYTEGASSTFPYQAIYLLDHEN-NNF  179

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
             R    P   D   +D +   G    S+ +IL+K+ R +EGKYID LS+  KK+ VP GPL
Sbjct  180   RGRVLPNLKD---ADEDFAFGNFKLSTDVILMKSSRAVEGKYIDYLSSRCKKQIVPTGPL  236

Query  443   VRSLVADGEN--PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +     D +    EI  WL  K   ST+++SFGSE FL+++++E +A GL L  VNFLWV
Sbjct  237   IADASGDDDEKFSEIMRWLSEKQEYSTIYISFGSECFLSKDQIEVIAKGLALCNVNFLWV  296

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP    GEK+ +I +A+P G+LE V  RG +V GWAPQ  IL H S GGFVSHCGW S
Sbjct  297   VRFP---IGEKS-SIKEAMPAGFLETVKDRGIIVPGWAPQTKILAHPSTGGFVSHCGWGS  352

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             +ME++ FGVP+IAMPMQ DQP+NAR+V
Sbjct  353   IMESMYFGVPVIAMPMQADQPINARLV  379



>ref|XP_011032817.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Populus 
euphratica]
Length=436

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 259/382 (68%), Gaps = 32/382 (8%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
             T++R +RVLMFPWLA+ HI PFL LA+ L++RNFYIY+CS+P NL  IK+ + E +  SI
Sbjct  4     TNRRVVRVLMFPWLAYSHIHPFLELAKKLSERNFYIYLCSSPANLGHIKENLLEMNFPSI  63

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             +LVEL LPS PDLPPHYHTT GLP HL+  L +A D +   F  +L TL+PDL++ DF Q
Sbjct  64    QLVELHLPSSPDLPPHYHTTKGLPNHLLGNLMQAFDTASSSFSGILTTLRPDLLICDFFQ  123

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGR--GHPAEEYPFPELYLRDHEFIRNKRL  618
             PW PA+A + +IP V F+  G  A S   H  +  G   ++     L++RD         
Sbjct  124   PWAPALALSLNIPTVQFVVSGNKANSVAVHAFKKSGVVIQDSAKDFLFIRD---------  174

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                            RI   L+ SS I+L+++ R++EGKY+D LS +  KR +PVGPLV+
Sbjct  175   ---------------RILQHLEQSSGIMLVRSSREIEGKYLDDLSAVTMKRVLPVGPLVQ  219

Query  437   SLVA-DGENPEIKEWLDMKPRCSTV-FVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               +A D +  EI EWL+ +  CS+V +V+FGSE +L++E+ EE+ALGL LS V+F+WV+R
Sbjct  220   DPIAEDDKKTEITEWLNRRDPCSSVIYVAFGSENYLSKEDREELALGLLLSNVDFIWVLR  279

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             FP    GE+  A  +ALPEG++E V +RG +VE WAPQ  IL H SIGGF+SHCGW SV+
Sbjct  280   FP---RGEEISA-REALPEGFIEMVSERGLIVEEWAPQKRILSHPSIGGFLSHCGWGSVL  335

Query  83    EALKFGVPIIAMPMQLDQPLNA  18
             E++KFGVP+IAMPM +DQPLNA
Sbjct  336   ESMKFGVPLIAMPMHIDQPLNA  357



>ref|XP_011090911.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   348 bits (892),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 252/389 (65%), Gaps = 15/389 (4%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE--KD  984
             M+  +   RVLMFPWLAHGHI PFL LA+ L++RNF +Y+CST VNL SI+        D
Sbjct  1     MEKKETKFRVLMFPWLAHGHIFPFLQLAKRLSRRNFSVYLCSTAVNLDSIRANTERDVSD  60

Query  983   AISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
               SI+LVEL +P   +LPP  HTT  LP +L+P L +A   S   F ++++++ PDL++Y
Sbjct  61    DPSIELVELHIPPSSELPPELHTTKNLPSNLLPALLQAFQTSSFSFSDIMNSVNPDLLIY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             DF QPW P +A+++ IP+V F   G A  ++  H+     +  +P+  +YL DHE     
Sbjct  121   DFFQPWAPKLASSKVIPSVFFSCAGVAPYAFYHHLYTEGASSIFPYQAIYLLDHESTNVL  180

Query  623   RLFEPPEQIDGDVSDTER--IDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
                EP      ++ D E+    G    S+ IIL+K+ R +EGKYID LSN  KK+ VP G
Sbjct  181   ARIEP------NIKDAEKDFAFGSFKLSTDIILMKSSRSVEGKYIDYLSNRCKKQIVPTG  234

Query  449   PLVR--SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             PL+   S   D +  EI  WL  K   ST+++SFGSEYFL+++++E +A GL L  VNFL
Sbjct  235   PLIADASHYDDEKLSEIMRWLSEKQEYSTIYISFGSEYFLSKDQIEVIAKGLALCNVNFL  294

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WV+RFP    GEK+ +I +ALP  +LE V  RG +V  WAPQ  IL H S GGFVSHCGW
Sbjct  295   WVVRFPT---GEKSTSIEEALPAWFLETVKDRGIIVPEWAPQTKILAHWSTGGFVSHCGW  351

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SS+ME++ FGVP+IAMPM+ DQP+NAR+V
Sbjct  352   SSIMESMYFGVPVIAMPMKSDQPINARLV  380



>ref|XP_011090843.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 261/387 (67%), Gaps = 13/387 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE-KDA  981
             M+  Q ++ +LMFPW+ HGH+ P+L LA+ L+  NF I+ CST VNLSS+   ++    +
Sbjct  1     MEAKQANLSILMFPWIGHGHVFPYLELAKNLSTHNFDIFFCSTAVNLSSVNDVLANTSSS  60

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             +SI+LVEL LPS P+LPP YHTT   PPHL+P L +A  MS   F +++ +L PD+++YD
Sbjct  61    VSIQLVELHLPSAPELPPCYHTTKNAPPHLLPKLHEAFQMSNSSFSDIITSLNPDMLIYD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
               QPW   +A++  IPAV F + GA   S+ FH         +P+ E+YLRD+E    ++
Sbjct  121   GFQPWAAKIASSLGIPAVHFATAGAVPYSFYFH-SFISATSAFPYEEIYLRDYE----RK  175

Query  620   LFEPPEQIDGDV--SDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
              +E     D  V  +D +   G    S  ++L+KT R +EGKY+D LS L KK+ VPVGP
Sbjct  176   AYETMVFSDLGVKKNDLDSAIGHFTLSCDVVLVKTCRAIEGKYMDYLSVLCKKKLVPVGP  235

Query  446   LV-RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             LV  S   +G++ EI EWL  K + STVF+SFGSE +L++++M E+A GLE S VNF+WV
Sbjct  236   LVTHSNSEEGKHAEIVEWLSQKNKFSTVFISFGSENYLSKDQMVEIAKGLEASDVNFIWV  295

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP    GE+  +I + +P+G+L+RV  RG +++GWAPQ  IL H S G F+SHCG SS
Sbjct  296   VRFP---PGERV-SIEEVVPKGFLDRVQDRGMILQGWAPQTQILAHPSTGAFLSHCGMSS  351

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             ++E++ FGVP+IAMP++LDQP NAR+V
Sbjct  352   IIESIYFGVPVIAMPLKLDQPFNARLV  378



>dbj|BAM28984.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=454

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 253/380 (67%), Gaps = 12/380 (3%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             S R+LMFPWLAHGHI PFL L++ LT++NF IY CST +NLS IKK + E  + +++LVE
Sbjct  11    SFRILMFPWLAHGHISPFLQLSKKLTQKNFQIYFCSTAINLSFIKKSLGESSSDNLRLVE  70

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L  P + +LPP +HTT  LPPHLM TL ++  +++  F + + TLKPDL++YD  Q W  
Sbjct  71    LHFPDVFELPPQHHTTKNLPPHLMSTLMRSFQIAQASFSSSITTLKPDLIIYDSFQSWAS  130

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFH-VGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
              +AA   IP+V F + GAA+ S+ +H +     +  +PF E++ RD+E  + + L E   
Sbjct  131   TLAAIHGIPSVHFSTSGAASMSFFYHQLSLRRDSGTFPFSEIFQRDYERDKFESLVESNR  190

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL--V  429
              +  D +         + SS I+L+K+   LE KY+D LS L  K+ V  GPL++     
Sbjct  191   GVAEDFAFR-----SFELSSEIVLMKSCIGLEDKYLDYLSFLCGKKMVTTGPLIQESHNY  245

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              + ++  I E+L+ K + S VFVSFGSEY+L+ EE EE+A GLELS ++F+WV+RFP   
Sbjct  246   ENSDDVGIIEFLNKKDQSSVVFVSFGSEYYLSAEEREEIAYGLELSNLSFIWVVRFPLG-  304

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
                   ++ +ALPEG+LERV +RG VV+ WAPQ  ILEH S  GFVSHCGWSSVME+L +
Sbjct  305   ---NTTSVEEALPEGFLERVKERGMVVDKWAPQAKILEHPSTCGFVSHCGWSSVMESLYY  361

Query  68    GVPIIAMPMQLDQPLNARVV  9
             GVP+IAMPM LDQP NAR +
Sbjct  362   GVPVIAMPMHLDQPTNARFL  381



>ref|XP_004140986.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 gb|KGN46026.1| hypothetical protein Csa_6G045050 [Cucumis sativus]
Length=489

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 189/392 (48%), Positives = 268/392 (68%), Gaps = 18/392 (5%)
 Frame = -3

Query  1148  SQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEK--DAIS  975
             ++  +++LM PWLAHGH+ PFL L++ L  +NF+I+ CST + L SI+ ++ +K   + +
Sbjct  9     NKMKMKILMLPWLAHGHVSPFLELSKLLATKNFHIFFCSTSIILHSIRSKLPQKLLSSSN  68

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I+LVEL LP+  DLP   HTT GLP HLM +LK+A D +   F  +L  LKPDLV+YDFL
Sbjct  69    IQLVELTLPTSADLPRWRHTTAGLPSHLMFSLKRAFDSAASAFDGILQNLKPDLVIYDFL  128

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEY--PFPELYLRDHEFIRNKR  621
             QPW PA+A + +IPAV+F   GA   + + ++ +  P  ++   FPE++L + E  + K 
Sbjct  129   QPWAPAVALSANIPAVMFQCTGALMAAMVTNMLK-FPNSDFLSTFPEIHLSEFEIKQLKN  187

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             LF+       D  D +RI+ C   S  I+L+K+ R++E KYID +S  ++ + +PVGPLV
Sbjct  188   LFKSSV---NDAKDKQRIEECYKRSCGILLLKSLREIEAKYIDFVSTSLQIKAIPVGPLV  244

Query  440   RS----LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
                   +V   E+ E  +WL+ K + S + VSFGSE++L++ +MEE+A GLELS VNF+W
Sbjct  245   EEQEEDIVVLAESFE--KWLNKKEKRSCILVSFGSEFYLSKGDMEEIAHGLELSHVNFIW  302

Query  272   VIRFPAA-EAGE---KARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             V+RFP + E GE   K   + + LP+G+LERVG+RG VVE W PQ  IL+H S GGF+SH
Sbjct  303   VVRFPGSGEQGERKKKKNVVEEELPKGFLERVGERGMVVEEWVPQVQILKHRSTGGFLSH  362

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             CGWSSV+E++K GVPIIA PMQLDQPLNAR+V
Sbjct  363   CGWSSVLESIKSGVPIIAAPMQLDQPLNARLV  394



>gb|AGO03777.1| non-smoky glycosyltransferase 1 [Solanum lycopersicum]
Length=450

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 256/386 (66%), Gaps = 14/386 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA---IS  975
             + S  +L+FPWL  GH+ PFL LA+ L+K NF+IY  STP+ L SIK+ + +       S
Sbjct  6     ENSPSILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKETLDKNSTNYNQS  65

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I+LVE  LP L +LPPHYHTT  LPPHL  TL +A  M+   F ++++TLKP+L++YD  
Sbjct  66    IQLVEFHLPYLHELPPHYHTTKDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYDGF  125

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFH--VGRGHPAEEYPFPELYLRDHEFIRNKR  621
             QPWV  MA++ +I A++F     +  +YL+H  +        +PF  +YL DHE    K+
Sbjct  126   QPWVATMASSYNIHAIMFYVSSTSGLAYLYHQFLHGSSSLTSFPFSSIYLHDHEI---KK  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L   P +   + +    I    + S +I+L+ T R++EGKYID +S + KK  +P+GPL+
Sbjct  183   LGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCREIEGKYIDYVSTIGKKELIPIGPLI  242

Query  440   RSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             R  + D E     I+ WLD K + S V+VSFGSE FL+++E+EE+A GLELSKVNF+W I
Sbjct  243   REAMIDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFLSKQEIEEIAKGLELSKVNFIWTI  302

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             +FP        + I + +P+G+LE    +G V+EGWAPQ +IL HSSIGGF++HCGW+S+
Sbjct  303   KFPKG----VNKTIEEMVPQGFLESTKGKGMVIEGWAPQSLILNHSSIGGFITHCGWNSI  358

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             +E++ FG+PIIAMPM  DQPLN+R+V
Sbjct  359   LESMSFGIPIIAMPMNHDQPLNSRLV  384



>gb|EYU38052.1| hypothetical protein MIMGU_mgv1a019912mg [Erythranthe guttata]
Length=471

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 252/387 (65%), Gaps = 19/387 (5%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             V+MFPWLAHGHI PFL LA+AL+ R+F  ++ STP NL+SI  ++ +  +  I LVEL L
Sbjct  14    VVMFPWLAHGHITPFLELAKALSHRHFISHLVSTPANLTSIANKIPQAYSAFIHLVELHL  73

Query  950   PSL--PDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
             PS   P+LPPH HTTNGLP +L P L+KAL  +KP F NL++TL PDL+++D LQPW  A
Sbjct  74    PSQNSPELPPHRHTTNGLPLNLHPALRKALRAAKPDFSNLVETLNPDLLIHDILQPWAAA  133

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQI  597
             +A+   IP+  F + GAAA SY  H+G      E+PFP + L   E        E     
Sbjct  134   VASTHKIPSAAFSTSGAAAVSYFSHLG-SRRGVEFPFPAIRLTASELTMAFGDIESHRSE  192

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS------  435
             + + SD +        ++  +L+ + R++EGKYID LS L+ K  +P+G LV        
Sbjct  193   EREYSDEDA--AAFRNNNGFMLVNSSREIEGKYIDYLSELITKTIIPIGSLVNQDPLIIK  250

Query  434   -----LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
                     D ++  I +WLD K   S+VFVSFGSE+FL E+E+EEVA GLELS  NF+W+
Sbjct  251   NDDGDGDDDVDSDVIMDWLDEKDELSSVFVSFGSEFFLNEQEIEEVAHGLELSGANFIWI  310

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             IRFP      +A    +ALPEG++ERVG RG ++E WAPQ  IL HSSIGGFVSHCGW+S
Sbjct  311   IRFPNGAGPGRAH---EALPEGFVERVGGRGMILEKWAPQARILSHSSIGGFVSHCGWNS  367

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             + E L  GVPI+A+PM LDQP+NA++V
Sbjct  368   LKEGLDLGVPIVAVPMHLDQPMNAKLV  394



>ref|XP_009416699.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=486

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/401 (49%), Positives = 259/401 (65%), Gaps = 30/401 (7%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVEL  957
             +RV+M PWLAHGH  PFL LA+ L++ + +++ CSTP NL S++++       SI+LVEL
Sbjct  10    LRVVMLPWLAHGHASPFLELAKRLSRHDVFVHFCSTPANLVSMREQFDANAFPSIRLVEL  69

Query  956   QLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
             QLP+LP LPP  HTT  LP HLMPTLK+A D+++P F  LL  L PDL++YDFLQPW P 
Sbjct  70    QLPALPGLPPDLHTTKHLPSHLMPTLKQAFDLAEPDFGLLLQALHPDLLIYDFLQPWAPL  129

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQI  597
              A  ++IPA+ FL+  A++ ++  H  +  P EE+PFP + L   E   N        + 
Sbjct  130   SAHRRNIPAIQFLTTAASSAAFFCHCIK-RPTEEFPFPAMSLGVKE---NLEHIATMNRF  185

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV--------  441
                +SD ER   C+D SS  I I+TFR++E KYID LS ++ K  VPVGPLV        
Sbjct  186   ANGMSDGERFLRCMDRSSGFIAIRTFREIEAKYIDYLSCVLDKEVVPVGPLVPDDDDDDD  245

Query  440   --------RSLVADGENPE-IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSK  288
                     R  V D E    I  WL  K + S V  +FGSEYF+ +EEM EVA GLELS 
Sbjct  246   DDGSSGRDRLTVKDRETERSIMSWLGAKEKSSVVLATFGSEYFMCKEEMREVARGLELSG  305

Query  287   VNFLWVIRFPA-----AEAGEKARAIGDALPEGYLERVGK---RGKVVEGWAPQGMILEH  132
             ++F+WV+RFP        AG+ + +   ALP G++ERV K   RG VVEGWAPQ  IL H
Sbjct  306   LSFIWVVRFPKDGILPTVAGDSS-SWATALPSGFVERVVKGEGRGLVVEGWAPQRKILSH  364

Query  131   SSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
               +GGF++HCGWSSV+EA+K+GVPIIA+P+QLDQP NA++V
Sbjct  365   PGVGGFLTHCGWSSVVEAMKYGVPIIALPLQLDQPPNAKLV  405



>gb|KCW51491.1| hypothetical protein EUGRSUZ_J01007, partial [Eucalyptus grandis]
Length=410

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 248/361 (69%), Gaps = 25/361 (7%)
 Frame = -3

Query  1079  LAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPSLPDLPPHYHTTNGL-  903
             LA+ L+ RNF+I++CSTPVNLSSIK ++S+K + SI+LVEL +PSLPDLPPHYHTT GL 
Sbjct  1     LAKRLSARNFHIHLCSTPVNLSSIKPKISKKYSSSIELVELHIPSLPDLPPHYHTTKGLA  60

Query  902   -PPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGA  726
              PPH  P          P        +        F +PW P +A +  +P+V+F   GA
Sbjct  61    SPPHENP---------HPWLQQYRQEVSARFARLTFSKPWAPEVAKSHGVPSVVFFVSGA  111

Query  725   AACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGS  546
              + S+L HV + +   E+PF E++L D+E  +  +  E       D +D  R   C++ S
Sbjct  112   GSSSFLLHVTK-NTCNEFPFGEIFLHDYELAKIIKAAEDSR----DAADY-RTPQCVERS  165

Query  545   SSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR--SLVADGENPEIKEWLDMKPRCS  372
             S+ IL+KTFR+LEGKYID LS+   K+ VPVGPLV   S + DG++  I EWLD + + S
Sbjct  166   SNFILMKTFRELEGKYIDYLSSYSGKKVVPVGPLVEDPSNIEDGDS--IIEWLDKRDKLS  223

Query  371   TVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLER  192
             TVFVSFG+EYFLTE++ EE+A GLELS VNFLWVIRFP  E+ E    + +ALP G+LER
Sbjct  224   TVFVSFGTEYFLTEKDREEIAHGLELSNVNFLWVIRFPVGESIE----LEEALPGGFLER  279

Query  191   VGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
             V  RG V++GWA QG ILEH SIGGFVSHCGW SVME++K GVPIIAMPMQLDQP+NAR+
Sbjct  280   VRDRGSVIDGWAAQGKILEHPSIGGFVSHCGWGSVMESMKSGVPIIAMPMQLDQPMNARL  339

Query  11    V  9
             V
Sbjct  340   V  340



>ref|XP_006365665.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=446

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 183/383 (48%), Positives = 262/383 (68%), Gaps = 20/383 (5%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + ++RVLMFP+LA+GHI PF  LA+ L+ R F I +CSTP+NLS IKK++++K + SI L
Sbjct  6     KTNVRVLMFPYLAYGHITPFFELAKKLSDRGFSIDLCSTPINLSLIKKKITQKYSCSIHL  65

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VE  LP+LP+LPPHYHTTNGLP HL  TL KA+ MSKP F  +L   KP+++V+D +QPW
Sbjct  66    VEFHLPNLPELPPHYHTTNGLPIHLQSTLYKAITMSKPQFYEILKDQKPNVLVHDVMQPW  125

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
                +A++ +IP++ F       C Y  H     P  E+PFP LYL+D+E    + +  P 
Sbjct  126   AAGVASSLNIPSIKFCLTSITMCCYFGHFFL-KPGVEFPFPALYLKDYE----REITRP-  179

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
                D +V +       L  + +I+L+ + R ++GKY+D LS + K   +P G +++ +  
Sbjct  180   --YDVEVKEE------LGENRAIMLVNSSRAIDGKYMDYLSEIGKTEILPTGVVIQDIAI  231

Query  425   DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
             + E  EI +WL  K   STV+VSFGSE FLT+EEMEEVA GLELS V+F+WV+RFP    
Sbjct  232   NEEQMEIIKWLGNKKENSTVYVSFGSENFLTKEEMEEVAYGLELSNVHFIWVVRFPKE--  289

Query  245   GEKARAIGDALPEGYLER-VGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              E+  ++ D LP+G+L+R +G++G+++E WAPQ  IL+H SIG F++HCGW+S +E ++F
Sbjct  290   -EQVVSLEDVLPQGFLQRNIGEKGRIIECWAPQTTILKHPSIGAFLTHCGWNSTLECIEF  348

Query  68    GVPIIAMPMQL--DQPLNARVVA  6
             GVPIIA+PM    DQPLNAR++ 
Sbjct  349   GVPIIALPMNFYSDQPLNARLIV  371



>ref|XP_004243636.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=441

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 183/384 (48%), Positives = 258/384 (67%), Gaps = 25/384 (7%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++R++M P+LA+GHI PFL LA+ L+ R F I+ICS+P+NLS IK ++ EK + SI LVE
Sbjct  3     NMRIVMLPYLAYGHITPFLELAKKLSNRGFSIHICSSPINLSFIKAKIPEKYSSSIHLVE  62

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L LP+LP+LPPH+HTTNGLP HL  TL K L M+KP    +L  LKPD  +YD +  W  
Sbjct  63    LHLPNLPELPPHHHTTNGLPNHLKQTLFKTLKMTKPQLHQILSDLKPDFFIYDIMLLWSA  122

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +A++ +IP++ F +  AA  SY FH    +P EE+PFP LY+RD+E  +          
Sbjct  123   VVASSLNIPSLRFYTVNAAIFSYFFHF-YFNPGEEFPFPALYMRDYELAK----------  171

Query  599   IDGDVSDTERIDGCLDG---SSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG---PLVR  438
             +  +V+D   ++   D    S   +L+ + + ++GKY+D L    + + VP+G   P   
Sbjct  172   MTHEVADDAEVEVDRDKVTESDKFVLVHSTKSIDGKYMDYLCGTGQAKVVPIGTESPEDG  231

Query  437   SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 D  + E+ +WL+ K   STV+VSFGSEYFL++EEMEEVA GLE+S V+F+WV+R+ 
Sbjct  232   VGDVDKIDIELVKWLEKKTEHSTVYVSFGSEYFLSKEEMEEVAYGLEVSGVDFIWVVRYQ  291

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E  E        LP+G+ ER+G RG+++EGWAPQ  IL+HSSIGGFV+HCGW+S +E+
Sbjct  292   KGEQLE--------LPQGFKERIGDRGRIIEGWAPQQRILKHSSIGGFVTHCGWNSTLES  343

Query  77    LKFGVPIIAMPMQLDQPLNARVVA  6
             ++FGVPIIAMPM  DQPLNAR++ 
Sbjct  344   IEFGVPIIAMPMLYDQPLNARLMV  367



>emb|CDP12002.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 195/398 (49%), Positives = 256/398 (64%), Gaps = 24/398 (6%)
 Frame = -3

Query  1154  DTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             +++ R  RVLMFPWLAHGH+ PFL L++ L + NF IY CST VNLS IKK  +  +  S
Sbjct  8     ESNTRRFRVLMFPWLAHGHMSPFLELSKRLAQNNFQIYFCSTEVNLSFIKKDRNLDEYFS  67

Query  974   ---IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
                I+LV+L LP  P+LPPHYHTT  LPPHL PTL  A  M K  F N+L+ L+PDL++Y
Sbjct  68    DHSIELVQLDLPHFPELPPHYHTTKNLPPHLNPTLHVAFYMGKTNFQNILNILQPDLLIY  127

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPG--AAACSYLFHV---GRGHPAEEYPFPELYLRDHE  639
             D  Q W   +A+   IP+VLFL  G    A SY + V   G       YPFP + L+D+E
Sbjct  128   DVFQAWASELASLIHIPSVLFLCAGLVCRAWSYFYDVNNKGLSGVDGTYPFPAIVLKDYE  187

Query  638   FIRNKRLFEPPEQIDGDVSDTE--RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKR  465
                 K+L    ++   ++ +     +  CL+ SS I+L+KT R++EGKYID LS+   K+
Sbjct  188   I---KKLAAFLQEFKKNIPEEVMLSLTKCLEVSSDIVLLKTCREIEGKYIDHLSSCCGKK  244

Query  464   CVPVGPLVRSLVADGENPE-------IKEWLDMKPRCSTVFVSFGSEYFlteeemeeval  306
              V VGPL+     D +  E       I E+L+ +   S V+VSFGSE FL+EEE EE+A 
Sbjct  245   IVAVGPLIELKHDDTKTEEETENSSHIIEFLNGREESSVVYVSFGSECFLSEEEREEMAY  304

Query  305   gleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             GLELS  NF+WV+RFP   A     A+ +ALPEG+LERV  RG VV+GWAPQ  ILEH S
Sbjct  305   GLELSNANFIWVVRFPVGHA----IALEEALPEGFLERVKTRGVVVDGWAPQAKILEHPS  360

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
              GGFVSHCGW S +E++ +GVP++A+PM  DQP +AR+
Sbjct  361   TGGFVSHCGWGSFLESIYYGVPLLALPMLYDQPHHARL  398



>gb|EYU43900.1| hypothetical protein MIMGU_mgv1a026213mg [Erythranthe guttata]
Length=454

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/382 (50%), Positives = 255/382 (67%), Gaps = 13/382 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKD--AISI  972
             + +  +LMFPWLAHGH+ P+L LA+ L+ +NF I+ CST + LSSIK+ +       ISI
Sbjct  2     ESNFNILMFPWLAHGHVYPYLELAKNLSTKNFNIFFCSTSIILSSIKETLDRNSPCGISI  61

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              LVEL LPS PDLP +YHTT  LPPHLMP L  +   S   F +++ +LKPD+++YD  Q
Sbjct  62    NLVELHLPSSPDLPQNYHTTKNLPPHLMPKLFDSFQNSNSSFSSIISSLKPDMLIYDVFQ  121

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
             PW   +A + SIPAV F + GA A S+ +H    H    +P+  +YLRD+E     R   
Sbjct  122   PWAAKIATSLSIPAVHFATSGATAYSF-YHHHFIHKNSPFPYDGIYLRDYE-----RKAL  175

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL  432
                 +  D +D +   G    S  I+L+KT   LEGKY+D LS L KK+ VPVGPLV   
Sbjct  176   QSMVLSRDKNDQDFAFGHFSMSCEIVLMKTCNGLEGKYLDYLSVLCKKKIVPVGPLVTQA  235

Query  431   VADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
                 EN  +I +WL  K R STVF+SFGSE +L++++M E+A GLE S VNF+WV+RFP 
Sbjct  236   DESDENHSDIMKWLSTKDRFSTVFISFGSENYLSKDQMGEIAKGLEFSNVNFIWVVRFPH  295

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
                GE+  +I +ALP+G+L+RV +RG +V+GWAPQ  IL H SIG FVSHCG SS +E++
Sbjct  296   ---GERV-SIEEALPKGFLDRVKQRGMIVQGWAPQAKILGHPSIGAFVSHCGMSSTIESV  351

Query  74    KFGVPIIAMPMQLDQPLNARVV  9
              FGVP+IA+P++LDQPLNAR+V
Sbjct  352   YFGVPVIAVPLKLDQPLNARLV  373



>dbj|BAI44134.1| flavonoid glycosyltransferase UGT94C2 [Veronica persica]
Length=460

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 188/390 (48%), Positives = 257/390 (66%), Gaps = 17/390 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRVSEKDAI--S  975
             + S ++LMFPWLAHGH+ P+L LA+ + K +NF IYICSTP+N +SI   ++ K+ +  S
Sbjct  4     ENSFKILMFPWLAHGHVFPYLELAKRILKGKNFQIYICSTPINFTSINTFIN-KNLLENS  62

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I+LV++QL    +LPPHYHT   LPP+L+ TL  A   +   F N++ TLKPDLV+YD  
Sbjct  63    IQLVDIQLQPSEELPPHYHTPKNLPPNLLFTLINAFQSTHSNFSNIIATLKPDLVIYDIF  122

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAE----EYPFPELYLRDHEFIRN  627
             QPW   +++ Q IPAV F S GA   S++ H     P++     +PFP L  +DHE    
Sbjct  123   QPWAAKISSLQGIPAVHFASIGAGVLSFIHH--HYTPSDIISTPFPFPVLQCKDHEVKSI  180

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             ++L E   +   DV D + + G    S +I+L+KT R  E KY++ +    KKR V VGP
Sbjct  181   EKLLEFLYENLHDV-DQDFLFGSFKHSCNIVLVKTSRSFEQKYMNYIQEKCKKRIVSVGP  239

Query  446   LV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             LV    ++  + ++  I +WL+ K   STV++SFGSEYFL ++E+EE+A GLEL   NF+
Sbjct  240   LVSNSNNITNEEDSESIIQWLNSKSLRSTVYISFGSEYFLNDKEVEEIAKGLELCDANFI  299

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WVIRFPA   G+K  ++ + LP G+L RV  RG VVEGWAPQ  IL HSSI  F SHCGW
Sbjct  300   WVIRFPA---GDKTISLENTLPRGFLNRVKDRGLVVEGWAPQVPILAHSSIACFASHCGW  356

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             SS+ME+L +GVP+IAMPMQ DQP+NAR+  
Sbjct  357   SSLMESLYYGVPVIAMPMQFDQPINARLAG  386



>emb|CDP12003.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 192/387 (50%), Positives = 252/387 (65%), Gaps = 22/387 (6%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS---IKLVELQ  954
             MFPWLAHGH+ PFL L++ L K NF IY CST +NLS IKK  +  +  S   I+LV+L 
Sbjct  1     MFPWLAHGHMSPFLELSKRLAKNNFQIYFCSTEINLSFIKKDRNLDEYFSDHSIELVQLD  60

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LP  P+LPPHYHTT  LPPHL PTL  A  M +  F N+L+ L+PDL++YD  Q W   +
Sbjct  61    LPRFPELPPHYHTTKNLPPHLNPTLHVAFYMGRTNFQNILNILQPDLLIYDMFQAWASEL  120

Query  773   AAAQSIPAVLFLSPGAA--ACSYLFHV-GRGHPAEE--YPFPELYLRDHEFIRNKRLF-E  612
             A+   IPAVLFL  GA   + SY + +  +G+   +  YPFP ++LRD+E  R      E
Sbjct  121   ASMFHIPAVLFLGGGAVFWSWSYFYDIINKGYSGIDGTYPFPAIFLRDYEIKRMAAFLQE  180

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV---  441
               E++  +V    +  G  + SS I+L+K  R+++GKYID LS+   K+ + VGPL+   
Sbjct  181   SKEKVPQEVV-LSKTKG-FEVSSDIVLLKACREIDGKYIDHLSSSRGKKILAVGPLIELK  238

Query  440   ----RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
                 +    D  +  I E+L+ +   S V+V FGSEYFL+EEE EE+A GLELS  NF+W
Sbjct  239   HDDTKEEEKDENSSHIIEFLNGREESSVVYVCFGSEYFLSEEEREEMAYGLELSNANFVW  298

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             V+RFP   A     A+ +ALPEG+LERV  RG VV+GWAPQ  ILEH S GGFVSHCGWS
Sbjct  299   VVRFPVGHA----IALEEALPEGFLERVKDRGVVVDGWAPQAKILEHPSTGGFVSHCGWS  354

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARV  12
             S ME+L +GVP++A+PM  DQPL AR+
Sbjct  355   SFMESLYYGVPLLALPMLYDQPLQARL  381



>emb|CDP17151.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/395 (47%), Positives = 252/395 (64%), Gaps = 26/395 (7%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKK-----RVSEKDAI  978
              + R+LMFPWLAHGHI PF+ L++ L K  F IY CST +NL+ IK+       S   +I
Sbjct  5     NTFRILMFPWLAHGHISPFIELSKRLAKNKFKIYFCSTEINLNFIKESKGFDENSSDHSI  64

Query  977   SI---KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
              +   KLV L LP  P+LPPHYHT   LPPHL  TLK A  MSK  F N+L+TLKPDL +
Sbjct  65    QLSIAKLVRLDLPDFPELPPHYHTIKNLPPHLTSTLKLAFRMSKTSFSNILNTLKPDLQI  124

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA---EEYPFPELYLRDHEF  636
             YD LQ W   +AA  SIP+ L +  GA   S+ +H      +   E YPF E++ RD+E 
Sbjct  125   YDVLQSWAAELAALNSIPSPLII--GAVNISFFYHGTNCRVSGTNETYPFSEIFFRDYEM  182

Query  635   IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
                K++    +++    S+   +  C + SS I+L+K++ ++EG+YID LS    K+ V 
Sbjct  183   ---KKIIATYQELTKLESEEAEVFKCFELSSDIVLVKSWTEIEGRYIDHLSLCSGKKVVS  239

Query  455   VGPL------VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL  294
             VGPL       +      +N +  ++L+ K   S V+VSFGSEYFL++EE EE+A GLEL
Sbjct  240   VGPLNNQDDDTKEEEEQEDNSDSIKFLNSKDESSVVYVSFGSEYFLSKEEREEIAYGLEL  299

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGF  114
             S  NF+WV+ FP   A     A+ +ALPEG+L RV +RG VV+GWAPQ  IL+H + GGF
Sbjct  300   SNANFIWVVIFPMGHA----VALEEALPEGFLHRVKERGIVVDGWAPQAKILQHPNTGGF  355

Query  113   VSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             +SHCGW SVME++  GVP++A+PMQ DQPLNAR+V
Sbjct  356   LSHCGWGSVMESIYDGVPLLALPMQHDQPLNARLV  390



>ref|XP_011090909.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/387 (48%), Positives = 258/387 (67%), Gaps = 11/387 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M+  Q    +LMFPWLAH H+ PFL LA+ L+KR+F+IY CS+ +NL SI+  ++    I
Sbjct  1     MENEQPKFSILMFPWLAHSHVFPFLGLAKTLSKRSFHIYFCSSAINLDSIRNNMATYLPI  60

Query  977   ---SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
                SI L+EL+LPSLP+LP  +HTT  LPP+L+P L +A  MS   F  +L+ L+PDL++
Sbjct  61    ATASIDLIELRLPSLPELPSQFHTTKNLPPNLLPILLQAFQMSSSSFSEVLNALRPDLLI  120

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             YDF QPW   +A +Q IP+V F + GAA  S+ +H+        +P+ E+YL +HE +  
Sbjct  121   YDFFQPWAAKLALSQGIPSVYFATTGAAPFSFFYHLYTYGTTTTFPYQEIYLLEHEKVDL  180

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             +   EP  +     +D +   G    SS+I+L+K+ R +EGKYID LS L +K+ VP GP
Sbjct  181   RAPVEPKVK----DADEDFAFGNFKLSSNIVLVKSLRGVEGKYIDYLSALCQKKVVPTGP  236

Query  446   LVRSLVADGENP-EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
             +V+    + E   EI +WL  K R STVF+ FGSE+FL++E++ E+A GLEL + NF+W 
Sbjct  237   IVQEPNDEDEGCWEILQWLSRKERFSTVFICFGSEHFLSKEQILEIAKGLELCESNFIWA  296

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
              RFP     E+   I DA P G+L+RV +RG V+  WAPQ  IL   SIGGFVSHCGWSS
Sbjct  297   TRFPVE---EETLCIEDAFPSGFLDRVKERGLVLRKWAPQAKILSCPSIGGFVSHCGWSS  353

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             +ME++ FG+P+IAMP++ DQP+NAR+V
Sbjct  354   IMESMYFGIPVIAMPIKFDQPINARLV  380



>gb|EPS69530.1| hypothetical protein M569_05234, partial [Genlisea aurea]
Length=430

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/384 (50%), Positives = 245/384 (64%), Gaps = 26/384 (7%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQ  954
             R+LM PWLA+GH  PF+ LA+AL +R F IYICS+P NL S++  VS     S++ +EL 
Sbjct  1     RILMLPWLAYGHTSPFVELAKALARRGFIIYICSSPANLHSVRDSVS---TASVEFIELH  57

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LP   +LPP YHTTNGLPPHLM  LK+AL  ++PGF  +L +L PDLV+YDF+QPW    
Sbjct  58    LPESRELPPRYHTTNGLPPHLMADLKEALIRARPGFAEILRSLNPDLVIYDFIQPWAAEE  117

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A++  IPAV F   G A+ S LF         EYPFP ++ R HE     R+      +D
Sbjct  118   ASSLGIPAVFFNIFGEASSS-LFGHRLWRSESEYPFPAIHYRGHELGFFNRI------VD  170

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-------  435
             G     E + G +  SS IIL++TFR+LEGKYID  S L KKR VPVG LVR        
Sbjct  171   G----FELLRGSVGRSSEIILVRTFRELEGKYIDYHSELTKKRHVPVGHLVRDPEEAYDE  226

Query  434   -LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                   E   I +WLD +   STVF SFG+EYFL++EEME +A GLE S+ NF+WV+   
Sbjct  227   EEEKKAECDAIMKWLDERTEKSTVFASFGTEYFLSDEEMEGIAGGLETSEANFIWVL---  283

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
              +  G+   A  + LP+G+L R   RG V+  WAPQ  IL H S+GGF+SHCG SSV+E 
Sbjct  284   TSHMGDDDDA-PERLPDGFLRRTRSRGLVLAKWAPQLRILSHRSVGGFLSHCGRSSVIEG  342

Query  77    LKFGVPIIAMPMQLDQPLNARVVA  6
             L  GVPI+A+PM LDQPLNAR++ 
Sbjct  343   LYCGVPIVALPMHLDQPLNARLLT  366



>gb|AFK79037.1| glycosyltransferase UGT5 [Bupleurum chinense]
Length=456

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 257/388 (66%), Gaps = 22/388 (6%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + ++++M P+++HGHI P+L  A+ L+KRN F IYICSTP+NL+SIK RV +     ++L
Sbjct  7     KRMKIVMLPYVSHGHISPYLEFAKQLSKRNCFNIYICSTPINLASIKNRVDDGKDDDVRL  66

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPS  +LPPH+H++NGLP HL P L +AL+M+ PGF  +L T+ PDLV+YDF   W
Sbjct  67    VELHLPSSEELPPHFHSSNGLPSHLKPNLHRALEMAAPGFTEILKTINPDLVIYDFQPTW  126

Query  785   VPAMAAAQSIPAVLFLSPGAAA-CSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
                +A + +IPAV F +  AA  C +LF     +P E+ PFPE+Y+R+ E         P
Sbjct  127   PAQVALSLNIPAVFFATTAAANFCLFLFFC--KNPDEDSPFPEIYVRNSE--------NP  176

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSN-LVKKRCVPVGPLV---  441
             P +    V     +  C + S+ ++L+K+ R++EGKYID LS+ L  K+ +PVGPLV   
Sbjct  177   PTERSHPV--IRNMVLCFERSTDLVLVKSCREVEGKYIDHLSSVLATKKVIPVGPLVEED  234

Query  440   --RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
                ++  D +  EI +WLD K   S VFV FGSE +L  E++ E+A  LE SK NF+W +
Sbjct  235   PTEAVEDDKKINEIIKWLDKKNESSVVFVCFGSENYLFGEQVTEMANALESSKCNFIWAV  294

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             R P  E  +K  +    LP+G++ERVG  G V+EGWAPQ MIL HSS GGF+SHCGW+S+
Sbjct  295   RSPKGE--QKGSSSLQLLPQGFVERVGDMGLVIEGWAPQKMILRHSSTGGFLSHCGWNSM  352

Query  86    MEALKFGVPIIAMPMQLDQPLNARVVAA  3
              E++K+GVPII MP+  DQP NAR+  A
Sbjct  353   NESIKYGVPIIGMPITGDQPSNARIAVA  380



>ref|XP_006354527.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 254/388 (65%), Gaps = 14/388 (4%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKK---RVSEKDA  981
             T   S  +L+FPWL  GH+ PFL LA+ L+K NF+IY  STP+ L SIK+   + S    
Sbjct  4     TKGNSPSILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKEILDKNSTSYN  63

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             +SI+LVE  LP L +LPPHYHTTN LPPHL  TL +A  M+   F ++++TLKP+L++YD
Sbjct  64    LSIQLVEFHLPYLHELPPHYHTTNDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYD  123

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH--VGRGHPAEEYPFPELYLRDHEFIRN  627
               QPWV  MA++ +I A++F     +  +YL+H  +         PF  LYL D+E    
Sbjct  124   GFQPWVATMASSCNIHAIMFYVSSTSGLAYLYHQFLHGTSNLTSLPFSSLYLHDYEI---  180

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             K+L   P +   + +    +    + S +I+L+ T R++EGKYID +S + KK  +P+GP
Sbjct  181   KKLDIKPIKPRDEQAFAYVVLKSFEHSHNIVLLNTCREIEGKYIDYVSTIGKKELIPIGP  240

Query  446   LVRSL-VADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
             L+R + + + EN   I+ WLD K R S V+VSFGSE FL+++E+EE+A GLELSKV+F+W
Sbjct  241   LIREVTIGEEENWGTIQSWLDKKDRLSCVYVSFGSEVFLSKQEIEEIAKGLELSKVSFIW  300

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
              I+F           I   +P+G+LE    +G V+EGW PQ  IL HSSIGGFV+HCGW+
Sbjct  301   TIKFSKG----LNTTIEKMVPQGFLESTKGKGMVIEGWVPQSQILNHSSIGGFVTHCGWN  356

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVV  9
             S++E++ FG+PIIAMPM  DQPLN+R+V
Sbjct  357   SMLESMSFGIPIIAMPMNHDQPLNSRLV  384



>ref|XP_009775012.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=470

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 259/393 (66%), Gaps = 13/393 (3%)
 Frame = -3

Query  1172  VLHAYMDTSQRS--IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKR  999
             VL +   T +R+  ++VLMFPWLA+GHI PFL LA+ L  + F I +CSTP++L SI K 
Sbjct  11    VLTSTNVTERRNTNLKVLMFPWLAYGHISPFLNLAKKLADKGFLIRVCSTPISLESIGKE  70

Query  998   VSEKDAISIKLVELQLPSLPDL-PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLK  822
             + EK + SIK+VEL LP LP L  PH HTTN LPP+L   ++KAL  SKP F  +L+ LK
Sbjct  71    IPEKYSASIKIVELHLPKLPQLLAPHCHTTNDLPPNLDHIVQKALKFSKPNFSKILENLK  130

Query  821   PDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDH  642
             PDLV+YD L  W   +A   +IP++ F++ GAA  SY F+  R  P  E+PFP++Y ++ 
Sbjct  131   PDLVIYDILLQWAEVVANEHNIPSIKFITCGAAIFSYFFNSLR-KPEVEFPFPDIYPKES  189

Query  641   EFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRC  462
             E ++   +     +      D + +D    GS   +L+ T R +E KYID LS L   + 
Sbjct  190   ELVKWGEMSAKFAK----EKDPDDVDPFAKGSMQFMLMSTSRIIEAKYIDYLSELSNWKV  245

Query  461   VPVG-PLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             +PVG P+   +  D ++ E+  WL+ K   STVFV+FGSE+ LT+E+MEE+A GLE S V
Sbjct  246   IPVGLPIKDPMTNDADDVELIHWLEKKDENSTVFVNFGSEHLLTKEDMEEIAFGLEFSNV  305

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NF+WV+RF   E     + + + LP+G+LER+G+RGKV++ W  +  IL H+SIGGF+S+
Sbjct  306   NFIWVVRFSKGEE----QNLEEVLPQGFLERIGERGKVLDKWEQKSRILNHTSIGGFISY  361

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             C WSSV++ L FGVP+IAMP+ LDQP+N R++ 
Sbjct  362   CDWSSVIKCLDFGVPMIAMPIYLDQPMNTRLMV  394



>ref|XP_011090908.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=457

 Score =   330 bits (846),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 250/390 (64%), Gaps = 12/390 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSIKKRVSEKDA  981
             M T   S  +LMFPWLAHGHI P+L LA+A+ KR N  IY CSTP+N  SIK  + +K+ 
Sbjct  1     MGTENTSFSILMFPWLAHGHIFPYLELAKAILKRKNLRIYFCSTPINFGSIKNFI-DKNL  59

Query  980   I--SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
             +  SI+LV+L L   P+LPPHYHTT  LPP L   L KA   S   F  ++ TL+PDLV+
Sbjct  60    LNNSIELVQLHLEPFPELPPHYHTTKNLPPDLNFALLKAFQTSNSSFSEIISTLRPDLVI  119

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             YD  QPW   +A++Q  PAV F   GA   S+L H      A  +PFP ++  D+E    
Sbjct  120   YDVFQPWAAKVASSQGFPAVYFSIYGAFLFSFLHHQYTFGKAG-FPFPAIHFEDYELKSL  178

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             + LFE       DV D + + G    S  IIL KT R  EG++ID LS L  K+ VPVGP
Sbjct  179   EELFEFLYANIFDV-DQDFLFGNFKQSCDIILSKTSRGFEGEHIDYLSALCNKKIVPVGP  237

Query  446   LVRSLVADGE-NPEIKEWLDM-KPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
             L+     + E + +I +WL   K   STV +SFGSEYFL++ E+EE+  GLEL  VNF+W
Sbjct  238   LISDDNQNNEEHSDIIQWLSKNKNPHSTVLISFGSEYFLSKIEIEEIVKGLELCDVNFIW  297

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             +IRFP          + +ALP+G+ +R G+RG V+ GWAPQ  IL H + GGF+SHCGWS
Sbjct  298   IIRFPVG----VTITLEEALPKGFTDRAGERGIVITGWAPQADILAHPNTGGFMSHCGWS  353

Query  92    SVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             S+ME++ +GVP+IAMPM+LDQP+NAR+++A
Sbjct  354   SIMESMYYGVPVIAMPMKLDQPINARMLSA  383



>gb|EYU43902.1| hypothetical protein MIMGU_mgv1a020418mg [Erythranthe guttata]
Length=464

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 251/386 (65%), Gaps = 12/386 (3%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRVSEKDAIS  975
               ++   +LMFPWLAHGHI PFL LA+ L+K RNF I +CSTPVNL SIK  + E D  S
Sbjct  4     NQEKKFTILMFPWLAHGHINPFLELAKRLSKTRNFNINLCSTPVNLDSIKTNI-ENDDGS  62

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I LV+L +PS P LPP  HTT  LP  L+PTL  A   S   F +++D+++PDL++YDF 
Sbjct  63    ITLVKLHMPSSPQLPPQLHTTKNLPSDLLPTLMHAFQDSSSSFSDIMDSVEPDLLIYDFF  122

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLF  615
             QPW P +A+++ IP V F + GAA CSY  H+        +P+  L + D E ++ +   
Sbjct  123   QPWAPKLASSKGIPCVYFSTSGAAPCSYYHHIYSTGTGSTFPYKALCIPDEEIVKLRNKI  182

Query  614   EPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL---  444
              P   I    ++ +   G    SS I+L+K+ R++E KYID LS L KK+ VP GPL   
Sbjct  183   AP--NIKDANNNKDFAFGNFSMSSEIVLVKSCREIEEKYIDYLSFLCKKKIVPTGPLHAC  240

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               S   D ++ EI +WL  K R ST+++SFGSE FL++E++ E+A GL+L  V+F+WV+R
Sbjct  241   NNSECNDDDDDEIMKWLGGKSRGSTIYISFGSEIFLSKEQIAEIAKGLQLCCVSFIWVVR  300

Query  263   FPAAEAGEKARAIGD--ALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
              P    G K  +I D    P G+LE   +RG +V  WAPQG IL H SIGGFVSHCGWSS
Sbjct  301   SP---VGAKETSIEDEGEWPVGFLETAKERGILVNKWAPQGKILRHPSIGGFVSHCGWSS  357

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
             VME+L +GVPIIAMPM+ +QP+NA++
Sbjct  358   VMESLYYGVPIIAMPMRAEQPINAQL  383



>emb|CDP05516.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/381 (47%), Positives = 241/381 (63%), Gaps = 41/381 (11%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS---IKLV  963
             R+LMFPWLAHGHI PF+ L++ L K NF +Y+CST +NL+ +K+     +  S   I+ V
Sbjct  14    RILMFPWLAHGHISPFMELSKRLAKSNFQVYLCSTEINLNFMKRSAKFDENSSDHAIEFV  73

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             +L LP LP+LPPHYHTT  +PPHL PTLK+A  M+K  F N+L+ LKPDL+VYD  QPW 
Sbjct  74    QLDLPDLPELPPHYHTTKNIPPHLEPTLKRAFHMAKTNFQNILNNLKPDLLVYDGFQPWA  133

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
               +AA   IP+VLFL  GA   S+                             ++    +
Sbjct  134   SELAALNHIPSVLFLVVGAVNLSF-----------------------------KILAKLQ  164

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVAD  423
             +      D   +   ++ SS I+L+K++R +EGKYID LS+   K+ V VGPL      +
Sbjct  165   ESKAKEGDALDVFKSIELSSDIVLVKSWRGIEGKYIDHLSSSCGKKLVAVGPLSNQ-EDN  223

Query  422   GENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
             G+  +    I E+L+ K   S V+VSFGSEYFL++EE EE+A+GLELS  NF+WV+RFP 
Sbjct  224   GKEADSYSLIIEFLNSKDEASVVYVSFGSEYFLSKEEREEIAVGLELSNANFIWVVRFPV  283

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
               A      + +ALPEG+LERV  RG VV GWAPQ  IL H S GGFVSHCGW SV+E++
Sbjct  284   GHA----IGLEEALPEGFLERVKGRGMVVNGWAPQAKILGHRSTGGFVSHCGWGSVIESI  339

Query  74    KFGVPIIAMPMQLDQPLNARV  12
              +GVP++A+PM LDQPL+AR+
Sbjct  340   YYGVPLLALPMHLDQPLHARL  360



>ref|XP_006851566.1| hypothetical protein AMTR_s00040p00192700 [Amborella trichopoda]
 gb|ERN13147.1| hypothetical protein AMTR_s00040p00192700 [Amborella trichopoda]
Length=452

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 245/377 (65%), Gaps = 8/377 (2%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVEL  957
             + VLMFPWLAHGHI PF  LA+ L +R   + ICST  NL+SIK ++ E  + SIK  E+
Sbjct  7     LHVLMFPWLAHGHITPFFELAKKLVEREITVTICSTASNLTSIKDQLRETHS-SIKTAEI  65

Query  956   QLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
              LP +  L PH+ TT  LPPHLMP LK+A  +S+  F +LL +LKP+ +++DF+QPW P 
Sbjct  66    SLPQVAGLSPHHQTTKDLPPHLMPHLKRAFHLSQNQFKDLLRSLKPNFLLHDFIQPWAPE  125

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQI  597
              A    IP+ +FL+   +  S+L+H+  G    E+PF  + L  HE  R + + E  +Q 
Sbjct  126   AALELKIPSSVFLTFSVSCSSFLYHLVLGKKPNEFPFETMELHPHESQRIQPMLE--QQT  183

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGE  417
              G + D ER   C++ S+  +  ++   +EGK+I+ LS L  KR +PVGPLV S      
Sbjct  184   FG-MRDLERYKSCVEQSTDFLTCRSMHDIEGKFINYLSALAGKRVIPVGPLVSSRTPATT  242

Query  416   NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEK  237
             +   ++WLD +P  S VF SFGSEYF++E+E++E+ALGLELS + F+WVIR    E    
Sbjct  243   DEFFRQWLDARPEKSVVFTSFGSEYFMSEDEIKEIALGLELSNLPFIWVIRVSPNEV---  299

Query  236   ARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPI  57
              + I + LP G++ERV +RG VV GWAPQG IL H +IGGF++HCGW S ME+L    P+
Sbjct  300   IKEINEVLPLGFIERVKERGLVV-GWAPQGEILRHVAIGGFLTHCGWGSCMESLGLESPL  358

Query  56    IAMPMQLDQPLNARVVA  6
             I +P+QLDQP N+RV+ 
Sbjct  359   ITLPLQLDQPFNSRVMT  375



>ref|XP_006342776.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=454

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 257/392 (66%), Gaps = 16/392 (4%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVS  993
             +    DT+  +++VLM PWLAHGH+ P+L LA+ L+K N F+IY CSTP+ L+SI +   
Sbjct  1     MEEIQDTNPTTLKVLMVPWLAHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENL  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
              K+   I+L+E  LPS P LP H HTTNGLP +L+ TL +    +   F  +LD+L PDL
Sbjct  61    PKN---IQLIEFPLPSSPQLPSHQHTTNGLPKNLLSTLIQTFGEAGSTFAKILDSLSPDL  117

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             +++D  QPW P +A+++ IPA+ FL  G+A+ S+ +H        ++PF  ++L+D E  
Sbjct  118   LIFDGFQPWAPELASSRKIPAIDFLIIGSASVSFFYHHYLYAGKRDFPFSGIFLKDFE--  175

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
                +  +   +++  +      +G L+ S  IILI T  ++EGKY+D LS L  K+ VPV
Sbjct  176   --AKQLQLTAEMNISIGPNVAFNG-LEKSHEIILINTCNEIEGKYVDYLSTLSNKKVVPV  232

Query  452   GPLVRSLVADGEN---PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             GPL+R +    EN    +I +WLD K   S V+VSFGSEYFL++EE+EE+A  LELS++N
Sbjct  233   GPLIREMETTTENEENSKIIQWLDKKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELN  292

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP  E       I +ALP+G+L+RV  +G +VE WAPQ  ILEH S+GGF+ HC
Sbjct  293   FIWVLRFPLGEETN----IENALPKGFLDRVEGKGVIVEKWAPQARILEHPSVGGFLCHC  348

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             GW+S++E+L FGVP+I MPM  DQ  ++R+  
Sbjct  349   GWNSILESLHFGVPLITMPMHFDQHTHSRMTV  380



>gb|EPS70317.1| hypothetical protein M569_04444, partial [Genlisea aurea]
Length=361

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 246/373 (66%), Gaps = 15/373 (4%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             VL FPWLAHGH+ PF  LA+ L+++NF  Y+CSTP+NL SI+   +  D+ +I+LVEL +
Sbjct  1     VLFFPWLAHGHLSPFYELAKRLSEKNFKTYVCSTPINLMSIQ---ASPDS-AIELVELHM  56

Query  950   PSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMA  771
             P  P+LPP +HT+   PP+L  TL     + K  FL++L ++KPDL++YDFLQPW    A
Sbjct  57    PPSPELPPEFHTSRNAPPNLGQTLMHEFQLCKSNFLDILKSIKPDLLIYDFLQPWSAKQA  116

Query  770   AAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDG  591
             ++  IP+V F +   A  SY  H+     A++YPF +LY+  HE    K +      I  
Sbjct  117   SSMGIPSVFFATSSTACYSYYHHLYSNGFAKKYPFEDLYVHHHE----KIVVRGYGNIIE  172

Query  590   DVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV-RSLVADG--  420
             DV D   + G  + S+ I+L+KT+ + E KY+  LS L  K+ V  GPL+  S+  DG  
Sbjct  173   DVGDG-FLFGSFNLSTEIVLVKTYGKFEAKYVSHLSALSNKKLVVTGPLIAESVDLDGIE  231

Query  419   ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGE  240
             ++ EI  WL+ + + S V++SFGSEYF ++E++ E++  LELS+V FLWVIRF   +AG+
Sbjct  232   KSNEIMNWLNDQRKFSVVYISFGSEYFPSKEQIYEISKALELSRVKFLWVIRF---DAGK  288

Query  239   KARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVP  60
             K  ++ D LP+G+++R    G +V  WAPQ  IL H SIG F+SHCGWSSVME+L FGVP
Sbjct  289   KETSLKDVLPKGFMDRSKDDGMIVTEWAPQKKILSHPSIGAFISHCGWSSVMESLYFGVP  348

Query  59    IIAMPMQLDQPLN  21
             IIAMP+ +DQP+N
Sbjct  349   IIAMPIHIDQPIN  361



>ref|XP_011071476.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=460

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 253/390 (65%), Gaps = 10/390 (3%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVSEKD-  984
             MD+   + R+LMFPWLAHGHI P+L L++ L  ++NF+IY+CSTP+N +SI   +   + 
Sbjct  1     MDSETTNFRILMFPWLAHGHIFPYLELSKRLLIRKNFHIYLCSTPINFTSINAFIHNNNL  60

Query  983   AISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
             + SI +V L L    +LPPHYHTT  LP  L+ TL KA   +K  F +++ TLKPDLV++
Sbjct  61    SESIHVVPLHLQPSHELPPHYHTTKNLPSDLVFTLIKAFQTAKSSFSDIITTLKPDLVIF  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLF-HVGRGHPAEEYPFPELYLRDHEFIRN  627
             D  QPW   +A++Q +PAV F   GAA  SY + H  R HP+ ++PFPEL LRD    + 
Sbjct  121   DLFQPWAARLASSQGVPAVHFAPLGAATRSYTYHHCLRRHPSGDFPFPELCLRDDRVKKG  180

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
                F      +    D + +      S+ I L+KT R LEGKYID +S +  ++ + VGP
Sbjct  181   LDGFFQFLYYNVFEEDEDVMLVNYRLSTDIALLKTSRALEGKYIDYVSAVSDRKLLSVGP  240

Query  446   LVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNF  279
             LV  +  D E  E    I EWL  K + STV++SFGSEYFL+++E+EE+A GLEL   NF
Sbjct  241   LVADVNKDEEEEEKYSDIMEWLSKKKQHSTVYISFGSEYFLSKQEIEEIAKGLELCDANF  300

Query  278   LWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCG  99
             +WVIRFP    GEK  ++ DALP+G+LERV +RG VV GWAPQ  IL H S   FVSHCG
Sbjct  301   IWVIRFP---LGEKEISVEDALPKGFLERVKERGIVVLGWAPQARILVHHSTATFVSHCG  357

Query  98    WSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             WSS+ E++ FGVP+I MP++ +  ++ R++
Sbjct  358   WSSLNESVYFGVPVIGMPVKQNMFIDCRML  387



>emb|CDP11999.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 248/386 (64%), Gaps = 20/386 (5%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS---IKLVELQ  954
             MFPWLAHGH+ PFL L++ L + NF +Y CST VNLS IKK  +  +  S   I+LV+L 
Sbjct  1     MFPWLAHGHMSPFLELSKRLAQNNFQVYFCSTEVNLSFIKKDRNLDEYFSDHSIELVQLD  60

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LP  P+LPPHYHTT  LPPHL PTL  A  M K  F ++LDTLKPDL++YD  QPW   +
Sbjct  61    LPHFPELPPHYHTTKNLPPHLNPTLHVAFYMGKTNFQSILDTLKPDLLIYDIFQPWASKL  120

Query  773   AAAQSIPAVLFLSPGAA--ACSYLFH-VGRGHPAEE--YPFPELYLRDHEFIRNKRLFEP  609
             A+   IP VLF++ GA   + SY +  + +G+   +  YPFP + L+D+E I+N      
Sbjct  121   ASLIHIPYVLFMAVGAVYWSWSYFYDAINKGYSGIDGTYPFPAIVLKDYE-IKNSAAILQ  179

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
               + +             + SS I+L+KT+R++EGKYID LS+   K+ V VGPL     
Sbjct  180   EFKKNASEEVLLSTTKSFEVSSDIVLLKTWREIEGKYIDHLSSCCGKKIVAVGPLAELKH  239

Query  428   ADG-------ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
              D         +  + ++L+ +   S V+VSFGSE FL+EEE EE+A GLELS  +F+WV
Sbjct  240   DDTKKEEEEENSSHLIKFLNDRSESSVVYVSFGSECFLSEEESEEMAYGLELSNADFIWV  299

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP       A A+ +ALPEG+LERV  RG VV+GWAPQ  ILEH S GGFVSHCGW S
Sbjct  300   VRFPVGH----AIALEEALPEGFLERVKTRGVVVDGWAPQAKILEHPSTGGFVSHCGWGS  355

Query  89    VMEALKFGVPIIAMPMQLDQPLNARV  12
              ME++ +GVP++A+PM  DQP +AR+
Sbjct  356   FMESIYYGVPLLALPMLYDQPHHARL  381



>gb|EYU18696.1| hypothetical protein MIMGU_mgv1a006481mg [Erythranthe guttata]
Length=442

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 186/388 (48%), Positives = 253/388 (65%), Gaps = 31/388 (8%)
 Frame = -3

Query  1154  DTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN--FYIYICSTPVNLSSIKKRVSEKDA  981
             ++ +R+IRVLMFPWLA+GHI P+L LA+ L  +N  F IYI STP   + I K+V +  +
Sbjct  7     ESRRRTIRVLMFPWLAYGHITPYLELAKKLATKNSSFIIYIYSTPATFTCIDKKVPQNLS  66

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              SIKLV   LP+  +LP H HTT GL  HL+P L+ AL+ S   F ++L+ L PDL +YD
Sbjct  67    NSIKLVPFHLPNTLELPSHLHTTRGLASHLIPKLEDALNSSANQFSDILEKLAPDLFIYD  126

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHV--GRGHPAEEYPFPELYLRDHEFIRN  627
               Q W   +A  ++I AV F++ GA +  +L+H+   RG    E+PFP +Y    E   +
Sbjct  127   CFQSWAALLARDRNIRAVEFMTSGATSVGHLYHLLLRRG---TEFPFPNIYQNGVE--DD  181

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDG---SSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
             KR  E        +S  E+ +  L+G   S+ I+LIK  R++EGKYID LS+L+ K+ VP
Sbjct  182   KRFVEI-------ISSVEKTNAMLEGARVSNKIVLIKGCREIEGKYIDYLSSLMGKKFVP  234

Query  455   VGPLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFL  276
             VGPLV   V +    E K         STVFVSFGSE F+T+E++ EVA GLELSK NF+
Sbjct  235   VGPLV---VLESSKREKK---------STVFVSFGSECFITKEDIHEVAYGLELSKCNFI  282

Query  275   WVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGW  96
             WV+R P         +I + LP G+L+R   RG+V+EGWAPQ  IL H+S+GGFVSHCGW
Sbjct  283   WVLRLPKGGDNTNISSIEEMLPIGFLDRANGRGRVLEGWAPQTKILGHASVGGFVSHCGW  342

Query  95    SSVMEALKFGVPIIAMPMQLDQPLNARV  12
             +S+ME++ FGVP+IAMPM +DQP+NAR+
Sbjct  343   NSLMESMYFGVPVIAMPMHVDQPINARL  370



>gb|AGP25113.1| uridine diphosphate glycosyltransferase [Bupleurum chinense]
Length=444

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 179/382 (47%), Positives = 252/382 (66%), Gaps = 22/382 (6%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             R   ++M P+LA GHI P+L LA+ LTKR+F IYICSTPVNL+SIK RV + D  +I+LV
Sbjct  7     RMSTIVMVPYLAQGHISPYLELAKQLTKRSFNIYICSTPVNLASIKNRVLQND--NIQLV  64

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL L S PDLPP YH+TNGLP HLMP L+ AL+ + P F+++L  + P+LV+YDF+  W 
Sbjct  65    ELHLQSSPDLPPQYHSTNGLPSHLMPVLRDALEKAAPNFVSILKDINPNLVIYDFMPSWP  124

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
               +A + +IPAV F    AA      H  +    E++PFPE+++   +        +PP 
Sbjct  125   AEVAMSLNIPAVYFTVNAAATSCIGLHPYK-RAGEKFPFPEIFVPSVD--------QPP-  174

Query  602   QIDGDVSDTER-IDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR--SL  432
              +  DV    R    C + S + +L+K+ R++EGKYID LS+L +K  +P GPLV   + 
Sbjct  175   -VSADVLRILRNFLLCFERSCNFVLVKSCREVEGKYIDHLSDLAEKNMIPTGPLVHDPTE  233

Query  431   VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAA  252
               D    +I +WLD K + S VFV FGSE +L+ EE+ E+A  LE +K NF+W +R  + 
Sbjct  234   NEDDNMKDIMKWLDKKKKYSVVFVCFGSENYLSAEEVIEMANALETTKCNFIWALR--SI  291

Query  251   EAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALK  72
             +  E+  A+   LP+G++ERVG  G ++  WAPQ MIL H S GGF+SHCGW S++E++K
Sbjct  292   QGEEEGSAL---LPDGFVERVGDLGLIL-SWAPQTMILRHPSTGGFLSHCGWGSMIESMK  347

Query  71    FGVPIIAMPMQLDQPLNARVVA  6
             +GVPIIAMPM++DQP+NAR+  
Sbjct  348   YGVPIIAMPMKVDQPMNARLAT  369



>gb|EPS60299.1| hypothetical protein M569_14508, partial [Genlisea aurea]
Length=362

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 252/375 (67%), Gaps = 15/375 (4%)
 Frame = -3

Query  1127  LMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLP  948
             LMFPWLAHGH+ PF+ LA+ L++R+F IYICS+PVNL+S +  + E +A  I+L+EL++P
Sbjct  1     LMFPWLAHGHMYPFVELAKRLSRRDFRIYICSSPVNLTSFRS-LPESNA-GIELIELKIP  58

Query  947   SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAA  768
             S  +LPP  HTT  LP HL+PTL +    S   F  +L  LKPDL++YD  QPW   +A+
Sbjct  59    S-DELPPELHTTKNLPSHLVPTLMRIFQDSDSSFSEILSDLKPDLLIYDGFQPWAAKLAS  117

Query  767   AQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGD  588
              + IPAV F   G+++ +Y  H+     +  YPFP +++     I  K    PP  I G 
Sbjct  118   EKGIPAVFFSIAGSSSITYFHHLYTHGDSTGYPFPAIFMPSSAAITTKL---PP--IKG-  171

Query  587   VSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGEN--  414
              ++   + G  + S+ I+L+ ++R+LE KY+D LS L+KK+ VP GPL+ +   D +N  
Sbjct  172   -AEEGFLFGVYNISTDIVLVNSYRELEAKYLDYLSVLIKKKVVPTGPLISATNVDDDNIQ  230

Query  413   PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKA  234
              ++ EWL  KP+ ST++VSFGSEY L ++++ E+A GLEL+ VNF+WV+RF + E   K 
Sbjct  231   SDVMEWLQQKPQFSTLYVSFGSEYILPKDQLHELAQGLELAGVNFIWVLRFSSLE---KE  287

Query  233   RAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPII  54
             ++  +ALPEG++ R   RG ++  WAPQ  IL H S+GGFVSHCGW+S+ E + FGVPII
Sbjct  288   KSPEEALPEGFIGRTKDRGWIITDWAPQSRILAHRSVGGFVSHCGWNSLTEGVYFGVPII  347

Query  53    AMPMQLDQPLNARVV  9
             AMPM  +QPL+A+++
Sbjct  348   AMPMSYEQPLSAKML  362



>gb|KDO39400.1| hypothetical protein CISIN_1g038300mg, partial [Citrus sinensis]
Length=401

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 247/358 (69%), Gaps = 37/358 (10%)
 Frame = -3

Query  1055  NFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLK  876
             NF+I  CSTP  L+SIK+   +K ++SI+L+EL LPSLP+LPP YHTT GLPPHLMPTLK
Sbjct  3     NFHICFCSTPSILNSIKQL--DKFSLSIQLIELHLPSLPELPPQYHTTKGLPPHLMPTLK  60

Query  875   KALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVG  696
             +A DM+ P F N+L  L PDL++YD +QPW PA+A++ +IPAV FL   AA  +++FH  
Sbjct  61    EAFDMASPSFFNILKNLSPDLLIYDLIQPWAPALASSLNIPAVYFLVSSAATSAFMFHAI  120

Query  695   RGHP-------AEEYPFPELYLRDHEFIRN--KRLFEPPEQIDGDVSDTERIDGCLDGSS  543
             + +         EE+P   +++ D+ ++++    + E P         T+R+  C + S 
Sbjct  121   KKNSLGDANDDDEEFPSSSIFIHDY-YMKSYFSNMVESP--------TTKRLLQCFERSC  171

Query  542   SIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIKEWLDMKPRCSTVF  363
             +I+LIK+FR+LEGKYID LS+L+KK+ VPVGPLV+  V         E  D +   + + 
Sbjct  172   NIVLIKSFRELEGKYIDYLSDLIKKKVVPVGPLVQDPV---------EQTDHEKGATEII  222

Query  362   VSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGK  183
                  EYFL++EEME++ALGLELS VNF+WV+RFP    G K + + + LPE +LER  +
Sbjct  223   ----HEYFLSKEEMEDIALGLELSGVNFIWVVRFP---CGAKVK-VDEELPESFLERTKE  274

Query  182   RGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             R  V+EGWAPQ  IL H SIGGFVSHCGWSSVME+++ GVPIIAMPM +DQPLNAR+V
Sbjct  275   RAMVIEGWAPQMKILGHPSIGGFVSHCGWSSVMESMRLGVPIIAMPMHVDQPLNARLV  332



>gb|ADW20351.1| putative branch-forming glycosyltransferase [Citrus sinensis]
Length=452

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/381 (46%), Positives = 251/381 (66%), Gaps = 17/381 (4%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             +LM PWLAHGHI P+L LA+ L+++NF+IY CSTP+NL S+ + + EK + SI+L++LQL
Sbjct  12    ILMLPWLAHGHITPYLALAKKLSQQNFHIYFCSTPINLQSMSQNLQEKFSTSIQLIDLQL  71

Query  950   P-SLPDL-PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
             P + P+L  P+ HTT  +P HL+PTL +A D +KP F N+L+TLKP LV+YD  QPW   
Sbjct  72    PCTFPELHDPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLETLKPTLVIYDLFQPWAAE  131

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQI  597
              A    I AV F++  AA+ S+       + + ++PFPE  L + E    +++ +   +I
Sbjct  132   AAYQHDIAAVAFVTIAAASFSFFLQ----NSSLKFPFPEFDLPESEI---QKMTQFKHRI  184

Query  596   DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGE  417
                  + +R    +D S  ++L+KT R++E K +  LS + KK  +PVGPLV+  +    
Sbjct  185   VNGTENRDRFLKAIDLSCKLVLVKTSREIESKDLHYLSYITKKETIPVGPLVQEPIYTDN  244

Query  416   NPEIK--EWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
             N + K  +WL  K   S V+VSFGSEYFL++EEM E+A GL LS+V+F+WV+RF +    
Sbjct  245   NNDTKIMDWLSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLLSEVSFIWVVRFHS----  300

Query  242   EKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
             E    I +ALP+G+ E +    +G VV+GWAPQ  IL H SIGGF+SHCGW S +E + +
Sbjct  301   EGNFTIEEALPQGFAEEIQGNNKGMVVQGWAPQAKILGHGSIGGFISHCGWGSTVEGIMY  360

Query  68    GVPIIAMPMQLDQPLNARVVA  6
             GVPIIA+PM LDQ  NA++VA
Sbjct  361   GVPIIAVPMVLDQLFNAKMVA  381



>gb|AGO03779.1| non-smoky glycosyltransferase 2 [Solanum lycopersicum]
Length=449

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 172/384 (45%), Positives = 253/384 (66%), Gaps = 14/384 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA---IS  975
             + S  +L+FPWL  GH+ PFL LA+ L+K NF+IY  STP+ L SIK+ + +       S
Sbjct  6     ENSPSILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKETLDKNSTNYNQS  65

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I+LVE  LP L +LPPHYHTT  LPPHL  TL +A  M+   F ++++TLKP+L++YD  
Sbjct  66    IQLVEFHLPYLHELPPHYHTTKDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYDGF  125

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLF  615
             QPWV  MA++ +I A++F     +  +YL+H      +    FP  +L D+E    K+L 
Sbjct  126   QPWVATMASSYNIHAIMFYVSSTSGLAYLYHQFLYGSSSLTSFP--FLHDYEI---KKLD  180

Query  614   EPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-  438
               P +   + +    +    + S +I+L+ T R++EGKYID +S + KK  + +GPL+R 
Sbjct  181   MKPIKPRDEKAFGYVVLKSFEKSHNIVLLNTCREIEGKYIDYVSTIGKKELIQIGPLIRE  240

Query  437   SLVADGEN-PEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
             + + + EN   I+ WLD K   S V+VSFGSE+F++++E+EE+A GLELSKV+F+W I+F
Sbjct  241   ATLGEEENLGTIQSWLDNKDHISCVYVSFGSEFFMSKQEIEEIAKGLELSKVSFIWTIKF  300

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P          I + +P+G+LE    +G V+EGW PQ +IL HSSIGGFV+HCGW+S++E
Sbjct  301   PKG----VNTTIEEMVPQGFLESTKGKGMVIEGWVPQSLILNHSSIGGFVTHCGWNSMLE  356

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++ FG+P+IAMPM  DQPLN+R+V
Sbjct  357   SMSFGIPLIAMPMNHDQPLNSRLV  380



>ref|XP_006424313.1| hypothetical protein CICLE_v10030271mg [Citrus clementina]
 gb|ESR37553.1| hypothetical protein CICLE_v10030271mg [Citrus clementina]
Length=453

 Score =   323 bits (827),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 249/386 (65%), Gaps = 17/386 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
              R   +LM PWLAHGHI P+L LA+ L+++NF+IY CST +NL SI + + E  + SI+L
Sbjct  7     NRKPSILMLPWLAHGHITPYLALAKKLSQQNFHIYFCSTSINLQSISQNLGENFSASIQL  66

Query  965   VELQLP-SLPDL-PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              +LQLP + P+L  P+ HTT  +P  L+PTL  A D +KP F N+L+TLKP LV+YD  Q
Sbjct  67    TDLQLPCTFPELHDPYNHTTKNIPRCLIPTLIAAFDAAKPAFCNVLETLKPTLVIYDLFQ  126

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
             PW    A    I AV FL+  AA+ S+  H    + + ++PFPE  L + E    +++ +
Sbjct  127   PWAAEAAYQHDIAAVAFLTTAAASFSFFLH----NSSLKFPFPEFDLPESEI---QKMTQ  179

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL  432
                +I     + +R    +D S  ++LIKT R++E KY+D  S + KK  +PVGPLV+  
Sbjct  180   FKHRIVNGTENKDRFLKAIDLSCKLVLIKTSREIESKYLDYFSYITKKETIPVGPLVQEP  239

Query  431   VADGENPEIK--EWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
             V    N + K  +WL  K   S V+VSFGSEYFL++EEM E+A GL LS+V+F+WV+RF 
Sbjct  240   VYTDNNDDTKIMDWLSRKEPSSVVYVSFGSEYFLSQEEMNEIASGLLLSEVSFIWVVRFH  299

Query  257   AAEAGEKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
             +    E   +I +ALP+ + + +    +G VV+GWAPQ  IL H SIGGFVSHCGW S +
Sbjct  300   S----EGKFSIEEALPQSFSKEIHGNNKGMVVQGWAPQAKILGHGSIGGFVSHCGWGSTV  355

Query  83    EALKFGVPIIAMPMQLDQPLNARVVA  6
             E + +GVPIIA+PM LDQ  NA++VA
Sbjct  356   EGIMYGVPIIAVPMVLDQLFNAKMVA  381



>ref|XP_008449848.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis melo]
Length=455

 Score =   323 bits (827),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 177/380 (47%), Positives = 242/380 (64%), Gaps = 13/380 (3%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDAISIKLVELQ  954
             +LM PW+ +GH+  +L LA+ L+KRN F IY CSTPVNL SIK++V    + SI+ VEL 
Sbjct  13    ILMLPWIGYGHLSAYLELAKVLSKRNNFLIYFCSTPVNLDSIKRKVVPSSS-SIQFVELH  71

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LPS P+ PPH HTTN LPP L PTL KA   +   F  +L TL P L++YD LQPW P +
Sbjct  72    LPSSPEFPPHLHTTNALPPRLTPTLHKAFAAAASPFEEILQTLCPHLLIYDSLQPWAPQI  131

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A++ +IPA+ F +  A+   +  H    +P  ++P  +  L  H + + K     P   +
Sbjct  132   ASSLNIPAINFNTTAASIICHALH-NINYPDTKFPLSDWVL--HNYWKGKYTTADPTNSE  188

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV-----RSLV  429
                   E    CL  S  + LI + R++EG+Y+D LS L+KK+ + VGPL          
Sbjct  189   RIRRVRESFLYCLSASHDVSLINSCREIEGEYMDYLSVLLKKKVIAVGPLAYEPREDEDE  248

Query  428   ADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAE  249
              D +   IK WLD K   STV VSFGSEYF +++EME++  GLE S  NF+WVIRFP   
Sbjct  249   EDEDYSRIKNWLDKKEVSSTVLVSFGSEYFPSKQEMEDIGNGLEESGANFIWVIRFPK--  306

Query  248   AGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKF  69
              GE+ R + +ALPEG++E+ G+R  +++ WAPQG IL+H SIGGFVSHCGW+SVME++  
Sbjct  307   -GEENRRVEEALPEGFVEKAGERAMILKDWAPQGKILKHRSIGGFVSHCGWNSVMESILL  365

Query  68    GVPIIAMPMQLDQPLNARVV  9
             GVP+I +PM +DQP NA +V
Sbjct  366   GVPVIGVPMHVDQPYNAGLV  385



>dbj|BAI44133.1| flavonoid glycosyltransferase UGT94F1 [Veronica persica]
Length=452

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/379 (49%), Positives = 245/379 (65%), Gaps = 26/379 (7%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI---SI  972
             +  ++LMFPWLAHGHI PFL LA+ L+KRNF I+ CST +NL SIK  ++   ++   SI
Sbjct  7     KMFKILMFPWLAHGHIFPFLELAKTLSKRNFTIHFCSTAINLDSIKSNLANDPSVLDDSI  66

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             KL+EL++ S P+LPP  HTT  LPPH  P L K  + SK  F ++ DTLKPD+++YD   
Sbjct  67    KLLELEIES-PELPPELHTTKNLPPHQFPLLIKDFENSKSSFFSIFDTLKPDMLIYDVFN  125

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFH-----VGRGHPAEEYPFPELYLRDHEFIRN  627
             PW    A +   P+V F++ GA  CS+ +H      G   P E   F E+          
Sbjct  126   PWAAKHALSHGSPSVWFMASGATICSFHYHQHLHKTGSLVPYEGVDFGEI----------  175

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             KR   P  +   D      I G L+ SS IIL+KT ++LE KYID LS L +K+ +P G 
Sbjct  176   KRHISPNTK-GADFGGF--ILGSLNSSSEIILLKTSKELEKKYIDYLSFLCRKQIIPTGL  232

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             L+ +   + + PEI +WLD K   STV++SFGSE FL++E++EEVA GLELS VNF+W+I
Sbjct  233   LIAN-SDEKDEPEIMQWLDEKSERSTVYISFGSECFLSKEQIEEVAKGLELSNVNFIWII  291

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RFP    G+ +  + +ALPEG+LERV  RG V+  +APQ  IL H SIGGFVSHCGWSS+
Sbjct  292   RFPE---GKNSMTVENALPEGFLERVKGRGMVIWKFAPQTRILAHKSIGGFVSHCGWSSI  348

Query  86    MEALKFGVPIIAMPMQLDQ  30
              E++ FGVPIIAMPM+ +Q
Sbjct  349   TESVYFGVPIIAMPMKFEQ  367



>ref|XP_009630066.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=539

 Score =   325 bits (833),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 174/388 (45%), Positives = 259/388 (67%), Gaps = 18/388 (5%)
 Frame = -3

Query  1154  DTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDAI  978
             DT+  S++VLM PWLAHGH+ P+L LA+ L+K N F+IY CSTP+ L+SI +    K+  
Sbjct  6     DTNTTSLKVLMVPWLAHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN--  63

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              I+L+E  LPS   LP H HTTNGLP +L+ TL +    +   F  +LD+L PDL+++D 
Sbjct  64    -IQLIEFPLPSSKQLPSHNHTTNGLPKNLLSTLIQTFGEASSTFGKILDSLNPDLLIFDG  122

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPW P  A++++I A+ FL  G+A+ S+ +H         +PF  ++L+D+E  +  +L
Sbjct  123   FQPWAPEFASSRNIHAIYFLVVGSASISFFYHHYLYVGTRNFPFSGIFLKDYE-AKQLQL  181

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                   +  +V+     +G ++ S  IILI T  ++EGKY+D LS L KK+ +PVGPL+R
Sbjct  182   AAKMNSLGPNVA----FNG-VEKSHDIILINTCNEIEGKYVDYLSTLSKKKVIPVGPLIR  236

Query  437   ----SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWV  270
                 S+  +G + +I +WLD K   S V+VSFGSEYFL++EE+EE+A  LELS+++F+W+
Sbjct  237   EMKTSMENEGNDSKIIQWLDNKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELHFIWI  296

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP  E       I + L +G+L+RV ++G +VE WAPQ  ILEH+S+GGF+ HCGW+S
Sbjct  297   LRFPLGEE----INIENVLSKGFLDRVKEKGVIVEKWAPQARILEHASVGGFLCHCGWNS  352

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVVA  6
             ++E+L FGVP+I MPM LDQ  ++R+  
Sbjct  353   ILESLHFGVPLITMPMHLDQHTHSRMTV  380


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  155  PQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
            PQ  IL HSSIGGFVSHCGWSSVM+ +   VPI+AMP+Q DQ +NAR++ 
Sbjct  469  PQARILAHSSIGGFVSHCGWSSVMDRINSRVPIMAMPLQFDQCINARLMG  518



>ref|XP_011071477.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=460

 Score =   322 bits (826),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 189/399 (47%), Positives = 258/399 (65%), Gaps = 28/399 (7%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVSEKD-  984
             MD+   + R+LMFPWLAHGHI P+L L++ L  ++NF+IY+CSTP+N +SI   +   + 
Sbjct  1     MDSQTTTFRILMFPWLAHGHIFPYLELSKRLLIRKNFHIYLCSTPINFTSINAFIHNNNL  60

Query  983   AISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
             + SI++V+L L    +LPPHYHTT  LP  L+ TL KAL  +K  F +++ TLKPDLV++
Sbjct  61    SESIQVVQLHLQPSHELPPHYHTTKNLPSDLVFTLIKALQTAKSSFSDIITTLKPDLVIF  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRGHPAEEYPFPELYL-RDHE---  639
             D  QPW   +A++Q +PAV F   GAA  SY +H   R  P  ++ F EL L  DHE   
Sbjct  121   DVFQPWAARLASSQGVPAVHFAPLGAATRSYTYHHYVRRLPGGDFRFQELCLGDDHEKKS  180

Query  638   ---FIR--NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLV  474
                F +     +FE  E +   V    R+      S+ I L+KT R LEGKYID +S + 
Sbjct  181   LDGFFQFLYYNVFEEDEDV---VFVNYRL------STDIALLKTSRGLEGKYIDYVSAVC  231

Query  473   KKRCVPVGPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeeval  306
              ++ + VGPLV  +  D E  E    I EWL  K + STV++SFGSEYFL+++E+EE+A 
Sbjct  232   HRKLLSVGPLVADVNKDDEEEEKYSDIMEWLSKKKQHSTVYISFGSEYFLSKQEIEEIAK  291

Query  305   gleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             GLEL   NF+WVIRFP    GEK  ++ DALP+G+LERV +RG VV GWAPQ  IL H S
Sbjct  292   GLELCDANFIWVIRFPL---GEKEISVEDALPKGFLERVKERGIVVLGWAPQARILVHQS  348

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
                FVSHCGWSS+ E++ FGVP+I MPM+L+  ++ R++
Sbjct  349   TASFVSHCGWSSLNESVYFGVPVIGMPMKLNMFIDCRML  387



>ref|XP_004229306.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=458

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 259/390 (66%), Gaps = 16/390 (4%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVS  993
             +    DT+  +++VLM PWLAHGH+ P+L LA+ L+K N F+IY CSTP+ L+SI +   
Sbjct  1     MEKIQDTNPTTLKVLMVPWLAHGHVTPYLELAKKLSKTNLFFIYFCSTPIILNSINQENL  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
              K+   I+L+E  LPS P LP H HTTNGLP +L+ TL +    +   F  +LD+L PDL
Sbjct  61    PKN---IQLIEFPLPSSPLLPSHQHTTNGLPKNLLSTLIQTFGEAGSTFAKILDSLCPDL  117

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             +++D  QPW P +A+++ IPA+ FL  G+A+ S+ +H        ++PF  ++L+D+E  
Sbjct  118   LIFDGYQPWAPELASSRKIPAIDFLIIGSASVSFFYHHYLYAGKRDFPFSGIFLKDYEAK  177

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             + +   E    I  DV+     +G L+ S  IILI T  ++EGKY+D LS L  K+ +PV
Sbjct  178   QLQLTAEMNISIGPDVA----FNG-LEKSHDIILINTCNEIEGKYVDYLSTLSNKKVIPV  232

Query  452   GPLVRSL---VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             GPL+R +     + EN +I +WLD K   S V+VSFGSEYFL++EE+EE+   LELS++N
Sbjct  233   GPLIREMGTTTENEENSKIIQWLDKKDESSCVYVSFGSEYFLSKEEIEEIGHSLELSELN  292

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP  E       I +ALP+G+L+RV  +G +VE WAPQ  ILEH S+GGF+ HC
Sbjct  293   FIWVVRFPLGEE----TNIENALPKGFLDRVEGKGVIVEKWAPQARILEHPSVGGFLCHC  348

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
             GW+S++E+L FGVP+I MPM  DQ  ++R+
Sbjct  349   GWNSILESLHFGVPLITMPMHFDQHTHSRM  378



>ref|XP_004142254.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 187/392 (48%), Positives = 249/392 (64%), Gaps = 22/392 (6%)
 Frame = -3

Query  1157  MDTSQRSI----RVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVS  993
             MDT Q S      +LMFPWL +GH+ P+L LA+AL T++NF IY CSTPVNL SIK ++ 
Sbjct  1     MDTHQASTPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLI  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
                + SI+LVEL LPS PDLPPH HTTN LPPHL P L +A   + P F  +L TL P L
Sbjct  61    --PSPSIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHL  118

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             ++YD  QPW P +A++ +IPA+ F +  AA  S+ FH     P  ++PF +  L +H   
Sbjct  119   LIYDCFQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATH-RPGSKFPFSDFVLHNH--W  175

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             ++K    P EQI      TE    CL+ S  +ILI +F+++EG+++D +  L KK+ +PV
Sbjct  176   KSKVDSNPSEQIR---IVTESFFECLNKSRDVILINSFKEVEGEHMDYIFLLSKKKVIPV  232

Query  452   GPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             GPLV     + E  E    IK WLD K   STV  S GSE + +EEE EE+  GL  S+ 
Sbjct  233   GPLVYEPSENDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEA  292

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NF+WV R    + G++ + I        LE+ G+R  VV+GWAPQG IL+H SIGGFVSH
Sbjct  293   NFIWVERI--NKKGDEEQQIKR---RELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSH  347

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             CGW+SV+E++  GVPII +P+  DQP+NA VV
Sbjct  348   CGWNSVLESIVSGVPIIGVPVFGDQPINAGVV  379



>ref|XP_004162020.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 187/392 (48%), Positives = 248/392 (63%), Gaps = 22/392 (6%)
 Frame = -3

Query  1157  MDTSQRSI----RVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVS  993
             MDT Q S      +LMFPWL +GH+ P+L LA+AL T++NF IY CSTPVNL SIK ++ 
Sbjct  1     MDTHQASTPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLI  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
                + SI+LVEL LPS PDLPPH HTTN LPPHL P L +A   + P F  +L TL P L
Sbjct  61    --PSPSIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHL  118

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             ++YD  QPW P +A++ +IPA+ F +  AA  S+ FH     P  ++PF +  L +H   
Sbjct  119   LIYDCFQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATH-RPGSKFPFSDFVLHNH--W  175

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             ++K    P EQI      TE    CL+ S  +ILI +F+++EG+++D +  L KK+ +PV
Sbjct  176   KSKVDSNPSEQIR---IVTESFFECLNKSRDVILINSFKEVEGEHMDYIFLLSKKKVIPV  232

Query  452   GPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             GPLV     + E  E    IK WLD K   STV  S GSE + +EEE EE+  GL  S+ 
Sbjct  233   GPLVYEPSENDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEA  292

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NF+WV R    + G++ + I        LE+ G+R  VVEGWAPQG I +H SIGGFVSH
Sbjct  293   NFIWVERI--NKKGDEEQQIRR---RELLEKSGERAMVVEGWAPQGKIQKHGSIGGFVSH  347

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             CGW+SV+E++  GVPII +P+  DQP+NA VV
Sbjct  348   CGWNSVLESIVSGVPIIGVPVFGDQPINAGVV  379



>gb|KGN54053.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltransferase [Cucumis 
sativus]
Length=452

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/392 (48%), Positives = 248/392 (63%), Gaps = 22/392 (6%)
 Frame = -3

Query  1157  MDTSQRSI----RVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVS  993
             MDT Q S      +LMFPWL +GH+ P+L LA+AL T++NF IY CSTPVNL SIK ++ 
Sbjct  3     MDTHQASTPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLI  62

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
                + SI+LVEL LPS PDLPPH HTTN LPPHL P L +A   + P F  +L TL P L
Sbjct  63    --PSPSIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHL  120

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             ++YD  QPW P +A++ +IPA+ F +  AA  S+ FH     P  ++PF +  L +H   
Sbjct  121   LIYDCFQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATH-RPGSKFPFSDFVLHNH--W  177

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             ++K    P EQI      TE    CL+ S  +ILI +F+++EG+++D +  L KK+ +PV
Sbjct  178   KSKVDSNPSEQIR---IVTESFFECLNKSRDVILINSFKEVEGEHMDYIFLLSKKKVIPV  234

Query  452   GPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             GPLV     + E  E    IK WLD K   STV  S GSE + +EEE EE+  GL  S+ 
Sbjct  235   GPLVYEPSENDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEA  294

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NF+WV R    + G++ + I        LE+ G+R  VVEGWAPQG I +H SIGGFVSH
Sbjct  295   NFIWVERI--NKKGDEEQQIRR---RELLEKSGERAMVVEGWAPQGKIQKHGSIGGFVSH  349

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             CGW+SV+E++  GVPII +P+  DQP+NA VV
Sbjct  350   CGWNSVLESIVSGVPIIGVPVFGDQPINAGVV  381



>ref|XP_010321591.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/382 (46%), Positives = 251/382 (66%), Gaps = 24/382 (6%)
 Frame = -3

Query  1139  SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVE  960
             ++ VLMFP+LA+GH  PFL LA+ L+ R F I  CSTP+NLS IKK++  K + SI+LVE
Sbjct  6     NLSVLMFPYLAYGHFTPFLELAKKLSDRGFLIDFCSTPINLSYIKKKIPHKYSCSIQLVE  65

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             L L  LP+LPPHYHTT  LP HL  TL KAL M +  F  +L   KPD++V+D +QPW  
Sbjct  66    LHLQDLPELPPHYHTTKDLPFHLQTTLYKALMMEEAQFHQILKDQKPDVLVFDIMQPWSV  125

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
               A++ +IPA+ +    AA C Y  ++ +  P  E+PF  LYL+D+E        E    
Sbjct  126   RAASSLNIPAIKYCIASAATCCYFGNL-KLKPGVEFPFTALYLKDYE-------QEIKRH  177

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADG  420
             I+  V          +G  +I+L+ T R ++ KY+D LS + +   +P G +++ L  +G
Sbjct  178   IELQVE---------EGGENIMLLNTSRAIDAKYLDYLSEIGQGNILPTGVVIQDLEDEG  228

Query  419   --ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
               E  ++ +W+      STV+VSFGSE  +T+EEMEEVA GLE+S V+F+WV+R P    
Sbjct  229   DIEETQLIKWIGKNKEHSTVYVSFGSECVMTKEEMEEVAYGLEVSNVHFIWVVRIP---R  285

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
             GE+   + + LP+G+LER+G+RG++VEGW PQ  IL+H+SIG FV+HCGW+S +E+++FG
Sbjct  286   GEQVVRLEEVLPQGFLERIGERGRIVEGWVPQAKILKHASIGAFVTHCGWNSTLESIEFG  345

Query  65    VPIIAMPMQL--DQPLNARVVA  6
             VPIIA+P+    DQP+NAR+V 
Sbjct  346   VPIIALPINFCSDQPINARLVV  367



>gb|AGA84058.1| UDP-glucosyltransferase isoform 2 [Picrorhiza kurrooa]
Length=484

 Score =   321 bits (822),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 251/391 (64%), Gaps = 19/391 (5%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M++ Q    +LMFPWLAHGHI PFL LA+ L+KRNF +Y+CS P+NL SIK  +++  +I
Sbjct  1     MESEQAKFSILMFPWLAHGHIFPFLELAKRLSKRNFTVYLCSAPINLDSIKTNLAKDRSI  60

Query  977   ---SIKLVELQLPSLPDLPPHYHTTNGLPPHL---MPTLKKALDMSKPGFLNLLDTLKPD  816
                SIKL+EL+  S P LP  +HTT  +P HL   +P L +    S   F+ ++++L PD
Sbjct  61    DDDSIKLIELEFES-PQLPSEFHTTKNIPSHLSHLIPILIQDFQKSSSSFVGIVNSLNPD  119

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEF  636
             L++ D+ QPW    A ++ IPAV FL   A + ++  H      +   PF  +YL DHE 
Sbjct  120   LLILDYFQPWAFKYALSRGIPAVCFLVICATSFAFHHHEHTHGTSSPSPFKGIYLLDHER  179

Query  635   IR-NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCV  459
             +     +    +  D DV       G  + SS IIL  + + LEGKYID L+   +K  V
Sbjct  180   VDYGASMGAFIKDADLDVFAF----GTFNLSSDIILFNSSKGLEGKYIDYLTVQCEKPVV  235

Query  458   PVGPL-VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             P GPL VRS   +GEN EI +WL  K R STV+VSFGSEYFL+ EE+ EVA GLEL K N
Sbjct  236   PTGPLIVRS--NEGENSEIMKWLSGKDRFSTVYVSFGSEYFLSMEEVAEVAKGLELCKAN  293

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP    GE A ++ +ALP G+ ER  +RG VV  WAPQ  +L+H S GGFVSHC
Sbjct  294   FVWVLRFPL---GENAMSVENALPRGFTERAKERGLVVT-WAPQTSVLDHESTGGFVSHC  349

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GW+SVME+  FGVP+IAMPM+++QPL+ R++
Sbjct  350   GWNSVMESAYFGVPVIAMPMRIEQPLSGRML  380



>ref|XP_004142256.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 ref|XP_004169962.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 gb|KGN54051.1| hypothetical protein Csa_4G279800 [Cucumis sativus]
Length=452

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 242/378 (64%), Gaps = 12/378 (3%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDAISIKLVELQ  954
             +LM PW+ +GH+  +L LA+ L++RN F IY CSTPVNL SIK R+      SI+ VEL 
Sbjct  13    ILMLPWIGYGHLSAYLELAKVLSRRNNFLIYFCSTPVNLDSIKPRLIPSS--SIQFVELH  70

Query  953   LPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             LPS P+ PPH HTTN LPP L PTL KA   +   F  +L TL P L++YD LQ W P +
Sbjct  71    LPSSPEFPPHLHTTNALPPRLTPTLHKAFAAAASPFEAILQTLCPHLLIYDSLQQWAPQI  130

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A++ +IPA+ F +  A+  S+  H    +P  ++P  +  L  H + + K        ++
Sbjct  131   ASSLNIPAINFNTTAASIISHALH-NINYPDTKFPLSDWVL--HNYWKGKYTTANEATLE  187

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV---RSLVAD  423
                   E    CL  S  I LI + R++EG+Y+D LS L+KK+ + VGPLV   R    D
Sbjct  188   RIRRVRESFLYCLSASRDITLISSCREIEGEYMDYLSVLLKKKVIAVGPLVYEPREDDED  247

Query  422   GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAG  243
              +   IK WLD K   STV VSFGSE+F ++EEMEE+  GLE S  NF+WVIR P    G
Sbjct  248   EDYSRIKNWLDKKEALSTVLVSFGSEFFPSKEEMEEIGCGLEESGANFIWVIRSPK---G  304

Query  242   EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGV  63
             E+ + + +ALPEG++E+ G+R  +V+ WAPQG IL+H SIGGFVSHCGW+SVME++  GV
Sbjct  305   EENKRVEEALPEGFVEKAGERAMIVKEWAPQGKILKHRSIGGFVSHCGWNSVMESIMLGV  364

Query  62    PIIAMPMQLDQPLNARVV  9
             P+IA+PM +DQP NA +V
Sbjct  365   PVIAVPMHVDQPYNAGLV  382



>emb|CDO99875.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 192/240 (80%), Gaps = 4/240 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MDT +RS R+LM PWLAHGHI PFL LA+ALTKRNFYIY+CSTPVNLSS+K+ +SEKD+I
Sbjct  1     MDTRKRSFRILMLPWLAHGHISPFLELAKALTKRNFYIYVCSTPVNLSSLKQNLSEKDSI  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             SIKLVELQ+P+LP+LPPH+HTTNGLPP+LMPTLK+A+DM+KP F N+L TLKPD+V+YDF
Sbjct  61    SIKLVELQVPTLPELPPHHHTTNGLPPNLMPTLKEAVDMAKPSFHNILRTLKPDMVLYDF  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
             L PWVPA+A+AQ+IPAV F++ GAA  SY+ H  + +P  EYPF  +Y R++E   N +L
Sbjct  121   LLPWVPALASAQNIPAVSFIATGAATFSYVVHY-KLNPDSEYPFSSIYYREYE---NHKL  176

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
                 +     + D++R+  C++ SS +ILIKT R++EGKYID LS L KK+ VPVGP  R
Sbjct  177   TGMADATASGIKDSDRVINCVEQSSGMILIKTCREIEGKYIDYLSRLSKKKIVPVGPSFR  236



>gb|EYU45578.1| hypothetical protein MIMGU_mgv1a007199mg [Erythranthe guttata]
Length=415

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/383 (44%), Positives = 220/383 (57%), Gaps = 44/383 (11%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             MD  + S RVLMFPWLAHGHI PFL LA+ L+K NF+IY CSTPVNL S+ K +S     
Sbjct  1     MDAKEASFRVLMFPWLAHGHIFPFLELAKKLSKSNFHIYFCSTPVNLDSVTKHLSNDVVS  60

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
             +I+LVEL LPSLP LPP YHTT   PPHLMPTL  A  MS   F +++  LKPDL++YD 
Sbjct  61    NIELVELHLPSLPQLPPQYHTTKNTPPHLMPTLMHAFQMSSSSFSDIIGDLKPDLLIYDG  120

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRL  618
              QPW    A++  IP+V F +      S+  H+       ++PFP ++LRD E    + L
Sbjct  121   FQPWSAKSASSIGIPSVNFATSSCTTISFFHHLHTHKTYGDFPFPSIFLRDFE---KRNL  177

Query  617   FEPPEQIDGDVSDTERIDGCLDGSSSIILIKT-FRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                 E I+    +     G  + S  I+L+K+  R++EGKY+D  S L  K+ VPVGPL 
Sbjct  178   ISRGESIEVQDKEEGFAFGIFELSCDIVLVKSCCREIEGKYMDYFSTLCNKKIVPVGPLQ  237

Query  440   RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
                +A G                                     L L    +NF+WV+R 
Sbjct  238   MEEIAKG-------------------------------------LLLVGEAINFIWVVRS  260

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P   A E+    G  LPEG+   V  RG V++GWAPQ  IL H S+GGF+SHCGWSSV E
Sbjct  261   PGETAAEEG---GGCLPEGFSAAVEGRGLVLKGWAPQAAILAHPSVGGFMSHCGWSSVTE  317

Query  80    ALKFGVPIIAMPMQLDQPLNARV  12
             ++ FGVP++A+P++LDQP+N R+
Sbjct  318   SMYFGVPVVAVPLKLDQPVNCRM  340



>ref|XP_004142255.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 247/392 (63%), Gaps = 18/392 (5%)
 Frame = -3

Query  1169  LHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRVS  993
             + A+  ++  +  +LMFPWL +GH+ P+L L++AL T++NF IY CSTPVNL SIK ++ 
Sbjct  1     MDAHQASTPTTTTILMFPWLGYGHLSPYLELSKALSTRKNFLIYFCSTPVNLDSIKPKLI  60

Query  992   EKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDL  813
                + SI+ VEL LPS PD PPH HTTN LPPHL P L +A   + P F  +L TL P L
Sbjct  61    --PSPSIQFVELHLPSSPDFPPHLHTTNALPPHLTPALHQAFAAAAPLFETILKTLSPHL  118

Query  812   VVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFI  633
             ++YD  Q W P +A++ +IPA+ F + G +  SY FH    HP+ ++PF +  L  H   
Sbjct  119   LIYDCFQSWAPRLASSLNIPAINFSTSGTSMISYGFH-SIHHPSSKFPFSDFVL--HNPW  175

Query  632   RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPV  453
             R+K    P E      S  E    CL+ S  +ILI +F+++EG+Y+D LS L+KK+ +PV
Sbjct  176   RSKYNSTPSEHAR---SVREAFFECLNTSRDVILINSFKEVEGEYMDYLSLLLKKKVIPV  232

Query  452   GPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             GPLV     + E  E    IK WLD K   STV  S GSE + +EEE EE+  GL  S+ 
Sbjct  233   GPLVYEPSENDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEA  292

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NF+WV R    + G++ + I        LE+ G+R  VV+GWAPQG IL+H SIGGFVSH
Sbjct  293   NFIWVERI--NKKGDEEQQIKR---RELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSH  347

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             CGW+SV+E++  GVPII +P+  DQP NA VV
Sbjct  348   CGWNSVLESIVSGVPIIGVPVFGDQPFNAGVV  379



>gb|KGN54052.1| hypothetical protein Csa_4G279810 [Cucumis sativus]
Length=452

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 247/393 (63%), Gaps = 18/393 (5%)
 Frame = -3

Query  1172  VLHAYMDTSQRSIRVLMFPWLAHGHICPFLVLAQAL-TKRNFYIYICSTPVNLSSIKKRV  996
              + A+  ++  +  +LMFPWL +GH+ P+L L++AL T++NF IY CSTPVNL SIK ++
Sbjct  2     TMDAHQASTPTTTTILMFPWLGYGHLSPYLELSKALSTRKNFLIYFCSTPVNLDSIKPKL  61

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
                 + SI+ VEL LPS PD PPH HTTN LPPHL P L +A   + P F  +L TL P 
Sbjct  62    I--PSPSIQFVELHLPSSPDFPPHLHTTNALPPHLTPALHQAFAAAAPLFETILKTLSPH  119

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEF  636
             L++YD  Q W P +A++ +IPA+ F + G +  SY FH    HP+ ++PF +  L  H  
Sbjct  120   LLIYDCFQSWAPRLASSLNIPAINFSTSGTSMISYGFH-SIHHPSSKFPFSDFVL--HNP  176

Query  635   IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
              R+K    P E      S  E    CL+ S  +ILI +F+++EG+Y+D LS L+KK+ +P
Sbjct  177   WRSKYNSTPSEHAR---SVREAFFECLNTSRDVILINSFKEVEGEYMDYLSLLLKKKVIP  233

Query  455   VGPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSK  288
             VGPLV       E  E    IK WLD K   STV VS GSE + +EEE EE+  GL  S+
Sbjct  234   VGPLVYEPNEKDEEDEDYSRIKNWLDKKEALSTVLVSLGSESYASEEEKEEIVQGLVESE  293

Query  287   VNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVS  108
              NF+WV R    + G++ + I        LE+ G+R  VV+GWAPQG IL+H SIGGFVS
Sbjct  294   ANFIWVERI--NKKGDEEQQIKR---RELLEKSGERAMVVKGWAPQGKILKHGSIGGFVS  348

Query  107   HCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             HCGW+SV+E++  GVPII +P+  DQP NA VV
Sbjct  349   HCGWNSVLESIVSGVPIIGVPVFGDQPFNAGVV  381



>gb|AFJ53038.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=472

 Score =   315 bits (807),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 243/391 (62%), Gaps = 27/391 (7%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKR--NFYIYICSTPVNLSSIKKRVSEKDAI  978
             T+   IR+LMFPWLAHGHI PFL LA  L  R  N  +++CS+P+NL+SI K +  K   
Sbjct  32    TNSGEIRILMFPWLAHGHISPFLELANKLVSRLPNVQVHLCSSPINLASITKLI--KHPS  89

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              IKL+EL LPSLPDLPPH HTT  LP HL+ TL KALDM+   F  +L TL PDL++ DF
Sbjct  90    RIKLIELNLPSLPDLPPHSHTTKDLPTHLLLTLMKALDMASSDFSQILTTLSPDLLICDF  149

Query  797   LQPWVPAMA-AAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
              QPW   +A +   IP VLF++  A +    F   +     +  FP   LR + F   ++
Sbjct  150   FQPWASKLAFSLLKIPTVLFMTIAAISTVVPFTSMKSSGKFDCLFP---LRSNYFFDYEQ  206

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             +  P        S  +R+    + S+ I+L+K+FR++E +YI +LS LV K  +PVGPLV
Sbjct  207   VESP--------SIMDRVFQSWERSAGILLVKSFREIEAEYIQRLSELVGKSVLPVGPLV  258

Query  440   RSLVADGENPE--IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg-----leLSKVN  282
                  + + P+  I  WL+ K   S V++SFGSE +L+  ++EE+A        +   +N
Sbjct  259   PGDDDENQQPDNDIINWLNNKAPSSVVYISFGSESYLSRRQIEELAHALVILIEKAIPIN  318

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             F+WV+RFP  E      AI +ALPEG+   VG+RG V E WAPQ  IL H S+GGFVSHC
Sbjct  319   FVWVLRFPQGEE----VAISEALPEGFSAAVGERGYVTEDWAPQRRILRHESVGGFVSHC  374

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GWSSVME +K+GVP++AMP+Q DQ  NA +V
Sbjct  375   GWSSVMEGMKYGVPMVAMPLQNDQSTNASLV  405



>gb|EYU43901.1| hypothetical protein MIMGU_mgv1a020989mg [Erythranthe guttata]
Length=467

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 188/395 (48%), Positives = 248/395 (63%), Gaps = 19/395 (5%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKR-NFYIYICSTPVNLSSI-------KK  1002
             M+  +    +LMFPWLA+ H+ PF  LA++L+KR  F+IY CS+  NL SI       K 
Sbjct  1     MEKDETKFTILMFPWLAYSHVFPFFELAKSLSKRRTFHIYFCSSAANLGSIENNLNNHKL  60

Query  1001  RVSEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLK  822
             R ++ D +SI LVELQLP  P LPPH+HTT  LPP+L+P L +    S   F  +L  LK
Sbjct  61    RCNDDDDVSIDLVELQLPPSPQLPPHFHTTKNLPPNLVPILLQTFQESSSSFSRILIDLK  120

Query  821   PDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDH  642
             PDL++YDF QPW    A + SIP++ F + GAA  SY  H+     A  +P+ E+YL D 
Sbjct  121   PDLLIYDFFQPWAAKQALSLSIPSIYFATAGAAPFSYFHHLHTHGSASTFPYQEIYLSDR  180

Query  641   EFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRC  462
             E   +      PE  D   +D +   G    S  I+LIK+ + LE KYID LS L +K+ 
Sbjct  181   E-KADLNAVVAPEIKD---ADQDFAFGNFKLSCDIVLIKSSKGLEQKYIDYLSVLCRKKV  236

Query  461   VPVGPLVR-SLVADGENPE---IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL  294
             VP GPLV+ S + D ++ E   I +WL  K R STV + FGSE+ L +E++ E+A GLE 
Sbjct  237   VPTGPLVQESNIKDDDDDESEVIMQWLSEKDRFSTVLICFGSEHLLPKEQIVEIAKGLEQ  296

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGF  114
                NF+W++RF      E A  + D LPEG+LERV  RG VV+ WAPQ  IL H SIGGF
Sbjct  297   CCTNFIWIVRFI---MDENALRLEDELPEGFLERVEGRGLVVQKWAPQAKILSHPSIGGF  353

Query  113   VSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             VSHCGWSS+ME+L FGVPIIA+P++ DQP+N R+V
Sbjct  354   VSHCGWSSIMESLYFGVPIIALPIKFDQPINGRLV  388



>gb|AFJ53039.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=456

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/398 (45%), Positives = 242/398 (61%), Gaps = 33/398 (8%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKR--NFYIYICSTPVNLSSIKKRVSEKDAI  978
              S  + R+LMFPWLAHGHI PFL LA  L  R  NF++Y+CS+P+NL S  K +  K   
Sbjct  7     NSGDAFRILMFPWLAHGHISPFLELANKLVSRRPNFHVYLCSSPINLQSTTKLI--KHPS  64

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              I L+EL LPSLPDLPPH H T GLP HL+PTL KALDM+   F  +L  L PDL++ DF
Sbjct  65    RIDLIELHLPSLPDLPPHSHATKGLPTHLIPTLLKALDMAGSEFSQILTKLSPDLLISDF  124

Query  797   LQPWVPAMAAAQ-SIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             LQPW P +A +   IP V F++  A    + F            FP   +R +  +    
Sbjct  125   LQPWAPKLALSLLKIPTVCFMTAPAIVYDFGFTSMNASGQFNGHFP---MRSNHVVDYGA  181

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                 P       S T+R    ++ SS+++LIK+FR +E  YID++S  + K  V + PLV
Sbjct  182   AESTP-------SLTDRFMRSMERSSTVVLIKSFRDIEAHYIDRVSKFIGKSMVTIAPLV  234

Query  440   -----RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg------leL  294
                       + +N EI  WL+ K + S V++SFGSE +L+  +++E+A         + 
Sbjct  235   PDDDDGEGDQEPDNNEIINWLNKKHKSSVVYISFGSECYLSASQIQELAHALLILLVEKA  294

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYL-ERVGKRGKV--VEGWAPQGMILEHSSI  123
               VNF+WV+RFP  E  E    I +ALPEG++ E VG   KV  VEGWAPQ  IL H S+
Sbjct  295   CPVNFIWVLRFPRGEEVE----ISEALPEGFIDEMVGPDNKVYLVEGWAPQRRILRHGSV  350

Query  122   GGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GGFVSHCGWSSVMEA+K+GVPII +P+++DQP+NAR+V
Sbjct  351   GGFVSHCGWSSVMEAMKYGVPIIGVPLRMDQPMNARLV  388



>gb|AFJ53040.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 178/397 (45%), Positives = 239/397 (60%), Gaps = 32/397 (8%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKR--NFYIYICSTPVNLSSIKKRVSEKDAI  978
             T+   IR+LMFPWLAHGHI PFL LA  L  R  NF++Y+CS+P+NL S  K +  K   
Sbjct  6     TNSGKIRILMFPWLAHGHISPFLELANKLISRRPNFHVYLCSSPINLESTTKLI--KHPS  63

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              I+L+EL LPSLPDLPPH HTT GLP HL+PTL KA+DM+   F  +L  L PDL++ DF
Sbjct  64    RIELIELHLPSLPDLPPHSHTTKGLPAHLIPTLFKAMDMASGEFFQILTKLSPDLLICDF  123

Query  797   LQPWVPAMA-AAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             LQPW P +A +   IP V F++  A      F      P     FP   LR +  I    
Sbjct  124   LQPWAPKLALSLLKIPTVCFMTSPAIVYDLAFTSMNASPQFNGAFP---LRSNYVIDYVE  180

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                 P       S   R+   ++ SS+++LIK+FR +E +YID++S  + K  V V PLV
Sbjct  181   AESTP-------SLANRVVWSMERSSTMVLIKSFRDIEARYIDRVSKFIGKSMVTVAPLV  233

Query  440   -----RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeeva------lgleL  294
                          +  +  WL+ K + S V++SFGSE +L+  +++E+A      L  + 
Sbjct  234   PDDDDDDEGDQETDNNVINWLNNKDKSSVVYISFGSECYLSTSQIQELAHALLILLVEKA  293

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKV--VEGWAPQGMILEHSSIG  120
               +NF+WV+RFP  E       I  ALPEG++E VG   KV   EGWAPQ  IL H ++G
Sbjct  294   YPINFIWVLRFPIGE----ELGISKALPEGFMEAVGLENKVYMAEGWAPQRRILRHGNVG  349

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GFVSHCGWSSVMEA+K+GVPI+ +P++ DQP+NAR+V
Sbjct  350   GFVSHCGWSSVMEAMKYGVPIVGVPLRTDQPMNARLV  386



>ref|XP_009803961.1| PREDICTED: crocetin glucoside glucosyltransferase-like, partial 
[Nicotiana sylvestris]
Length=449

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 248/371 (67%), Gaps = 17/371 (5%)
 Frame = -3

Query  1109  AHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPSLPDL  933
             +HGH+ P+L LA+ L+K N F+IY CSTP+ L+SI +    K+   I+L+E  LPS   L
Sbjct  10    SHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN---IQLIEFPLPSSTQL  66

Query  932   PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIP  753
             P + HTTNGLP +L+ TL +    +   F  +LD+L PDL+++D  QPW P +A++++IP
Sbjct  67    PSYNHTTNGLPKNLLSTLIQTFGEASSTFGKILDSLNPDLLIFDGFQPWAPQLASSRNIP  126

Query  752   AVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTE  573
             A+ FL  G+A+ S+L+H         +PF  ++L+D+E     +  +   +++  +    
Sbjct  127   AIHFLIVGSASISFLYHHYLYVGTRNFPFSGIFLKDYE----AKQLQLAAKMNNSLGPNV  182

Query  572   RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR----SLVADGENPEI  405
               +G ++ S  IILI T  ++EGKY+D LS L KK  +PVGPL+R    ++  +G + +I
Sbjct  183   AFNG-VEKSHDIILINTCNEIEGKYVDYLSTLSKKEVIPVGPLIREMKITMENEGNDSKI  241

Query  404   KEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAI  225
               WLD K   S V+VSFGSEYFL++EE+EE+A  LELS++NF+WV+RFP  E       I
Sbjct  242   ITWLDKKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELNFIWVLRFPLGEETN----I  297

Query  224   GDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMP  45
              + LP+G+L+RV ++G +VE WAPQ  ILEH+S+GGF+ HCGW+S++E+L FGVP+I MP
Sbjct  298   ENVLPKGFLDRVKEKGVIVEKWAPQARILEHTSVGGFLCHCGWNSILESLHFGVPLITMP  357

Query  44    MQLDQPLNARV  12
             M LDQ  ++R+
Sbjct  358   MHLDQHTHSRM  368



>ref|XP_011091058.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 247/385 (64%), Gaps = 9/385 (2%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA-  981
             M+  + +  +LMFPW+ HGH+ P+L LA+ L+ +NF I+ CST VNLSSI   + +  + 
Sbjct  1     MEAKETNFSILMFPWIGHGHVFPYLELAKNLSNKNFDIFFCSTAVNLSSISDALEKSSST  60

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
             ISI+LVEL LP L +LPPH+HTT  +PP LMP L +   MS   F +++ +++PD+++YD
Sbjct  61    ISIQLVELHLPLLSELPPHFHTTKNVPPALMPKLFETFQMSTSSFSDIISSIRPDMLIYD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
               QPW   +A +  IPAV F + GAA  S+  H      +  +PF  +YLRD+E  R   
Sbjct  121   VFQPWAAKIALSLGIPAVHFATSGAAPYSFYLHYFISANS-VFPFEAIYLRDYE--RKAL  177

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                 P        D +        S  I+L++T R +E KYID LS L K++ VPVGPLV
Sbjct  178   EAMAPSDRRNKQKDQDSGFDHFRLSCDIVLMRTCRAIERKYIDHLSFLCKRKLVPVGPLV  237

Query  440   -RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
               +   + ++ EI +WL  K + STVF+SFGSE +L +++M E+A GLE   VNF+WV+R
Sbjct  238   THANSEEAKHAEIMQWLSKKNQFSTVFISFGSENYLFKDQMVEIAKGLEACNVNFIWVVR  297

Query  263   FPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVM  84
              P    GE+  +I + LP G+L+R    G +++GWAPQ  IL H S G F+SHCG SS++
Sbjct  298   SP---LGERV-SIEEVLPTGFLDRAKDTGMILQGWAPQANILAHPSTGAFLSHCGMSSII  353

Query  83    EALKFGVPIIAMPMQLDQPLNARVV  9
             E++ FGVP+IAMP++LDQPLNAR+V
Sbjct  354   ESIYFGVPVIAMPLKLDQPLNARLV  378



>gb|KDO51358.1| hypothetical protein CISIN_1g046033mg, partial [Citrus sinensis]
Length=434

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 244/373 (65%), Gaps = 17/373 (5%)
 Frame = -3

Query  1106  HGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLP-SLPDL-  933
             HGHI P+L LA+ L+++NF+IY CSTP+NL S+ + + EK + SI+L++LQLP + P+L 
Sbjct  1     HGHITPYLALAKKLSQQNFHIYFCSTPINLQSMSQNLQEKFSTSIQLIDLQLPCTFPELH  60

Query  932   PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIP  753
              P+ HTT  +P HL+PTL +A D +KP F N+L+TLKP LV+YD  QPW    A    I 
Sbjct  61    DPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLETLKPTLVIYDLFQPWAAEAAYQHDIA  120

Query  752   AVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTE  573
             AV F++  AA+ S+       + + ++PFPE  L + E    +++ +   +I     + +
Sbjct  121   AVAFVTIAAASFSFFLQ----NSSLKFPFPEFDLPESEI---QKMTQFKHRIVNGTENRD  173

Query  572   RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIK--E  399
             R    +D S  ++L+KT R++E K +  LS + KK  +PVGPLV+  +    N + K  +
Sbjct  174   RFLKAIDLSCKLVLVKTSREIESKDLHYLSYITKKETIPVGPLVQEPIYTDNNNDTKIMD  233

Query  398   WLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGD  219
             WL  K   S V+VSFGSEYFL++EEM E+A GL LS+V+F+WV+RF +    E    I +
Sbjct  234   WLSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLLSEVSFIWVVRFHS----EGNFTIEE  289

Query  218   ALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMP  45
             ALP+G+ E +    +G VV+GWAPQ  IL H SIGGF+SHCGW S +E + +GVPIIA+P
Sbjct  290   ALPQGFAEEIQGNNKGMVVQGWAPQAKILGHGSIGGFISHCGWGSTVEGIMYGVPIIAVP  349

Query  44    MQLDQPLNARVVA  6
             M LDQ  NA++VA
Sbjct  350   MVLDQLFNAKMVA  362



>sp|Q8GVE3.2|FLRT_CITMA RecName: Full=Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase; 
AltName: Full=1,2 rhamnosyltransferase [Citrus maxima]
 gb|AAL06646.2| flavonoid 1-2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 236/387 (61%), Gaps = 12/387 (3%)
 Frame = -3

Query  1157  MDTS-QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MDT  Q    +LM PWLAHGHI P L LA+ L+++NF+IY CSTP NL S  + V +  +
Sbjct  1     MDTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFS  60

Query  980   ISIKLVELQLP-SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
              SI+L+ELQLP + P+LP    TT  LPPHL+ TL  A + +KP F N+L+TLKP LV+Y
Sbjct  61    SSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             D  QPW    A    I A+LFL   A ACS+L H    +P+ +YPF E   +D E   +K
Sbjct  121   DLFQPWAAEAAYQYDIAAILFLPLSAVACSFLLH-NIVNPSLKYPFFESDYQDRE---SK  176

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              +            + +R     + S   + IKT R++E KY+D   +L+    +PVGPL
Sbjct  177   NINYFLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPL  236

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             ++      ++ +I +WL  K   S V+ SFGSEYF +++E+ E+A GL LS+VNF+W  R
Sbjct  237   IQEPTFKEDDTKIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFR  296

Query  263   FPAAEAGEKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
                 E       I +ALP+G+ E +    +G +V+GW PQ  IL H SIGGF+SHCGW S
Sbjct  297   LHPDE----KMTIEEALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGS  352

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             V+E + FGVPII +PM  +QP NA+VV
Sbjct  353   VVEGMVFGVPIIGVPMAYEQPSNAKVV  379



>gb|ACX70154.1| 1,2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 235/387 (61%), Gaps = 12/387 (3%)
 Frame = -3

Query  1157  MDTS-QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MDT  Q    +LM PWLAHGHI P L LA+ L+++NF+IY CSTP NL S  + V +  +
Sbjct  1     MDTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFS  60

Query  980   ISIKLVELQLP-SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
              SI+L+ELQLP + P+LP    TT  LPPHL+ TL  A + +KP F N+L+TLKP LV+Y
Sbjct  61    SSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             D  QPW    A    I A+LFL   A ACS+L H    +P  +YPF E   +D E   +K
Sbjct  121   DLFQPWAAEAAYQYDIAAILFLPLSAVACSFLLH-NIVNPNLKYPFFESDYQDRE---SK  176

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              +            + +R     + S   + IKT R++E KY+D   +L+    +PVGPL
Sbjct  177   NINYFLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPL  236

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             ++      ++ +I +WL  K   S V+ SFGSEYF +++E+ E+A GL LS+VNF+W  R
Sbjct  237   IQEPTFKEDDTKIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFR  296

Query  263   FPAAEAGEKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
                 E       I +ALP+G+ E +    +G +V+GW PQ  IL H SIGGF+SHCGW S
Sbjct  297   LHPDE----KMTIEEALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGS  352

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             V+E + FGVPII +PM  +QP NA+VV
Sbjct  353   VVEGMVFGVPIIGVPMAYEQPSNAKVV  379



>gb|AFB73772.1| 1,2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 236/387 (61%), Gaps = 12/387 (3%)
 Frame = -3

Query  1157  MDTS-QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             M+T  Q    +LM PWLAHGHI P L LA+ L+++NF+IY CSTP NL S  + V +  +
Sbjct  1     MNTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFS  60

Query  980   ISIKLVELQLP-SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
              SI+L+ELQLP + P+LP    TT  LPPHL+ TL  A + +KP F N+L+TLKP LV+Y
Sbjct  61    SSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMY  120

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNK  624
             D  QPW    A    I A+LFL   A ACS+L H    +P+ +YPF E   +D E   +K
Sbjct  121   DLFQPWAAEAAYQYDIAAILFLPLSAVACSFLLH-NIVNPSLKYPFFESDYQDRE---SK  176

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              +            + +R     + S   + IKT R++E KY+D   +L+    +PVGPL
Sbjct  177   NINYFLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPL  236

Query  443   VRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIR  264
             ++      ++ +I +WL  K   S V+ SFGSEYF +++E+ E+A GL LS+VNF+W  R
Sbjct  237   IQEPTFKEDDTKIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFR  296

Query  263   FPAAEAGEKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
                 E       I +ALP+G+ E +    +G +V+GW PQ  IL H SIGGF+SHCGW S
Sbjct  297   LHPDE----KMTIEEALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGS  352

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             V+E + FGVPII +PM  +QP NA+VV
Sbjct  353   VVEGMVFGVPIIGVPMAYEQPSNAKVV  379



>gb|EPS71335.1| hypothetical protein M569_03424 [Genlisea aurea]
Length=449

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 179/389 (46%), Positives = 238/389 (61%), Gaps = 22/389 (6%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
              + +  R+L+FPWLAHGH+ PF  LA+ L+KRNF  Y+CSTPVNL+SI+         S+
Sbjct  2     AAAKEYRILLFPWLAHGHVSPFFQLAERLSKRNFKTYVCSTPVNLASIRLPADS----SV  57

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             +LVEL++ S  +LPP  HTT  LPPHLM  L +      P    +L +LKPDL+VYDFLQ
Sbjct  58    QLVELRMDSSAELPPELHTTRNLPPHLMLNLMQGFQACGPSLSEILISLKPDLLVYDFLQ  117

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
             P+   +AAA  IP+V F   GAA  SY   +     A  YPF  + L + +         
Sbjct  118   PFAAKLAAAVGIPSVFFAMMGAAYFSYYHQIYTSGSAGGYPFDAMDLFEDDVY-------  170

Query  611   PPEQIDG---DVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
              P  ID     V + E   G    S+ I+LIK++  +E KY++ LS L  KR V  GPL+
Sbjct  171   DPRMIDSLLEGVVENEFQCGSFKLSTEIVLIKSYGNMESKYLNHLSKLSNKRLVLTGPLM  230

Query  440   RSL---VADGE-NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLW  273
                   VADGE   EI  WLD K + STV+++FGSE +L+ E++ E+A GLE+SK NFLW
Sbjct  231   AKESHNVADGEITDEIMNWLDRKTKFSTVYINFGSECYLSAEQIREIANGLEISKANFLW  290

Query  272   VIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWS  93
             V+RF  ++      +  +ALPEG+LER   RG V+  W PQ  IL H S+  F+SHCGWS
Sbjct  291   VMRFRDSDG---VISPAEALPEGFLERTQGRGMVLAKWVPQVRILVHESVAAFLSHCGWS  347

Query  92    SVMEALKFGVPIIAMPMQL-DQPLNARVV  9
             SV E+L  GVPI+AMPMQL D+ +NA +V
Sbjct  348   SVTESLYLGVPIMAMPMQLADRAVNAALV  376



>gb|EYU45580.1| hypothetical protein MIMGU_mgv1a021692mg [Erythranthe guttata]
Length=458

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 256/395 (65%), Gaps = 21/395 (5%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEKDA  981
             MD+     R+LMFPWLAHGHI P+L LA+ ++K+  F+I++CST VN +SI   + EK++
Sbjct  1     MDSEASCFRILMFPWLAHGHIFPYLELARRISKKKKFHIHLCSTAVNFNSINSFI-EKNS  59

Query  980   I--SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
             +  SI+ VEL L S  DLPPHYHTT  LP +L+ TL K+   +KP F + +  LKPDLV+
Sbjct  60    LQNSIETVELHLQS--DLPPHYHTTKNLPSNLILTLLKSFQTAKPSFSDTIAALKPDLVI  117

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             YD  QPW   +A+++ IPAV F +  AA  +++ H     P  ++PFPEL L DHE    
Sbjct  118   YDIFQPWAARIASSRGIPAVHFAAFAAATMAFVHH-HYASPGGDFPFPELCLLDHE----  172

Query  626   KRLFEPPEQI---DGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
             KR  +   Q    D    D E I      SS  +++KT    EGKYID +S++ +++ +P
Sbjct  173   KRSIDSLIQFLYTDVFEEDKEVIFQNYRLSSEFVMLKTSEGFEGKYIDYVSDVCRRKILP  232

Query  455   VGPLVRSLVADGE--NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL--SK  288
             VGPLV  +  + E  N ++ +WL  K   STV++SFGSEYFL+EEE++E+A GLEL   +
Sbjct  233   VGPLVTGVCENAEENNSDVMKWLSKKEHHSTVYISFGSEYFLSEEEIDEIAKGLELCDER  292

Query  287   VNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVS  108
             VNF+WV+RFP    GEK   I + LP G+L RV  RG VV GWAPQ  IL H S G FVS
Sbjct  293   VNFIWVVRFPV---GEKTITIEERLPRGFLNRVEGRGMVVSGWAPQANILAHPSTGAFVS  349

Query  107   HCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             HCGWSS+ E++ +GVP+I MP +L+  ++AR++  
Sbjct  350   HCGWSSLTESIYYGVPVIGMPKKLNMFIDARMLVG  384



>gb|EPS70316.1| hypothetical protein M569_04443, partial [Genlisea aurea]
Length=434

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 239/377 (63%), Gaps = 15/377 (4%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             VL FPWLAHGH+ PF  LA+ L+K+NF  Y+CSTP+NL SI+   +  D+ +++L+EL +
Sbjct  1     VLFFPWLAHGHLSPFYELAKRLSKKNFKTYVCSTPINLMSIQ---AAPDS-AVELIELHM  56

Query  950   PSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMA  771
             P    LPP +HT+   PP++   L +   + K  FL++L ++KPDL++YD LQPW    A
Sbjct  57    PPSLKLPPEFHTSRNAPPNIGHALMQEFQLCKSNFLDILTSIKPDLLIYDLLQPWSAKQA  116

Query  770   AAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDG  591
              + SIP+V F +   A  SY  H+     AE+YPF  +YL DHE I  +      E    
Sbjct  117   LSMSIPSVFFGTSCTANYSYYHHLDNNGFAEKYPFKAIYLHDHEKIELRGYNNFIE----  172

Query  590   DVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV-RSLVADG--  420
             DV D   + G  + S+ IIL+K++ + E KY   LS L KK+ V  GPL+  S+  DG  
Sbjct  173   DVGDG-FLFGSFNLSTEIILVKSYGKFEAKYGCHLSALSKKKLVLTGPLIAESVDLDGTK  231

Query  419   ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGE  240
             ++ EI  WL+ + + S V+VSFGSEY  +++++ E++  LELS+V FLWVIRF     GE
Sbjct  232   KSNEIMNWLNDQRKFSIVYVSFGSEYSPSKQQIYEISKALELSRVMFLWVIRFG---IGE  288

Query  239   KARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVP  60
             K  ++ + LP+G+L+R    G +V  W PQ  IL H SIG F+SHCGWSSV E+L FGVP
Sbjct  289   KEISLKEVLPKGFLDRTKDNGIIVNEWVPQKRILAHPSIGAFISHCGWSSVTESLYFGVP  348

Query  59    IIAMPMQLDQPLNARVV  9
             II MP   DQP+NAR++
Sbjct  349   IIGMPFHTDQPINARLL  365



>gb|EYU45579.1| hypothetical protein MIMGU_mgv1a006511mg [Erythranthe guttata]
Length=441

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/384 (47%), Positives = 253/384 (66%), Gaps = 21/384 (5%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRN---FYIYICSTPVNLSSIKKRVSEKDAI--SIKLVE  960
             MFPWLAHGHI P+L LA+ ++K+N   F+I++CST VN +SI   + EK+++  SI+ VE
Sbjct  1     MFPWLAHGHIFPYLELARRISKKNNNNFHIHLCSTAVNFNSINSFI-EKNSLQNSIETVE  59

Query  959   LQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVP  780
             + L S  DLPPHYHTT  LP +L  TL KA   +K  F +++ TLKPDLV+YD  QPW  
Sbjct  60    IHLHS--DLPPHYHTTKNLPTNLNFTLIKAFQTAKSSFSDIVTTLKPDLVIYDIFQPWAA  117

Query  779   AMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAE--EYPFPELYLRDHEFIRNKRLFE-P  609
              +A+++ IPAV F + GAA  ++ FH      ++  ++PFP +Y+R HE  R   +F+  
Sbjct  118   GIASSRGIPAVHFAALGAAKMTF-FHRQATACSDGGDFPFPAIYIRPHEKKRMDGVFDFM  176

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV  429
                +  D  D   ++  L  SS ++L+KT R LEGKY+D +S    ++ +PVGPLV  + 
Sbjct  177   RTHVFDDDGDVFFVNYKL--SSEVVLLKTGRALEGKYVDYVSTTCGRKLLPVGPLVTDVC  234

Query  428   ADGE--NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgle--LSKVNFLWVIRF  261
              + E  N ++ +WL  K   STV++SFGSE FL+EEE+ E+A GLE    +VNF+WV+RF
Sbjct  235   ENAEESNSDVMKWLSKKEHHSTVYISFGSECFLSEEEINEIAKGLELCDERVNFIWVVRF  294

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  +   K   I +ALP G+L+RV  RG VV  WAPQ  IL H S G FVSHCGWSS+ E
Sbjct  295   PVED---KTITIEEALPLGFLDRVKDRGIVVSEWAPQANILAHPSTGAFVSHCGWSSLTE  351

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++ +GVP+IAMPM+L   ++AR++
Sbjct  352   SIYYGVPVIAMPMKLAMFVDARML  375



>gb|AFJ53037.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=431

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 233/384 (61%), Gaps = 31/384 (8%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKR--NFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQL  951
             MFPWLAHGHI PFL LA  L  R  NF++Y+CS+ +NL S    +  K    ++L+EL L
Sbjct  1     MFPWLAHGHISPFLELANKLVSRSPNFHVYLCSSSINLQSATALI--KHPSHMELIELHL  58

Query  950   PSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMA  771
             PSLPDLPPH HTT GLP HL+PTL KALDM+   F  +L  L PDL++ DF QPW P  A
Sbjct  59    PSLPDLPPHSHTTKGLPAHLIPTLFKALDMASSEFSQILTELSPDLLICDFFQPWAPKFA  118

Query  770   AAQ-SIPAVLFLSPGA--AACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQ  600
              +   IP VLF++  A   A         G     +P    Y+ D+E +      E P  
Sbjct  119   LSLLKIPTVLFMTNAAFSTAVPLTSMKNTGKFDGVFPLRSNYIFDYEEV------ESP--  170

Query  599   IDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADG  420
                  S  +R+   L+ SS I+L+K+FR++E +YID +S L  K  +P+GPLV     + 
Sbjct  171   -----SFKDRVFQSLERSSPILLVKSFREIEAEYIDTVSELFGKSVLPIGPLVPDDDDEN  225

Query  419   ENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg-----leLSKVNFLWVIRF  261
             + P  EI  WL+ K   S V++SFGSE +L+  ++EE+A        +   +NF+WV+RF
Sbjct  226   QQPDEEIINWLNNKGPSSVVYISFGSESYLSRSQIEELAHALLILIEKAIPINFVWVLRF  285

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
             P  E      AI +ALPEG+   VG +G + EGWAPQ  IL H S+GGFVSHCGWSSVME
Sbjct  286   PRGEE----VAISEALPEGFFSAVGGKGYMAEGWAPQRRILRHESVGGFVSHCGWSSVME  341

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
              +K+GVPI+ MP+Q DQ  NA +V
Sbjct  342   GMKYGVPIVGMPLQNDQSTNASLV  365



>sp|Q5NTH0.1|UGAT_BELPE RecName: Full=Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase; 
Short=BpUGAT; AltName: Full=UDP-glucuronic acid:anthocyanin 
glucuronosyltransferase [Bellis perennis]
 dbj|BAD77944.1| UDP-glucuronic acid:anthocyanin glucuronosyltransferase [Bellis 
perennis]
Length=438

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 240/384 (63%), Gaps = 32/384 (8%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             ++ RV+M PWLA+ HI  FLV A+ LT  NF+IYICS+  N+  +K  ++ + + SI+L+
Sbjct  8     KTFRVVMLPWLAYSHISRFLVFAKRLTNHNFHIYICSSQTNMQYLKNNLTSQYSKSIQLI  67

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL LPS  +LP  YHTT+GLPPHL  TL      S P F  +L  L P LV+YDF Q W 
Sbjct  68    ELNLPSSSELPLQYHTTHGLPPHLTKTLSDDYQKSGPDFETILIKLNPHLVIYDFNQLWA  127

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEE----YPFPELYLRDHEFIRNKRLF  615
             P +A+   IP++  LS   A  +   H+    P +E    +PFPE+Y ++ +  +     
Sbjct  128   PEVASTLHIPSIQLLSGCVALYALDAHL-YTKPLDENLAKFPFPEIYPKNRDIPK-----  181

Query  614   EPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR-  438
                    G     ER   C+  S  IIL+++  +LEGKYID LS  + K+ +PVGPLV+ 
Sbjct  182   -------GGSKYIERFVDCMRRSCEIILVRSTMELEGKYIDYLSKTLGKKVLPVGPLVQE  234

Query  437   -SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRF  261
              SL+ D ++  I +WLD K   S VFV FGSEY L++ E+E++A GLELS+V+F+W IR 
Sbjct  235   ASLLQD-DHIWIMKWLDKKEESSVVFVCFGSEYILSDNEIEDIAYGLELSQVSFVWAIR-  292

Query  260   PAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVME  81
                    K  A+      G+++RVG +G V++ W PQ  IL HSS GGF+SHCGWSS ME
Sbjct  293   ------AKTSALN-----GFIDRVGDKGLVIDKWVPQANILSHSSTGGFISHCGWSSTME  341

Query  80    ALKFGVPIIAMPMQLDQPLNARVV  9
             ++++GVPIIAMPMQ DQP NAR++
Sbjct  342   SIRYGVPIIAMPMQFDQPYNARLM  365



>ref|XP_010046728.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=389

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 169/386 (44%), Positives = 221/386 (57%), Gaps = 74/386 (19%)
 Frame = -3

Query  1157  MDTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI  978
             M T+ +   +LM PWLAHGHI PFL L + L+ R+F+IY CSTP+NL  ++  +  +D +
Sbjct  1     MSTTTQKPSILMLPWLAHGHISPFLELGKKLSHRDFHIYFCSTPINLKPLRDTILAQDCV  60

Query  977   -SIKLVELQLPS--LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
              SI+LV+L LPS   P LPPHYHTT  LPPHLM TLK A + +K  F ++L +LKPDLV+
Sbjct  61    PSIQLVDLHLPSDEFPQLPPHYHTTKDLPPHLMSTLKSAFNSAKSSFFDILGSLKPDLVI  120

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRN  627
             +D+LQPW    A+  +I AV                     +E Y   +L        +N
Sbjct  121   FDYLQPWASVAASELNINAV---------------------SENYRIAKLMNASANGYKN  159

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
             K                ER   C++ SS+I+LIKT R  EGKY+D LS LVK++ V VGP
Sbjct  160   K----------------ERFWECMERSSNIVLIKTSRVTEGKYVDYLSELVKRKVVTVGP  203

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             L++      E  E               +++G E                 S V F+WV+
Sbjct  204   LLQEPANKDEEREK--------------IAYGLEL----------------SNVGFIWVL  233

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSV  87
             RF   E       I +ALP+G+L+R+G RG VVEGWAPQ  IL H SIGGFVSHCGWSS 
Sbjct  234   RFHGGE----DVTIHEALPQGFLQRIGDRGLVVEGWAPQAEILGHPSIGGFVSHCGWSST  289

Query  86    MEALKFGVPIIAMPMQLDQPLNARVV  9
             +EA+ FGVPI+AMPM LDQPLNA++V
Sbjct  290   LEAILFGVPILAMPMHLDQPLNAKLV  315



>gb|AEQ33588.2| putative UDP-glucose:flavonoid glucosyltransferase [Ginkgo biloba]
Length=496

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/397 (44%), Positives = 242/397 (61%), Gaps = 22/397 (6%)
 Frame = -3

Query  1130  VLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA-----ISIKL  966
             VLMFPWLAHGHI PFL L+  L  R   +  CSTP N++SIK+ +   D       SI L
Sbjct  13    VLMFPWLAHGHISPFLELSMRLAGRGITVSFCSTPSNINSIKRTLQSHDDGETALNSINL  72

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LP +  L P + TT  LPPHLMP LKKA D  +  F  LL  L PD V++DFLQPW
Sbjct  73    VELPLPLVDGLGPSHETTASLPPHLMPLLKKAFDSLETSFGMLLQRLSPDCVIHDFLQPW  132

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPEL----------YLRDHEF  636
                +A+   IP++ F+   A   +Y     +G  +E+    +L           +R H+F
Sbjct  133   TSPVASKFGIPSLTFVPCSAVVVAYFLCAVKGKDSEQVTVEDLINPLDFPSSSTVRLHQF  192

Query  635   IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
                + L       +  +SD ER+ GC +  S+I  +KTF ++EGK++  L +L  K  V 
Sbjct  193   EALQTLNMYKRNRETGISDCERLQGCANKCSAIA-VKTFPEIEGKFLRLLESLTGKHVVA  251

Query  455   VGPLVR---SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             +GPL+    S  A  ++ +   WLD + R S VFVSFG+EYFL+++++EE+ALGLE S+ 
Sbjct  252   LGPLLTKQPSSNASEQDSKCLAWLDRQKRSSVVFVSFGTEYFLSKDQIEEIALGLEASEQ  311

Query  284   NFLWVIRFPAAEAG---EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGF  114
             +F+WV+RFP    G   ++ R +  +L  G+ ER+  +G VV GWAPQ  IL H S GGF
Sbjct  312   SFMWVLRFPQGPEGNVNDQQRRVSASLSAGFEERMKVKGIVVSGWAPQMKILRHPSTGGF  371

Query  113   VSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             ++HCGWSSVME +  G+P+IA+PMQLDQPLNAR+VA 
Sbjct  372   MTHCGWSSVMEGMSAGLPLIALPMQLDQPLNARLVAG  408



>ref|XP_009589204.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=455

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/390 (45%), Positives = 243/390 (62%), Gaps = 18/390 (5%)
 Frame = -3

Query  1157  MDTSQR-SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSE---  990
             M+ SQR S++VLM PWLAHGH  PF  LA+ L+K NFY+Y CSTP+ L+ +KK  S    
Sbjct  1     MEESQRNSLKVLMVPWLAHGHATPFFELAKRLSKCNFYVYFCSTPIILNFLKKSQSNFFS  60

Query  989   --KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
                    I+L+EL LPS  +LP  Y TT GLP HL P L  +   + P F N++ TL PD
Sbjct  61    NNHSNTKIQLIELHLPSTLELPLEYQTTKGLPRHLFPILLNSFKTAGPIFSNIVPTLNPD  120

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEF  636
             L++YD  Q W P +A++  IPAV ++  GA   S+ +H+      +++PFPE++L  +E 
Sbjct  121   LIIYDIFQNWAPKIASSLHIPAVSYIILGATTASFFYHLYAFDGTKDFPFPEIFLPRYEL  180

Query  635   IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
                ++L+     +   + D     G +  S  IILI  ++  E KY++  S L KK  + 
Sbjct  181   ---EKLYSENASMTKFIDDIFASSG-VAMSQDIILINNWKCTETKYMEYFSILTKKNVIS  236

Query  455   VGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKV  285
             VGPL+    S V D E  +I +WLD K   ST++V+FGSE  + +EE+EE+A GLELS V
Sbjct  237   VGPLIGKTESRVEDSE--DIIQWLDKKDPSSTLYVAFGSECVVNKEEIEEIARGLELSNV  294

Query  284   NFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSH  105
             NFLWV+ F      EK   I + LPEGY ERV ++G++V  WAPQ  IL HS+I GF++H
Sbjct  295   NFLWVVNFS---LDEKISGIDEILPEGYNERVKEKGRIVTKWAPQAKILRHSNIVGFLNH  351

Query  104   CGWSSVMEALKFGVPIIAMPMQLDQPLNAR  15
             CG +S++E+L FGVPIIAMP+ +DQ +  R
Sbjct  352   CGSNSILESLHFGVPIIAMPVLVDQFIATR  381



>ref|XP_008347175.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=354

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 230/352 (65%), Gaps = 25/352 (7%)
 Frame = -3

Query  1157  MDTSQRSI--RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKD  984
             MD+   +I   V+M PWLAHGHI PF  LA+ L+ RNF+I+ CSTPV L+S+K ++ E+ 
Sbjct  1     MDSRHGNIIMSVVMLPWLAHGHISPFXELAKKLSDRNFHIFFCSTPVILNSVKPKLPERY  60

Query  983   AISIKLVELQLPS--LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             +  I+ VEL LP    P+L PHYHTTNGLPPHLMPTLKKAL M+ P F N+L TL PD +
Sbjct  61    SHCIEFVELHLPHDVFPELAPHYHTTNGLPPHLMPTLKKALQMASPYFSNILKTLNPDFL  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDF+ PW  ++   Q+IP + F    A + S+LFH     P+  +PFP +YLRD+E  +
Sbjct  121   IYDFVVPWALSLGLDQNIPTIQFFIFSAVSVSFLFHRLFKGPSVRFPFPAIYLRDYEISK  180

Query  629   NKRLFEPPEQIDGDVSDTERIDG--------CLDGSSSIILIKTFRQLEGKYIDQLSNLV  474
                +  P        +D  + DG         +  S  +IL+KTFR++EGKY+D L  L+
Sbjct  181   FNSMMPP-----ASSNDNRKDDGVPPLQFLITIGHSCDLILLKTFREIEGKYVDYLYELM  235

Query  473   KKRCVPVGPLVRSLVADGENPE-----IKEWLDMKPRCSTVFVSFGSEYFlteeemeeva  309
               + V +GPL+     D E+ +     + +WL+ +   S V++SFGSEYFL++EE+EE+A
Sbjct  236   DSKVVRLGPLLHDPTKDQEDKDEETDHVIKWLNQRETSSVVYISFGSEYFLSKEEIEEIA  295

Query  308   lgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAP  153
              GL+LSKV+F+WV+RFP  E   +A+ +   LP+G++ERVG+RG +VEGWAP
Sbjct  296   HGLDLSKVSFIWVVRFPKEEKVTRAKEV---LPKGFVERVGERGMIVEGWAP  344



>ref|XP_009620256.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana tomentosiformis]
Length=465

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/388 (42%), Positives = 237/388 (61%), Gaps = 30/388 (8%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIK----KRVSEKDAISIKL  966
             ++LM PWLAHGH  PF  LA+ L+K NF+IY+CST   LS +K    K  S+  + +I+L
Sbjct  12    KILMVPWLAHGHATPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFSDISSANIEL  71

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             +EL LPS+P LP HY +T GLP HL P L  A  M+   F N++D + PDL++ DFLQ W
Sbjct  72    IELHLPSMPQLPSHYQSTKGLPNHLYPLLLNAFQMAGQSFSNIVDNVNPDLIIEDFLQAW  131

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYLRDHEFIRNKRLFEP  609
              P +A +++IP V F    AA+ S+++H+     A ++YPFPE+ L ++E          
Sbjct  132   APDIALSKNIPIVNFTVSSAASYSFMYHLYLHDGATDDYPFPEICLSNNEI--------E  183

Query  608   PEQIDGDVSDT-----ERI--DGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVG  450
                + G  + +     ERI        S+ IILI  +++ E KY+  LS++  K+ + VG
Sbjct  184   IGLVSGTTTRSITALLERILVYSARKKSNDIILINNWKETEAKYMQYLSSITNKKILSVG  243

Query  449   PLVRSL---VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNF  279
             PL+        D ++ +I EWLD +   STV+  FGSE   ++E ++E+A G+ELS VNF
Sbjct  244   PLIGQTDESTQDDQDSDIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGIELSNVNF  303

Query  278   LWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCG  99
             LWV+RFP +E       +   LPEG+L RV +RG VV  W P   I+ H+SIGGF++HCG
Sbjct  304   LWVLRFPGSE-------VEQVLPEGFLNRVKERGMVVSRWVPHAKIMRHTSIGGFLNHCG  356

Query  98    WSSVMEALKFGVPIIAMPMQLDQPLNAR  15
             W+S +E + FGVP+IAMP  +DQ + A 
Sbjct  357   WNSTVECIHFGVPLIAMPFNMDQFITAN  384



>gb|EPS71334.1| glycosyltransferase, partial [Genlisea aurea]
Length=439

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 233/381 (61%), Gaps = 15/381 (4%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             R  +VL FPWLAHGH+ PF  LA+ L+K+NF  YICST VN+ SI+   +  D+ ++  V
Sbjct  2     REFKVLFFPWLAHGHVSPFFELAKRLSKKNFKTYICSTRVNMESIQ---ATPDS-AVDFV  57

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
             EL +P  P+ PP   TT     +L+  L K L + K  F  +L ++KPDL++YDFLQ W 
Sbjct  58    ELHMPPSPEFPPELQTTRNANGYLVQALMKKLHLCKSIFFEILTSIKPDLLIYDFLQLWS  117

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPE  603
                A +  IP+V F     A  SY  H+      E+YP   +YL DHE    K      +
Sbjct  118   AKQALSMDIPSVYFAPSSTAYHSYYHHLYTNGSTEKYPLEAIYLHDHERFDLKHF----K  173

Query  602   QIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR---SL  432
              +  D+ D    D   + S+ I+L+K++ Q+E KY+  LSNL K + V  GPL+    +L
Sbjct  174   NLIEDIGDGFTFDD-FNLSTKIMLVKSYGQVEAKYVSHLSNLSKTKIVLTGPLIAESANL  232

Query  431   VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAA  252
                 ++ EI  WL+ + + S V++SFGSE+ L++E++ E++ GLELS+V FLWVIRF   
Sbjct  233   NGAEKSNEIMNWLNDQQKLSIVYISFGSEHVLSKEQIYEISKGLELSRVRFLWVIRFAV-  291

Query  251   EAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALK  72
               G+K   + + LPEG+L+R    G +V  WAPQ  IL H SI  F+SHCGWSSV E L 
Sbjct  292   --GKKETFLEEILPEGFLDRTKDDGIIVTEWAPQKKILAHPSIRAFISHCGWSSVTEGLY  349

Query  71    FGVPIIAMPMQLDQPLNARVV  9
             FGVPIIAMP+ +DQP+NAR++
Sbjct  350   FGVPIIAMPIHVDQPINARLL  370



>gb|EPS71672.1| hypothetical protein M569_03087 [Genlisea aurea]
Length=465

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 167/384 (43%), Positives = 236/384 (61%), Gaps = 16/384 (4%)
 Frame = -3

Query  1142  RSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLV  963
             + +++L FPWLAHGH+ PF  LA+ LTK+NF  YICS+PVNLSSI+      D+ +++ V
Sbjct  19    KELKILFFPWLAHGHLSPFFELAKRLTKKNFKAYICSSPVNLSSIRL---PPDSSAVEFV  75

Query  962   ELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWV  783
              L +P  P+LP   H+T  LP H +  L          F  +L +LKPDLV+YD  QPW 
Sbjct  76    PLHMPESPELPAELHSTRNLPNHRVIELIACFQSCDEIFAGILASLKPDLVIYDLFQPWA  135

Query  782   PAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPE-LYLRDHEFIRNKRLFEPP  606
             P +A    IPAV F    A   SY  H+      E YPF + + L ++E  R   LF   
Sbjct  136   PRIAIGMGIPAVFFSMYNATFYSYYHHLYNHGTPETYPFSDAISLDEYERFRLGDLF---  192

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
               +    ++ E + G  + S+ ++L+K F ++E KYI+ LS +  KR +  GPL      
Sbjct  193   --VHLKDAEHEFVFGNFNLSTEVVLVKGFGKMEEKYINYLSQMNGKRILRTGPLFAGSSI  250

Query  425   DG----ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
              G    ++ EI +WL  KP  STV++SFGSE FL+ ++M+++ +GLE+S VNF+WVIRF 
Sbjct  251   GGVHSEKSSEILKWLSGKPESSTVYISFGSESFLSAKQMQQIGVGLEISPVNFIWVIRFS  310

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
               E   KAR + + LPEG+L+R  ++G ++  WAPQ  IL H S+GGFVSH GWSS  E+
Sbjct  311   HLE---KARPVEEVLPEGFLDRNKEKGLIITEWAPQQAILGHRSVGGFVSHAGWSSTTES  367

Query  77    LKFGVPIIAMPMQLDQPLNARVVA  6
             L  GVPI+AMP+  DQP+NAR++A
Sbjct  368   LLCGVPIVAMPLGSDQPINARLLA  391



>gb|EMT05942.1| hypothetical protein F775_52247 [Aegilops tauschii]
Length=458

 Score =   296 bits (759),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/399 (45%), Positives = 244/399 (61%), Gaps = 28/399 (7%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKR-------NFYIYICSTPVNLSSIKK  1002
             M  ++R  +RV+MFPWLAHGHI P+L LA+ L          +  +++ STP NL+ +  
Sbjct  1     MAQAERECMRVVMFPWLAHGHINPYLELAKRLVAASPDDHHLDVVVHLVSTPANLAPLAH  60

Query  1001  RVSEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLK  822
               +++    IKLVEL LP+LP LPP  HTT GLP HLMP LK+A D++ P F  LLD L 
Sbjct  61    HQTDR----IKLVELHLPALPGLPPALHTTKGLPAHLMPALKRACDLAAPRFGALLDQLC  116

Query  821   PDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYL--  651
             PD+VVYDFLQPW P  AAA+ +PAV F +  AAA +++ H  +       +PF  + L  
Sbjct  117   PDIVVYDFLQPWAPLEAAARGVPAVHFNTFSAAAKAFVVHCLKNERTPSAFPFESISLGG  176

Query  650   RDHEFIRNKRLFEPPEQIDGD--VSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNL  477
              + +     RL     + DG   + + +R+   L+ SS  + IKT   +E KY+D LS L
Sbjct  177   AEEDAKYTARLI---SRDDGTAMIPERDRLPLSLERSSGFVAIKTCADIERKYVDYLSQL  233

Query  476   VKKRCVPVGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeeval  306
             V K  VP GPL+       A  +   I  WLD K   S VFVSFGSEYF+++ +M ++A 
Sbjct  234   VGKEVVPTGPLLVDSGGSEAKRDGGRITRWLDGKEPGSVVFVSFGSEYFMSDRQMAQMAR  293

Query  305   gleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             GLELS+V +LW +R P AE  + AR    ++P G+      RG VVEGWAPQ  IL H S
Sbjct  294   GLELSRVPYLWAVRVPKAE--DDARGAARSMPRGFKP---ARGLVVEGWAPQWRILSHRS  348

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
              G F++HCGWSSV+E++  GVP++A+P+ +DQPLNA + 
Sbjct  349   CGAFLTHCGWSSVLESMAAGVPMVALPLHIDQPLNANLA  387



>ref|XP_002311963.2| hypothetical protein POPTR_0008s02520g [Populus trichocarpa]
 gb|EEE89330.2| hypothetical protein POPTR_0008s02520g [Populus trichocarpa]
Length=419

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 235/387 (61%), Gaps = 56/387 (14%)
 Frame = -3

Query  1157  MDTSQRSI-RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             MD + RS+ RVLMFPWLA+ HI PFL LA+ L++RNFYI++CS+P NL  IK+ + E + 
Sbjct  1     MDATNRSVVRVLMFPWLAYSHIHPFLELAKKLSERNFYIHLCSSPANLGHIKENLLEMNF  60

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              SI+LVEL LPS PDLPPHYHTT GLP HL+  L +A D +   F ++L TL+P  +  D
Sbjct  61    PSIQLVELHLPSSPDLPPHYHTTKGLPNHLLGNLMQAFDTASSSFSSILTTLRPYFLTCD  120

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGR--GHPAEEYPFPELYLRDHEFIRN  627
             F QPW PA+A + +IP V F+  G  A S   H  +  G   ++     L+++D      
Sbjct  121   FFQPWAPALALSLNIPTVQFVVSGNKANSVAAHAFKKSGVVIQDSAKDFLFIKD------  174

Query  626   KRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGP  447
                               RI   L+ SS I+L   F Q                      
Sbjct  175   ------------------RILQHLEQSSGIMLSVHFVQ----------------------  194

Query  446   LVRSLVADGENPEIKEWLDMKPRCSTV-FVSFGSEYFlteeemeevalgleLSKVNFLWV  270
                 +  D +  EI EWL+ +  CS+V +V+FGSE +L++E+ EE+ALGL LS VNF+WV
Sbjct  195   --EPIAEDDKKTEITEWLNKRDPCSSVIYVAFGSENYLSKEDREELALGLLLSNVNFIWV  252

Query  269   IRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSS  90
             +RFP    GE+  A  +ALPEG++E V +RG +VE WAPQ  IL H SIGGF+SHCGW S
Sbjct  253   LRFP---RGEEISA-REALPEGFIEMVSERGLIVEEWAPQKRILSHPSIGGFLSHCGWGS  308

Query  89    VMEALKFGVPIIAMPMQLDQPLNARVV  9
             V+E++KFGVP+IAMPM +DQPLNA  +
Sbjct  309   VLESMKFGVPLIAMPMHIDQPLNAEFL  335



>ref|XP_011071677.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=455

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 248/382 (65%), Gaps = 13/382 (3%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRN-FYIYICSTPVNLSSIKKRVSEK-----DAISI  972
             +VLMFPWLAHGH+ P+L LAQ L+K N F+IY CST VNL SI+  +++      D +SI
Sbjct  5     KVLMFPWLAHGHVYPYLALAQRLSKTNKFHIYFCSTSVNLESIRNSLNQHSPSSWDHLSI  64

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             +L+EL+LP  P LPPHYHTT  +P  L+PTL  A  +S P F +++  L PDL++YD  Q
Sbjct  65    ELIELRLPPHPQLPPHYHTTKNIPLTLIPTLIHAFQLSAPNFSDIITRLNPDLLIYDMFQ  124

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE  612
             PW   +A++Q IPAV F   G+ A S+L H+     A  +P P +YL D+E  R  ++ E
Sbjct  125   PWSAKLASSQGIPAVHFNVGGSTALSFLHHLHTHKSAVTFPVPAIYLHDYE--RQNQMAE  182

Query  611   PPEQIDGDVSDTERIDGCLDGSSSIILIKT-FRQLEGKYIDQLSNLVKKRCVPVGPLVRS  435
               E +     D     G    S  I+LI +    +EG YID LS L ++R VPVGPLV+ 
Sbjct  183   -EELVKVQEDDEGLFFGVFKLSCDIVLINSCCMWIEGMYIDYLSTLSQRRIVPVGPLVQE  241

Query  434   LVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPA  255
               AD  +  I  WL  K   ST+++SFGSE + + E+++E+A GLEL KVNF+WV R P 
Sbjct  242   NAADETDSWIMNWLSKKRESSTLYISFGSETYFSREQIQEIAKGLELCKVNFIWVARSP-  300

Query  254   AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEAL  75
                G     + +ALPEG+++ V +RG +V+ WAPQ  IL   ++GGF+SHCGW+++ E++
Sbjct  301   --VGSDHINVEEALPEGFIDLVKERGILVQKWAPQAAILASPAVGGFMSHCGWNAIKESI  358

Query  74    KFGVPIIAMPMQLDQPLNARVV  9
              FGVP++A+P++ +QPLN+R+V
Sbjct  359   YFGVPVVALPLKFEQPLNSRLV  380



>ref|XP_008363249.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=354

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 225/347 (65%), Gaps = 15/347 (4%)
 Frame = -3

Query  1157  MDTSQRSI--RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKD  984
             MD+   +I   V+M PWLAHGHI PF  LA+ L+ RNF+I+ CSTPV L+S+K ++ E+ 
Sbjct  1     MDSRHGNIIMSVVMLPWLAHGHISPFXELAKKLSDRNFHIFFCSTPVILNSVKPKLPERY  60

Query  983   AISIKLVELQLPS--LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             +  I+ VEL LP    P+L PHYHTTNGLPPHLMPTLKKAL M+ P F N+L TL PD +
Sbjct  61    SHCIEFVELHLPHDVFPELAPHYHTTNGLPPHLMPTLKKALQMASPYFSNILKTLNPDFL  120

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIR  630
             +YDF+ PW  ++   Q+IP + F    A + S+LFH     P+  +PFP +YLRD+E  +
Sbjct  121   IYDFVVPWALSLGLDQNIPTIQFFIFSAVSVSFLFHRLFKGPSVRFPFPAIYLRDYEISK  180

Query  629   NKRLFEPPEQIDGDVSDTE---RIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCV  459
                +  P    D    D     +    +  S  +IL+KTFR++EGKY+D L  L+  + V
Sbjct  181   FNSMMPPASSNDNRKDDGVPPLQFXITIGHSCDLILLKTFREIEGKYVDYLYELMDXKVV  240

Query  458   PVGPLVRSLVADGENPE-----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL  294
              + PL+     D E+ +     + +WL+ +   S V++SFGSEYFL++EE+EE+A GL L
Sbjct  241   RLXPLLHXPTKDQEDKDEETDHVIKWLNQRETSSVVYISFGSEYFLSKEEIEEIAHGLXL  300

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAP  153
             SKV+F+WV+RFP      +A+ +   LP+G++ERVG+RG +VEGWAP
Sbjct  301   SKVSFIWVVRFPKEXKVTRAKEV---LPKGFVERVGERGMIVEGWAP  344



>ref|XP_008449847.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis melo]
Length=451

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/394 (45%), Positives = 237/394 (60%), Gaps = 25/394 (6%)
 Frame = -3

Query  1157  MDTSQRSIR-----VLMFPWLAHGHICPFLVLAQALTK-RNFYIYICSTPVNLSSIKKRV  996
             MD  Q S       +LMFPWL +GH+ P+L L++AL++ +NF IY CSTPVNL SIK ++
Sbjct  1     MDAHQASTHPTTTTILMFPWLGYGHLTPYLELSKALSRXKNFLIYFCSTPVNLDSIKPKL  60

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
                 + SI+ VEL LPS P+ PPH HTT  LP HL P L +A   + P F  +L TL P 
Sbjct  61    I--PSPSIQFVELHLPSSPEFPPHLHTTKALPLHLTPALHQAFAAAAPLFETILKTLSPH  118

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEF  636
             L++YD  Q W P +A++ +IPA+ F + GA+  SY FH     P  ++P  +  L +H  
Sbjct  119   LLIYDCFQSWAPRLASSLNIPAINFNTSGASIISYAFH-SIHRPGSKFPISDFVLHNHWN  177

Query  635   IR-NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCV  459
              + N  L E    +       E    CL+ S  +IL  +F+++EG+Y+D +S L KK+ +
Sbjct  178   SKYNSTLREHAHCVK------EAFFECLNTSRDVILTNSFKEVEGEYMDYISLLSKKKVI  231

Query  458   PVGPLVRSLVADGENPE----IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLS  291
             PVGPLV       E  E    IK WLD K   STV VS GSE + +EEE EE+  GL  S
Sbjct  232   PVGPLVYEPNEKDEEDEDYSRIKNWLDKKEALSTVLVSLGSESYASEEEKEEIVKGLVES  291

Query  290   KVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFV  111
               NF+WV R    + G++ + I        LE+ G+R  VV+GWAPQG IL+H SIGGFV
Sbjct  292   GANFIWVERI--NQKGDEEQQIKR---RELLEKGGERAMVVKGWAPQGKILKHGSIGGFV  346

Query  110   SHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             SHCGW+SV+E+   GVPII +P+  DQP NA VV
Sbjct  347   SHCGWNSVLESTVSGVPIIGVPLFGDQPFNAGVV  380



>dbj|BAK08326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 240/391 (61%), Gaps = 27/391 (7%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKR-------NFYIYICSTPVNLSSIKKRVSEKDAI  978
             +RV+MFPWLAHGHI P+L LA+ L          +  +++ STP NL+ +    +++   
Sbjct  9     MRVVMFPWLAHGHINPYLELAKRLIASASGDHHLDVVVHLVSTPANLAPLAHHQTDR---  65

Query  977   SIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDF  798
              ++LVEL LPSLPDLPP  HTT GLP  LMP LK+A D++ P F  LLD L PD++VYDF
Sbjct  66    -LRLVELHLPSLPDLPPALHTTKGLPARLMPVLKRACDLAAPRFGALLDELCPDILVYDF  124

Query  797   LQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRGHPAEEYPFPELYLRD-HEFIRNK  624
             +QPW P  A A+ +PA  F + GAAA ++  H +    P   +PF  + L    E  +  
Sbjct  125   IQPWAPLEAEARGVPAFHFATCGAAATAFFIHCLKTDRPPSAFPFESISLGGVDEDAKYT  184

Query  623   RLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPL  444
              L    E     V++ +R+   L+ SS  + +K+   +E KY++ LS L+ K  +P GPL
Sbjct  185   ALVTVREDSTALVAERDRLPLSLERSSGFVAVKSSADIERKYMEYLSQLLGKEIIPTGPL  244

Query  443   VRSLVADGENPE------IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
                LV  G + E      I  WLD +   S VFVSFGSEYF++E +M ++A GLELS V 
Sbjct  245   ---LVDSGGSEEQRDGGRIMRWLDGEEPGSVVFVSFGSEYFMSEHQMAQMARGLELSGVP  301

Query  281   FLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHC  102
             FLWV+RFP AE  + AR    ++P G+   +   G VVEGWAPQ  IL H S G F++HC
Sbjct  302   FLWVVRFPNAE--DDARGAARSMPPGFEPEL---GLVVEGWAPQRRILSHPSCGAFLTHC  356

Query  101   GWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             GWSSV+E++  GVP++A+P+ +DQPLNA + 
Sbjct  357   GWSSVLESMAAGVPMVALPLHIDQPLNANLA  387



>ref|XP_009774569.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana sylvestris]
Length=498

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 235/381 (62%), Gaps = 17/381 (4%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIK----KRVSEKDAISIKL  966
             ++LM P +AHGH+ PF  LA+ L+K NF+IY+CST   LS +K    K  S+    +I+L
Sbjct  46    KILMIPMIAHGHVTPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFSDASNTNIEL  105

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             +EL LPS+PDLP HY +T GLP  L P L  A  M+   F N++D L PDL++ DF Q W
Sbjct  106   IELHLPSMPDLPSHYQSTKGLPS-LYPPLFTAYKMAGESFSNIVDNLNPDLIIEDFFQAW  164

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYLRDHEFIRNKRLFEP  609
              P +A +++IP V F    AA+ S+++H+     A ++YPFPE+ L ++E I    + +P
Sbjct  165   APDIALSKNIPIVSFSVVSAASYSFMYHIYLSDGATDDYPFPEICLSNNE-IEIGLISKP  223

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL-  432
                      +   +      S  I+LI  +++ E KY+  LS+++ K+ + VGPL+    
Sbjct  224   TGSSITVFLEKILVYSARKKSCDIVLINNWKETEVKYMTYLSSIINKKTLSVGPLIGQTD  283

Query  431   --VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 D ++ +I EWLD K R STV+  FGSE   ++E ++E+A G+ELS VNFLWV+RFP
Sbjct  284   ESTQDDQDSDIIEWLDKKDRFSTVYAVFGSENVWSKENIQEIAHGIELSNVNFLWVLRFP  343

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
              +E       +   LPEG+L RV +RG VV  W P   I+ H+SIGGF++HCGW+S +E 
Sbjct  344   GSE-------VEQVLPEGFLNRVKERGMVVSRWVPHAKIMGHTSIGGFLNHCGWNSTVEC  396

Query  77    LKFGVPIIAMPMQLDQPLNAR  15
             + FGVP+IAMP  +DQ + A 
Sbjct  397   IHFGVPLIAMPFNVDQFITAN  417



>ref|XP_009802399.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=365

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 204/296 (69%), Gaps = 10/296 (3%)
 Frame = -3

Query  890  MPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSY  711
            M TLK+A D++ P F  +L TLKPDL++YDFLQPW P +AA   IPAV F+S  +   +Y
Sbjct  1    MNTLKEAFDLACPEFTLILKTLKPDLLIYDFLQPWAPNVAAELKIPAVEFISSSSTMTAY  60

Query  710  LFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE--PPEQIDGDVSDTERIDGCLDGSSSI  537
            + H     P  ++PF  +Y RD+E  R K+     P E+++    D +R+  C   SS I
Sbjct  61   MLH-DFNKPGIKFPFSSIYYRDYEMARIKKDESSMPVEKLE---EDKKRVRDCFYLSSDI  116

Query  536  ILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIKEWLDMKPRCSTVFVS  357
            +LIK+F+++EGKY D ++ L  K+ VP+GPLV+    D    E+  WL+ K   ST+FVS
Sbjct  117  VLIKSFKEIEGKYSDYITKLTGKKVVPIGPLVQEPTLDDGESELITWLNEKEEKSTIFVS  176

Query  356  FGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRG  177
            FGSEYFL++E++ E+A GLE SKVNF+W IRF   E  E    + +ALP G+  RVG RG
Sbjct  177  FGSEYFLSKEDLLEIAYGLENSKVNFIWPIRFQKGEDIE----LEEALPNGFFNRVGNRG  232

Query  176  KVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
            KV +GWAPQ  ILEHSSIGGF+SHCGWSSVME++K+GV IIAMPM +DQP+N+R+V
Sbjct  233  KVFKGWAPQAKILEHSSIGGFMSHCGWSSVMESMKYGVSIIAMPMHIDQPINSRLV  288



>ref|XP_004958654.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Setaria italica]
Length=471

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 173/394 (44%), Positives = 237/394 (60%), Gaps = 21/394 (5%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRN-----FYIYICSTPVNLSSIKKRVSEKDA  981
             +  + V+MFPWLAHGHI P+L LA+ LT  +       +Y+ STPVNL++I  R +++  
Sbjct  6     REQLSVVMFPWLAHGHINPYLELARRLTSTDRDGVDVVVYLVSTPVNLAAIAHRQTDR--  63

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
               I+LVEL LPSLPDLPP  HTT  LP  LMP LK+A D++ P F  LLD L+PD ++YD
Sbjct  64    --IRLVELHLPSLPDLPPALHTTKHLPARLMPALKRACDLAAPRFGALLDDLRPDALLYD  121

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRGHPA-EEYPFPELYL-RDHEFIR  630
             FLQPW P  AAA+ +PA  F +  AAA ++  H +G    A   +PF  + L    E  +
Sbjct  122   FLQPWAPLEAAARGVPAAHFSTCSAAATAFFVHCLGSADRAPRAFPFQSVGLGTADEEAK  181

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLV-KKRCVPV  453
                LF   E     VS+ +R+   L  SS  + +KT   +E KY+D LS L+  K  +P 
Sbjct  182   YTELFALREDPAALVSERDRLLLSLARSSGFVAVKTCADIERKYMDYLSELLGGKEIIPC  241

Query  452   GPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVN  282
             GPL+          E+  +  WLD +   S V  SFGSEYF++E ++ ++A GLE+S   
Sbjct  242   GPLLVDSGGGGGAAESDRVMRWLDGQEPGSVVLASFGSEYFMSEHQIAQMARGLEMSGER  301

Query  281   FLWVIRFPAAEAG--EKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVS  108
             FLWV+RFP +  G  E       ALP G+      RG VVEGWAPQ  IL H + G F++
Sbjct  302   FLWVVRFPESAGGGEEDHGGAARALPRGF---APSRGLVVEGWAPQRRILSHGACGAFLT  358

Query  107   HCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             HCGWSS++E+L  GVP++A+P+ +DQPL A + A
Sbjct  359   HCGWSSLLESLAAGVPVVALPLHIDQPLGANLAA  392



>gb|EAZ05102.1| hypothetical protein OsI_27293 [Oryza sativa Indica Group]
Length=474

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 238/401 (59%), Gaps = 24/401 (6%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKR-----NFYIYICSTPVNLSSIKKRV  996
             M  ++R  +RVLMFPWLAHGHI P+L LA  LT       +  +++ STPVNL+++  R 
Sbjct  1     MAQAERERLRVLMFPWLAHGHINPYLELATRLTTTSSSQIDVVVHLVSTPVNLAAVAHRR  60

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
             +++    I LVEL LP LP LPP  HTT  LPP LMP LK+A D++ P F  LLD L PD
Sbjct  61    TDR----ISLVELHLPELPGLPPALHTTKHLPPRLMPALKRACDLAAPAFGALLDELSPD  116

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH----VGRGHPAEEYPFPELYLR  648
             +V+YDF+QPW P  AAA+ +PAV F +  AAA ++  H     G G     +PF  + L 
Sbjct  117   VVLYDFIQPWAPLEAAARGVPAVHFSTCSAAATAFFLHFLDGGGGGGGRGAFPFEAISLG  176

Query  647   DHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
               E      +    +     + + ER+      SS  + +KT  ++E KY+D LS LV K
Sbjct  177   GAEEDARYTMLTCRDDGTALLPEGERLPLSFARSSEFVAVKTCVEIESKYMDYLSKLVGK  236

Query  467   RCVPVGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgle  297
               +P GPL+     + A  E   +  WLD +   S V VSFGSEYF+TE+++ E+A GLE
Sbjct  237   EIIPCGPLLVDSGEVSAGSEADGVMRWLDGQEPGSVVLVSFGSEYFMTEKQLAEMARGLE  296

Query  296   LSKVNFLWVIRFPA----AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHS  129
             LS   F+WV+RFP      +  +   A   A+P G+      RG VVEGWAPQ  +L H 
Sbjct  297   LSGAAFVWVVRFPQQSPDGDEDDHGAAAARAMPPGF---APARGLVVEGWAPQRRVLSHR  353

Query  128   SIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             S G F++HCGWSSVME++  GVP++A+P+ +DQP+ A + A
Sbjct  354   SCGAFLTHCGWSSVMESMSAGVPMVALPLHIDQPVGANLAA  394



>ref|NP_001060603.1| Os07g0672700 [Oryza sativa Japonica Group]
 dbj|BAC15998.1| putative Flavonol 3-O-glucosyltransferase(UDP-glucose flavonoid 
3-O-glucosyltransferase) [Oryza sativa Japonica Group]
 dbj|BAF22517.1| Os07g0672700 [Oryza sativa Japonica Group]
Length=474

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 237/401 (59%), Gaps = 24/401 (6%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKR-----NFYIYICSTPVNLSSIKKRV  996
             M  ++R  +RVLMFPWLAHGHI P+L LA  LT       +  +++ STPVNL+++  R 
Sbjct  1     MAQAERERLRVLMFPWLAHGHINPYLELATRLTTTSSSQIDVVVHLVSTPVNLAAVAHRR  60

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
             +++    I LVEL LP LP LPP  HTT  LPP LMP LK+A D++ P F  LLD L PD
Sbjct  61    TDR----ISLVELHLPELPGLPPALHTTKHLPPRLMPALKRACDLAAPAFGALLDELSPD  116

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH----VGRGHPAEEYPFPELYLR  648
             +V+YDF+QPW P  AAA+ +PAV F +  AAA ++  H     G G     +PF  + L 
Sbjct  117   VVLYDFIQPWAPLEAAARGVPAVHFSTCSAAATAFFLHFLDGGGGGGGRGAFPFEAISLG  176

Query  647   DHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
               E      +    +     +   ER+      SS  + +KT  ++E KY+D LS LV K
Sbjct  177   GAEEDARYTMLTCRDDGTALLPKGERLPLSFARSSEFVAVKTCVEIESKYMDYLSKLVGK  236

Query  467   RCVPVGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgle  297
               +P GPL+     + A  E   +  WLD +   S V VSFGSEYF+TE+++ E+A GLE
Sbjct  237   EIIPCGPLLVDSGDVSAGSEADGVMRWLDGQEPGSVVLVSFGSEYFMTEKQLAEMARGLE  296

Query  296   LSKVNFLWVIRFPA----AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHS  129
             LS   F+WV+RFP      +  +   A   A+P G+      RG VVEGWAPQ  +L H 
Sbjct  297   LSGAAFVWVVRFPQQSPDGDEDDHGAAAARAMPPGF---APARGLVVEGWAPQRRVLSHR  353

Query  128   SIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             S G F++HCGWSSVME++  GVP++A+P+ +DQP+ A + A
Sbjct  354   SCGAFLTHCGWSSVMESMSAGVPMVALPLHIDQPVGANLAA  394



>gb|EPS70318.1| hypothetical protein M569_04442, partial [Genlisea aurea]
Length=354

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 227/366 (62%), Gaps = 13/366 (4%)
 Frame = -3

Query  1103  GHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPSLPDLPPH  924
             GH+ PF  LA+ L+K+NF  YICSTP+NL SI+   S+ D   ++L+EL++P  P+LPP 
Sbjct  1     GHLSPFYELAKRLSKKNFKTYICSTPINLVSIQA-ASDSD---VELIELRMPPSPELPPE  56

Query  923   YHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVL  744
              HTT   P  L   L K L + K  F  +L ++KPD+++YDFLQPW    A++  IP+V 
Sbjct  57    LHTTRNAPADLTRPLMKKLHLFKSIFFEILTSIKPDILIYDFLQPWSTKQASSMGIPSVY  116

Query  743   FLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERID  564
             F +   A  SY  H+      E+YPF  +YL DHE        E       D+ D   ID
Sbjct  117   FATTSTAFHSYYHHLYTNGSTEKYPFKAIYLHDHESCDT----EDINNFIQDIGDGLTID  172

Query  563   GCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIKEWLDMK  384
                +  + I+L+K++ Q+E KY+  LS L+K + V  GPL+    +  ++ EI  WL+ +
Sbjct  173   DFFNLPTEIMLLKSYGQVETKYVSHLSALIKTKMVLTGPLIAE--STEKSNEIINWLNDQ  230

Query  383   PRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEG  204
              + S +++SFGSEYF +EEE+ E++  LELS+V F+WVIRFP     E    + D LPEG
Sbjct  231   QQFSVIYISFGSEYFASEEEIYEISKALELSRVKFIWVIRFPIT---ENKTFLKDVLPEG  287

Query  203   YLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPL  24
             +++R    G VV  WAPQ  IL H S+G F+SHCGWSSV E+L FGVPIIAMPM+ DQ +
Sbjct  288   FIDRSKDNGIVVNEWAPQIKILSHPSVGAFISHCGWSSVTESLYFGVPIIAMPMRGDQLI  347

Query  23    NARVVA  6
             NAR++ 
Sbjct  348   NARLLV  353



>ref|XP_009804830.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana sylvestris]
Length=466

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/381 (42%), Positives = 232/381 (61%), Gaps = 16/381 (4%)
 Frame = -3

Query  1133  RVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIK----KRVSEKDAISIKL  966
             ++LM P +AHGH  PF  LA+ L+K NF+IY+CST   LS +K    K  S+    +I+L
Sbjct  13    KILMVPMIAHGHATPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFSDVSNTNIEL  72

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPS+PDLP HY +T GLP HL P L  A  M+   F  +++ L PDL++ DF Q W
Sbjct  73    VELHLPSMPDLPSHYQSTKGLPNHLYPPLFTAYKMAGESFSIIVNNLSPDLIIEDFFQAW  132

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYLRDHEFIRNKRLFEP  609
              P +A +++IP V F    AA+ S+++H+     A ++YPFPE+ L ++E I    + +P
Sbjct  133   APDIALSKNIPIVSFSVVSAASYSFMYHIYLSDGATDDYPFPEICLSNNE-IEIGLVSKP  191

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSL-  432
                      +   +      S  I+LI  +++ E KY+  LS+++ K+ + VGPL+    
Sbjct  192   TGSSITVFMEKILVYSARKKSCDIVLINNWKETEVKYMQYLSSIINKKTLSVGPLIGQTD  251

Query  431   --VADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFP  258
                 D ++ +I EWLD +   STV+  FGSE   ++E ++E+A G+ELS VNFLWV+RFP
Sbjct  252   ESTQDDQDSDIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGIELSNVNFLWVLRFP  311

Query  257   AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEA  78
              +E       +   LPEG+L RV +RG VV  W P   I+ H SIGGF++HCGW+S +E 
Sbjct  312   GSE-------VEQVLPEGFLNRVKERGMVVSRWVPHAKIMRHKSIGGFLNHCGWNSTVEC  364

Query  77    LKFGVPIIAMPMQLDQPLNAR  15
             + FGVP+IAMP  +DQ + A 
Sbjct  365   IHFGVPLIAMPFNMDQFITAN  385



>ref|XP_008670653.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Zea mays]
 tpg|DAA41728.1| TPA: hypothetical protein ZEAMMB73_462265 [Zea mays]
Length=470

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/416 (43%), Positives = 244/416 (59%), Gaps = 58/416 (14%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKRN-----FYIYICSTPVNLSSIKKRV  996
             M  ++R  + V+MFPWLAHGHI P+L LA+ LT  +       +++ STPVNLS+I ++ 
Sbjct  1     MAQAEREHLSVVMFPWLAHGHITPYLELARRLTSEDGGDVDVTVHLVSTPVNLSAIARQQ  60

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
             + +    I+ VEL LP+  DLPP  HTT  LP  LMP LK+A D++ P F  LLD L+PD
Sbjct  61    TPR----IRFVELHLPAALDLPPALHTTKHLPARLMPALKRACDLAAPRFGALLDELRPD  116

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH---------------VGRGHPA  681
             L+++DFL PW P  AA++ +PAV   +  AAA S++ H               VG G   
Sbjct  117   LLLFDFLYPWAPLEAASRGVPAVHLSTCSAAATSFMVHWFGSARAGRAFPFQGVGLGGAE  176

Query  680   EEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGK  501
             EE  +  L LR+H               DG V + +R+   L  SS  + IKT   +E  
Sbjct  177   EEAKYTSLLLREHP--------------DGLVPERDRLLLSLARSSGFVAIKTCADIERP  222

Query  500   YIDQLSNLV-KKRCVPVGPLVRSLVADGENP----------EIKEWLDMKPRCSTVFVSF  354
             Y+  LS L+  K  VP+GP    L+ DG +            +  WLD++P  S V VSF
Sbjct  223   YMGYLSELLGGKEMVPIGP----LLVDGSDTGGGTTSPDPDRVTRWLDLQPPASVVLVSF  278

Query  353   GSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGK  174
             GSEYF++E+++  +A GLELS   F+WV+RFP  + G+ A     ALP G+    G RG 
Sbjct  279   GSEYFMSEQQLARMARGLELSGERFVWVVRFPKGDEGDAA---ARALPRGFAPAPG-RGL  334

Query  173   VVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             VVEGWAPQ  +LEH + G F+SHCGWSSV+E+L  GVPI+A+P+ +DQPL+A + A
Sbjct  335   VVEGWAPQRRVLEHPACGAFLSHCGWSSVLESLAAGVPIVALPLHIDQPLDANLAA  390



>ref|XP_009793589.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=333

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 206/296 (70%), Gaps = 10/296 (3%)
 Frame = -3

Query  890  MPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSY  711
            M TLK+A D++ P F  +L TLKPDL++YDFLQPW P  AA   IPAV F+S  +   SY
Sbjct  1    MNTLKEAFDLASPDFTLILKTLKPDLLIYDFLQPWAPKAAAELKIPAVEFISSSSTMTSY  60

Query  710  LFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFE--PPEQIDGDVSDTERIDGCLDGSSSI  537
            + HV    P  ++PF  +Y RD+E  R ++     P E+++    D +R+  C   SS I
Sbjct  61   MLHVF-NKPGIKFPFSSIYYRDYEIARIEKDESSMPMEKLE---EDKKRVRDCFYLSSDI  116

Query  536  ILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIKEWLDMKPRCSTVFVS  357
            +LIK+F+++EGKY D ++N   K+ VPVGPLV+    D    E+  WL+ K   ST+FVS
Sbjct  117  VLIKSFKEIEGKYSDYVTNSTGKKVVPVGPLVQEPTLDDGESELITWLNEKEEKSTIFVS  176

Query  356  FGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRG  177
            FGSEYFL++E++ E+A GLE SKVNF+W IRF   +  E    + +ALP+G+  RVG RG
Sbjct  177  FGSEYFLSKEDLLEIACGLENSKVNFIWPIRFQKGKDVE----LQEALPKGFFNRVGNRG  232

Query  176  KVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
            KV +GWAPQ  ILEHSSIGGFVSHCGWSSVME++K+GVPIIAMPM +DQP+N+R+V
Sbjct  233  KVFKGWAPQAKILEHSSIGGFVSHCGWSSVMESMKYGVPIIAMPMHIDQPINSRLV  288



>ref|XP_004250483.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=437

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 236/380 (62%), Gaps = 18/380 (5%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + +++VLMFPWLA+GHI PFL LA  L  R F + +CST ++  +I K++ EK + SIK+
Sbjct  10    RNALKVLMFPWLAYGHISPFLDLAMKLADRGFSVRVCSTIISCDTINKQIPEKYSASIKM  69

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LP L    P    TN +P  L   + + L +SK  F  +L  LKPDLV+YD L  W
Sbjct  70    VELCLPKL--FKP---ITNEIPVDLDHIVLETLKLSKSNFAKILQKLKPDLVIYDLLLQW  124

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPP  606
                +A  Q I A+ F+  GAA  SY +   R  P  E+PF ++Y   +E ++   L    
Sbjct  125   AEGVAKKQGILAMKFVVMGAAVFSYFYTTIR-KPEVEFPFHDIYPGQNELMKLNELIAES  183

Query  605   EQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVA  426
              +I+      +  D   +G+  ++L+ T R +EGKYID  + L   + +PVG  +++ V 
Sbjct  184   SRIE------KYEDAFAEGNIQVMLMSTSRTIEGKYIDYFTKLSNWKVIPVGLPIKNRVT  237

Query  425   DGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEA  246
             +  + E+ +WL  K   ST+ VSFG+EY L++EE EE+A GLELS VNF+WV+RFP  E 
Sbjct  238   N--DVEVIDWLGTKDEGSTILVSFGNEYILSKEEAEELAFGLELSNVNFVWVVRFPERET  295

Query  245   GEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFG  66
                 R + D LP+G+ ER+G+RG V++    +  IL HSSIGGFVS CGW +V+E L FG
Sbjct  296   ----RNLEDVLPKGFFERIGERGSVLDKCVLRSRILNHSSIGGFVSPCGWHNVIECLDFG  351

Query  65    VPIIAMPMQLDQPLNARVVA  6
             VPIIAMP+ LDQP+NA+++ 
Sbjct  352   VPIIAMPIHLDQPMNAKLMV  371



>gb|AHK12771.1| flavanone-O-beta-L-rhamnosyltransferase-like protein 2 [Litchi 
chinensis]
Length=466

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 243/394 (62%), Gaps = 33/394 (8%)
 Frame = -3

Query  1157  MDTSQR-SIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKK-----RV  996
             M+  QR ++ V+M P LAHGH+ PF  LA+ L+ R F IY CSTP+ L  I+        
Sbjct  1     MEIKQRKAMSVVMLPHLAHGHVSPFFELAKRLSDRGFQIYFCSTPICLEPIRNNHLDDHH  60

Query  995   SEKDAISIKLVELQLPS--LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLK  822
             ++  + +I+L++LQLPS    DLPPHYH T  +PPHLM TL  ALD +KP F ++L  L+
Sbjct  61    NKHSSSNIQLIDLQLPSSFHQDLPPHYHCTKNIPPHLMTTLLAALDATKPAFSDILKKLR  120

Query  821   PDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDH  642
             PDLVVYD  +PW    A   +I AVLFL+  A+    +          E P      ++ 
Sbjct  121   PDLVVYDLFEPWAAEAARELNIDAVLFLTNIASQNVRI----------ETP------KET  164

Query  641   EFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYI---DQLSNLVK  471
             E  +    +     ++G ++ T+R +  + GSS +IL+KT R+++ KY     Q    + 
Sbjct  165   EMSKEYIEYTIKNTVNG-ITPTQRFNRSVTGSSHMILVKTSREIQAKYYKDGKQPHLAIL  223

Query  470   KRCVPVGPLVRSLVADGENPE-IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL  294
             +  V VGPLV+      +  E + +WL  K   S V+VS GSE FL+EEEMEE+A GLEL
Sbjct  224   RPLVHVGPLVQKPQDHHDGDEKLMDWLSKKEAASVVYVSIGSENFLSEEEMEEMAKGLEL  283

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGF  114
             S V+F+WV+RF     G    +I +ALP+ +LER+  RG +V+ WAPQ  +L H+S GGF
Sbjct  284   SNVDFIWVVRF---HGGSNVASIHEALPQSFLERINGRGLIVD-WAPQAKVLAHASTGGF  339

Query  113   VSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
             VSHCGW+S +E++ +GVPIIA+P+QLDQPLNA++
Sbjct  340   VSHCGWNSTLESMMYGVPIIAIPIQLDQPLNAKL  373



>gb|EMS55799.1| Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase [Triticum 
urartu]
Length=436

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 230/381 (60%), Gaps = 32/381 (8%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKR------NFYIYICSTPVNLSSIKKRVSE  990
               +  +RV+MFPWLAHGHI P+L LA+ L         +  +++ STP NL+ +    ++
Sbjct  4     AERECMRVVMFPWLAHGHINPYLELAKRLVAASPDDHLDVVVHLVSTPANLAPLAHHQTD  63

Query  989   KDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLV  810
             +    I+LVEL LP+LP LPP  HTT GLP HLMP LK+A D++ P F  LLD L PD+V
Sbjct  64    R----IRLVELHLPALPGLPPALHTTKGLPAHLMPALKRACDLAAPRFGALLDQLCPDIV  119

Query  809   VYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYL--RDHE  639
             VYDFLQPW P  AAA+ +PAV F +  AAA +++ H  +   A   +PF  + L   D +
Sbjct  120   VYDFLQPWAPLEAAARGVPAVHFNTFSAAAKAFVVHCLKTERAPSAFPFETISLGGADED  179

Query  638   FIRNKRLFEPPEQIDGD--VSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKR  465
                  RL     + DG   + + +R+   L+ SS  + IKT   +E KY+D LS LV K 
Sbjct  180   AKYTARLI---SRDDGTAMIPERDRLPLSLERSSGFVAIKTCADIERKYVDYLSQLVGKE  236

Query  464   CVPVGPLVRSLVADG------ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg  303
              VP GPL   LV  G      +   I  WLD K   S V VSFGSEYF+++ +M ++A G
Sbjct  237   VVPTGPL---LVDSGGSEAKRDGGRIMRWLDGKEPGSVVLVSFGSEYFMSDRQMAQMARG  293

Query  302   leLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSI  123
             LELS+V +LWV+RFP AE  + AR    ++P G+      RG VVEGWAPQ  IL H S 
Sbjct  294   LELSRVPYLWVVRFPNAE--DDARGAARSMPRGFKP---ARGLVVEGWAPQWRILSHRSC  348

Query  122   GGFVSHCGWSSVMEALKFGVP  60
             G F++HCGWSSV+E++  GVP
Sbjct  349   GAFLTHCGWSSVLESMASGVP  369



>ref|NP_001147268.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
 gb|ACG26485.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=480

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 172/401 (43%), Positives = 238/401 (59%), Gaps = 35/401 (9%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRN-----FYIYICSTPVNLSSIKKRVSEKDAISI  972
             + V+MFPWLAHGH+ P+L LA+ LT  N       +++ STPVNLS+I +  + +    I
Sbjct  9     LSVVMFPWLAHGHVTPYLKLARRLTSANDADIDVTVHLVSTPVNLSAIARHQTPR----I  64

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             +  EL LP+ PDLPP  HTT  LP  LMP LK+A D++ P F  LLD ++PDL+++DFL 
Sbjct  65    RFAELHLPAAPDLPPELHTTKHLPARLMPALKRACDLAAPRFGALLDEIRPDLLLFDFLY  124

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRG-HPAEEYPFPELYLRDHE----FIR  630
             PW P  AAA+ +PA    +  AAA S++ H +GRG      +PF  +     E    ++ 
Sbjct  125   PWAPLEAAARGVPAAHLSTFSAAATSFVVHCLGRGRREGCAFPFRGVGFGSAEEEAKYMA  184

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLV--KKRCVP  456
                L E  E  D  V +  R+   L  SS+ + +KT   +E  Y+D LS LV   K  VP
Sbjct  185   QYILRE--ELPDALVPERNRLLLSLARSSAFVAVKTCADVERPYMDYLSELVGGNKEMVP  242

Query  455   VGPLV-----------RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeeva  309
             VGPL+               ++ E+  +  WLD +   S V V FGSEYF++E+++  +A
Sbjct  243   VGPLLVDADAAAAAAGGGTSSESESDRVMRWLDAQTPASVVLVCFGSEYFMSEQQLARMA  302

Query  308   lgleLSKVNFLWVIRFP-AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEH  132
              GLELS   F+WV+RFP   E G++A     ALP G+    G RG VVEGWAPQ  IL H
Sbjct  303   RGLELSGERFVWVVRFPRETEEGDEA---ARALPRGFAPAPG-RGLVVEGWAPQRRILAH  358

Query  131   SSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
              + G F+SHCGWSSV+E+L  GVPI+A+P+ +DQPL+A + 
Sbjct  359   PACGAFLSHCGWSSVLESLAAGVPIVALPLHIDQPLDANLA  399



>tpg|DAA64088.1| TPA: anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=480

 Score =   276 bits (706),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 172/401 (43%), Positives = 238/401 (59%), Gaps = 35/401 (9%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRN-----FYIYICSTPVNLSSIKKRVSEKDAISI  972
             + V+MFPWLAHGH+ P+L LA+ LT  N       +++ STPVNLS+I +  + +    I
Sbjct  9     LSVVMFPWLAHGHVTPYLELARRLTSANDADIDVTVHLVSTPVNLSAIARHQTPR----I  64

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
             +  EL LP+ PDLPP  HTT  LP  LMP LK+A D++ P F  LLD ++PDL+++DFL 
Sbjct  65    RFAELHLPAAPDLPPELHTTKHLPARLMPALKRACDLAAPRFGALLDEIRPDLLLFDFLY  124

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRG-HPAEEYPFPELYLRDHE----FIR  630
             PW P  AAA+ +PA    +  AAA S++ H +GRG      +PF  +     E    ++ 
Sbjct  125   PWAPLEAAARGVPAAHLSTFSAAATSFVVHCLGRGRREGCAFPFRGVGFGSAEEEAKYMA  184

Query  629   NKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLV--KKRCVP  456
                L E  E  D  V +  R+   L  SS+ + +KT   +E  Y+D LS LV   K  VP
Sbjct  185   QYILRE--ELPDALVPERNRLLLSLARSSAFVAVKTCADVERPYMDYLSELVGGNKEMVP  242

Query  455   VGPLV-----------RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeeva  309
             VGPL+               ++ E+  +  WLD +   S V V FGSEYF++E+++  +A
Sbjct  243   VGPLLVDADAAAAAAGGGTSSESESDRVMRWLDAQTPASVVLVCFGSEYFMSEQQLARMA  302

Query  308   lgleLSKVNFLWVIRFP-AAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEH  132
              GLELS   F+WV+RFP   E G++A     ALP G+    G RG VVEGWAPQ  IL H
Sbjct  303   RGLELSGERFVWVVRFPRETEEGDEA---ARALPRGFAPAPG-RGLVVEGWAPQRRILAH  358

Query  131   SSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
              + G F+SHCGWSSV+E+L  GVPI+A+P+ +DQPL+A + 
Sbjct  359   PACGAFLSHCGWSSVLESLAAGVPIVALPLHIDQPLDANLA  399



>gb|KCW87408.1| hypothetical protein EUGRSUZ_B03886 [Eucalyptus grandis]
Length=346

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/376 (41%), Positives = 201/376 (53%), Gaps = 108/376 (29%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAI-SIKLVELQLP  948
             M PWLAHGHI PFL L + L+ R+F+IY CSTP+NL  ++  +  +D + SI+LV+L LP
Sbjct  1     MLPWLAHGHISPFLELGKKLSHRDFHIYFCSTPINLKPLRDTILAQDCVPSIQLVDLHLP  60

Query  947   S--LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
             S   P LPPHYHTT  LPPHLM TLK A + +K  F ++L +LKPDLV++D+LQPW    
Sbjct  61    SDEFPQLPPHYHTTKDLPPHLMSTLKSAFNSAKSSFFDILGSLKPDLVIFDYLQPWASVA  120

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A+  +I AV                                        +R +E      
Sbjct  121   ASELNINAV--------------------------------------NKERFWE------  136

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRS-LVADGE  417
                        C++ SS+I+LIKT R  EGKY+D LS LVK++ V VGPL++     DG+
Sbjct  137   -----------CMERSSNIVLIKTSRVTEGKYVDYLSELVKRKVVTVGPLLQEPANKDGD  185

Query  416   NPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEK  237
               ++ E+                                                  GE 
Sbjct  186   GEKVMEF------------------------------------------------HGGED  197

Query  236   ARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPI  57
                I +ALP+G+L+R+G RG VVEGWAPQ  IL H SIGGFVSHCGWSS +EA+ FGVPI
Sbjct  198   V-TIHEALPQGFLQRIGDRGLVVEGWAPQAEILGHPSIGGFVSHCGWSSTLEAILFGVPI  256

Query  56    IAMPMQLDQPLNARVV  9
             +AMPM LDQPLNA++V
Sbjct  257   LAMPMHLDQPLNAKLV  272



>ref|XP_003559812.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Brachypodium 
distachyon]
Length=479

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 235/403 (58%), Gaps = 42/403 (10%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNF-----YIYICSTPVNLSSIKKRVSEK  987
               +  + VLMFPWLAHGH+ P+L LA+ L   +F      +++ STP NL+ I    +  
Sbjct  4     AERERLSVLMFPWLAHGHVTPYLELARRLVATSFPNLDVVVHLVSTPANLAHI---ATPS  60

Query  986   DAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVV  807
                ++ LVE++LP+  +LP   HTT  LPP LMP LK A D++ P F  L+D L+PDLV+
Sbjct  61    LPSNLHLVEIRLPA-EELPASLHTTKRLPPRLMPALKHACDLAAPRFGALIDELRPDLVL  119

Query  806   YDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA-EEYPFPELYL----RDH  642
             YDFLQPW P  AA++ +PA  F +  AAA ++  H  R   +   +PF  + L    +D 
Sbjct  120   YDFLQPWAPLEAASRGVPAAHFSTCSAAATAFFLHCLRTDQSPSAFPFDAISLGGAAQDA  179

Query  641   EFI-------RNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLS  483
              +        R K    PP      V + +R+   LD S+  + +KT   +E KY+D LS
Sbjct  180   RYTALLASAGRGKDDDSPPPL----VPERDRLPLSLDRSTVFVAVKTCADIERKYMDYLS  235

Query  482   NLVKKRCVPVGPLVRSLVAD------GENPE---IKEWLDMKPRCSTVFVSFGSEYFlte  330
              L  K  VPVGPL   LV D      GE+ E   I  WLD +   S V VSFGSEYFL+E
Sbjct  236   QLTGKEIVPVGPL---LVHDDPRNPGGESSEEDAIMAWLDGEDPGSVVLVSFGSEYFLSE  292

Query  329   eemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQ  150
              +M ++A GLELS   FLWV+RFP  +    +     +LP  Y      RGKVV+GWAPQ
Sbjct  293   RQMAQMARGLELSGAPFLWVVRFP--DDDNDSSGAARSLPRDY---APARGKVVQGWAPQ  347

Query  149   GMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLN  21
              ++L H + G F++HCGWSSV+EA+  GVP++A+P+ +DQPLN
Sbjct  348   RLVLAHGACGAFLTHCGWSSVLEAMAVGVPMVALPLHIDQPLN  390



>ref|XP_006424314.1| hypothetical protein CICLE_v10030045mg, partial [Citrus clementina]
 gb|ESR37554.1| hypothetical protein CICLE_v10030045mg, partial [Citrus clementina]
Length=399

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 149/338 (44%), Positives = 216/338 (64%), Gaps = 17/338 (5%)
 Frame = -3

Query  1001  RVSEKDAISIKLVELQLP-SLPDL-PPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDT  828
             ++S K + SI+L++LQLP + P+L  P+ HTT  +P HL+PTL +A D +KP F N+L+T
Sbjct  1     KISRKISTSIQLIDLQLPCTFPELHDPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLET  60

Query  827   LKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLR  648
             LKP LV+YD  QPW    A    I AV F++  AA+ S+       + + ++PFPE  L 
Sbjct  61    LKPTLVIYDLFQPWAAEAAYQHDIAAVAFVTIAAASFSFFLQ----NSSLKFPFPEFDLP  116

Query  647   DHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
             + E    +++ +   +I     + +R    +D S  ++L+KT R++E K +  LS + KK
Sbjct  117   ESEI---QKMTQFKHRIVNGTENRDRFLKAIDLSCKLVLVKTSREIESKDLHYLSYITKK  173

Query  467   RCVPVGPLVRSLVADGENPEIK--EWLDMKPRCSTVFVSFGSEYFlteeemeevalgleL  294
               +PVGPLV+  +    N + K  +WL  K   S V+VSFGSEYFL++EEM E+A GL L
Sbjct  174   ETIPVGPLVQEPIYTDNNNDTKIMDWLSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLL  233

Query  293   SKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERV--GKRGKVVEGWAPQGMILEHSSIG  120
             S+V+F+WV+RF +    E    I +ALP+G+ E +    +G VV+GWAPQ  IL H SIG
Sbjct  234   SEVSFIWVVRFHS----EGNFTIEEALPQGFAEEIQGNNKGMVVQGWAPQAKILGHGSIG  289

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
             GF+SHCGW S +E + +GVPIIA+PM LDQ  NA++VA
Sbjct  290   GFISHCGWGSTVEGIMYGVPIIAVPMVLDQLFNAKMVA  327



>ref|XP_002311964.1| hypothetical protein POPTR_0008s02530g [Populus trichocarpa]
 gb|EEE89331.1| hypothetical protein POPTR_0008s02530g [Populus trichocarpa]
Length=349

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 179/275 (65%), Gaps = 19/275 (7%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA  981
             M+TS +S IRVLMFPWLA+ HI  FL LA+ L+KRNFYIY+CSTP NL+ IK++      
Sbjct  1     METSSKSNIRVLMFPWLAYSHIHAFLELAKKLSKRNFYIYLCSTPANLAYIKEKEP----  56

Query  980   ISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYD  801
              S++ VEL LPSLP+LPPHYHTT GLP HL+  L KALDMS   F  +L  LKPDL++ D
Sbjct  57    -SVEFVELHLPSLPELPPHYHTTKGLPRHLLSNLMKALDMSSCSFSGILTALKPDLLISD  115

Query  800   FLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKR  621
             FLQPW PA A +  IP VLF+   A    +L  + +   +   P    Y  ++++     
Sbjct  116   FLQPWAPAKALSLKIPTVLFMVSAAMPYCFLLDLVKISGSTALPLRSNYPHEYDY-----  170

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
                     + +++  +R+  CL+GSS+++LI++ R+LEGKY+D+LS L  K+ V VGPLV
Sbjct  171   -------ENDNLTLQDRLLQCLEGSSNLMLIRSLRELEGKYVDELSVLAMKKIVLVGPLV  223

Query  440   RSLV-ADGENPEIKEWLDMKPRCSTVFVSFGSEYF  339
             + L   + E  EI EWL+ K  CS +FVSFGSE +
Sbjct  224   QELSEEENEKTEIIEWLNKKDPCSVLFVSFGSECY  258



>ref|XP_008366513.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=291

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 164/237 (69%), Gaps = 6/237 (3%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIK  969
              RSI +LM PWL HGHI PFL LA+ LT +R+F+I ICSTPVNLSSIK ++ +K +  I+
Sbjct  7     HRSISILMLPWLGHGHISPFLELAKKLTDRRDFHILICSTPVNLSSIKPKLPQKYSHCIE  66

Query  968   LVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQP  789
              VEL LP   +LPPHYHTTNGLPPHLMPTLKKA DMS   F ++L TLKPDL++YDFLQP
Sbjct  67    FVELHLPH-DELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILRTLKPDLLIYDFLQP  125

Query  788   WVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEP  609
             W P++A++ +IPAV F +  AA  S+  H  +  P   +P+P +YLRD+E    K+    
Sbjct  126   WAPSLASSHNIPAVEFFTTSAAVISFSVHHLKN-PNVIFPYPSIYLRDYE---TKKFSSV  181

Query  608   PEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVR  438
              E     + D E    C D S +IIL+KT  ++E KYID LS L++K+ VPVG LV+
Sbjct  182   LESSANGIKDVESALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVGSLVQ  238



>gb|AGO03780.1| truncated non-smoky glycosyltransferase 2 [Solanum lycopersicum]
Length=362

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/336 (42%), Positives = 206/336 (61%), Gaps = 14/336 (4%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDA---IS  975
             + S  +L+FPWL  GH+ PFL LA+ L+K NF+IY  STP+ L SIK+ + +       S
Sbjct  6     ENSPSILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKETLDKNSTNYNQS  65

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I+LVE  LP L +LPPHYHTT  LPPHL  TL +A  M+   F ++++TLKP+L++YD  
Sbjct  66    IQLVEFHLPYLHELPPHYHTTKDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYDGF  125

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFH--VGRGHPAEEYPFPELYLRDHEFIRNKR  621
             QPWV  MA++ SI A++F     +  +Y++H  +        +PF  +YL DHE    K+
Sbjct  126   QPWVATMASSYSIHAIMFYVSSTSGLAYIYHQFLHGSSSLTSFPFSSIYLHDHEI---KK  182

Query  620   LFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV  441
             L   P +   + +    I    + S +I+L+ T R+ EGKYID +S + KK  +P+GPL+
Sbjct  183   LGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCRETEGKYIDYVSTIGKKELIPIGPLI  242

Query  440   RSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVI  267
             R  + D E     I+ WLD K + S V+VSFGSE FL+++E+EE+A GLELSKVNF+W I
Sbjct  243   REAMIDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFLSKQEIEEIAKGLELSKVNFIWTI  302

Query  266   RFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGW  159
             +FP        + I + +P+G+LE      +  + W
Sbjct  303   KFPKG----VNKTIEEMVPQGFLESTKSNFEPFKYW  334



>ref|XP_010326752.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=347

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 191/289 (66%), Gaps = 11/289 (4%)
 Frame = -3

Query  863  MSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH--VGRG  690
            M+   F ++++TLKP+L++YD  QPWV  MA++ SI A++F     +  +Y++H  +   
Sbjct  1    MASSKFPSIIETLKPNLIIYDGFQPWVATMASSYSIHAIMFYVSSTSGLAYIYHQFLHGS  60

Query  689  HPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQL  510
                 +PF  +YL DHE    K+L   P +   + +    I    + S +I+L+ T R+ 
Sbjct  61   SSLTSFPFSSIYLHDHEI---KKLGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCRET  117

Query  509  EGKYIDQLSNLVKKRCVPVGPLVRSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFl  336
            EGKYID +S + KK  +P+GPL+R  + D E     I+ WLD K + S V+VSFGSE FL
Sbjct  118  EGKYIDYVSTIGKKELIPIGPLIREAMIDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFL  177

Query  335  teeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWA  156
            +++E+EE+A GLELSKVNF+W I+FP        + I + +P+G+LE    +G V+EGWA
Sbjct  178  SKQEIEEIAKGLELSKVNFIWTIKFPKG----VNKTIEEMVPQGFLESTKGKGMVIEGWA  233

Query  155  PQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
            PQ +IL HSSIGGF++HCGW+S++E++ FG+PIIAMPM  DQPLN+R+V
Sbjct  234  PQSLILNHSSIGGFITHCGWNSILESMSFGIPIIAMPMNHDQPLNSRLV  282



>gb|AGO03778.1| truncated non-smoky glycosyltransferase 1 [Solanum lycopersicum]
Length=348

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 191/289 (66%), Gaps = 11/289 (4%)
 Frame = -3

Query  863  MSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH--VGRG  690
            M+   F ++++TLKP+L++YD  QPWV  MA++ SI A++F     +  +Y++H  +   
Sbjct  1    MASSKFPSIIETLKPNLIIYDGFQPWVATMASSYSIHAIMFYVSSTSGLAYIYHQFLHGS  60

Query  689  HPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQL  510
                 +PF  +YL DHE    K+L   P +   + +    I    + S +I+L+ T R+ 
Sbjct  61   SSLTSFPFSSIYLHDHEI---KKLGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCRET  117

Query  509  EGKYIDQLSNLVKKRCVPVGPLVRSLVADGENP--EIKEWLDMKPRCSTVFVSFGSEYFl  336
            EGKYID +S + KK  +P+GPL+R  + D E     I+ WLD K + S V+VSFGSE FL
Sbjct  118  EGKYIDYVSTIGKKELIPIGPLIREAMIDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFL  177

Query  335  teeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWA  156
            +++E+EE+A GLELSKVNF+W I+FP        + I + +P+G+LE    +G V+EGWA
Sbjct  178  SKQEIEEIAKGLELSKVNFIWTIKFPKG----VNKTIEEMVPQGFLESTKGKGMVIEGWA  233

Query  155  PQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
            PQ +IL HSSIGGF++HCGW+S++E++ FG+PIIAMPM  DQPLN+R+V
Sbjct  234  PQSLILNHSSIGGFITHCGWNSILESMSFGIPIIAMPMNHDQPLNSRLV  282



>emb|CDP19775.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 190/291 (65%), Gaps = 15/291 (5%)
 Frame = -3

Query  863  MSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHP  684
            M+K  F N+L+TLKPDL+VYD  QPW   +AA   IP+VLFL  G    S ++H  R   
Sbjct  1    MAKTNFQNILNTLKPDLLVYDGFQPWASELAALNHIPSVLFLVVGTVNLSSVYHSRRCRV  60

Query  683  A---EEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQ  513
            +   E YPFP ++ RD+E  +     +  +  +GD  D  +    ++ SS I+L+K++R+
Sbjct  61   SGANETYPFPAIFYRDYEIKKILAKLQESKAKEGDEFDVFK---SIELSSDIVLVKSWRE  117

Query  512  LEGKYIDQLSNLVKKRCVPVGPLVR----SLVADGENPEIKEWLDMKPRCSTVFVSFGSE  345
            +EGKYID LS+   K+ + VGP       S  AD  +  I E+L+ K   S V+VSFGSE
Sbjct  118  MEGKYIDHLSSSCGKKLIAVGPFSNHEDDSKEADSYS-HIIEFLNSKDEASLVYVSFGSE  176

Query  344  YFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVE  165
            YFL++EE EE+A+GLELS  NF+WV+RFP   A      + +ALPE +LERV  RG VV 
Sbjct  177  YFLSKEEREEIAIGLELSNANFIWVVRFPVGHA----IGLEEALPERFLERVKGRGTVVN  232

Query  164  GWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARV  12
            GWAPQ  IL H S GGFVSHCGW SV+E++ +GVP++A+PM LDQPL+AR+
Sbjct  233  GWAPQAKILGHRSTGGFVSHCGWGSVIESIYYGVPLLALPMHLDQPLHARL  283



>ref|XP_007219845.1| hypothetical protein PRUPE_ppa027014mg, partial [Prunus persica]
 gb|EMJ21044.1| hypothetical protein PRUPE_ppa027014mg, partial [Prunus persica]
Length=213

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 154/217 (71%), Gaps = 7/217 (3%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALT-KRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLP  948
             M PWLAHGHI PFL LA+ LT KRNF+I+ICSTPVNL+SIK ++S K +  I+ VEL LP
Sbjct  1     MLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHCIEFVELYLP  60

Query  947   --SLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAM  774
                LP+LPP YHTTNGLPPHLM TLK+A DMS   F  +L  LKPDL++YDFLQPW P+ 
Sbjct  61    HDDLPELPPQYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTALKPDLLIYDFLQPWAPSQ  120

Query  773   AAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQID  594
             A+ Q+IP+V F++  AA  S+  H  R  P++++PFP +YLRD+E  +  RL    E   
Sbjct  121   ASLQNIPSVEFITTNAALTSFSVHHLRN-PSDKFPFPSIYLRDYEAKKFNRLL---ESSS  176

Query  593   GDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLS  483
               + D +R+  C D SS IIL+KT R++E KY+D LS
Sbjct  177   NGIKDGDRVQKCSDLSSDIILVKTSREIEAKYVDYLS  213



>ref|XP_006471419.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Citrus sinensis]
Length=401

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 192/309 (62%), Gaps = 15/309 (5%)
 Frame = -3

Query  920  HTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLF  741
            HTT  +P  L+PTL  A D +KP F N+L+TLKP LV+YD  QPW    A    I AV F
Sbjct  32   HTTKNIPRRLIPTLIAAFDAAKPSFCNVLETLKPTLVIYDLFQPWAAEAAYQHDIAAVAF  91

Query  740  LSPGAAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDG  561
            L+  AA+ S+       + + ++PFPE  L + E    +++ +   +I     + +R   
Sbjct  92   LTTAAASFSFFLL----NSSLKFPFPEFDLPESEI---QKMTQFKHRIVNGTENKDRFLE  144

Query  560  CLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPEIK--EWLDM  387
             +D S  ++LIKT R +E KY+D  S + KK  +PVGPLV+  V    N + K  +WL  
Sbjct  145  AVDLSCKLVLIKTSRDIESKYLDYFSYITKKETIPVGPLVQEPVYTDNNDDTKIMDWLSR  204

Query  386  KPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPE  207
            K   S V+VSFGSEYFL++EEM E+A GL LS+V+F+WV+RF +    E    I +ALP+
Sbjct  205  KEPSSVVYVSFGSEYFLSQEEMNEIASGLLLSEVSFIWVVRFHS----EGKFTIEEALPQ  260

Query  206  GYLERV--GKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLD  33
             + + +    +G VV+GWAPQ  IL H SIGGFVSHCGW S +E + +GVPIIA+PM LD
Sbjct  261  SFSKEIQGNNKGMVVQGWAPQAKILGHGSIGGFVSHCGWGSTVEGIMYGVPIIAVPMVLD  320

Query  32   QPLNARVVA  6
            Q  NA++VA
Sbjct  321  QLFNAKMVA  329



>ref|XP_009627944.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=354

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/315 (41%), Positives = 192/315 (61%), Gaps = 14/315 (4%)
 Frame = -3

Query  944  LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
            +PDLP HY +T GLP HL P+L KA  M+   F N+++ L PDL++ DF Q W P +A +
Sbjct  1    MPDLPSHYQSTKGLPNHLYPSLFKAFQMAGESFSNIVNNLNPDLIIEDFFQAWAPDIALS  60

Query  764  QSIPAVLFLSPGAAACSYLFHVG-RGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGD  588
            ++IP V F   GAA+ S+++H+       ++YPFPE+ L ++E I    + +P       
Sbjct  61   KNIPIVNFTVSGAASYSFMYHLYLHDGSTDDYPFPEMCLSNNE-IEIGLISKPTGSSITT  119

Query  587  VSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV----RSLVADG  420
              +   +      S+ IILI  +++ E KY+  LS +  K+ + VGPL+     S   D 
Sbjct  120  FLEKILVYSARKKSNDIILINNWKETEAKYMQYLSTITNKKILSVGPLIGQTDESTQYD-  178

Query  419  ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGE  240
            ++ +I EWLD +   STV+  FGSE   ++E ++E+A G+ELS VNFLWV+RFP +E   
Sbjct  179  QDSDIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGIELSDVNFLWVLRFPGSE---  235

Query  239  KARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVP  60
                +   LPEG+L RV +RG VV  W P   I+ H+SIGGF++HCGW+S +E + FGVP
Sbjct  236  ----VEQVLPEGFLNRVKERGMVVSRWVPHAKIMSHTSIGGFLNHCGWNSTVECIHFGVP  291

Query  59   IIAMPMQLDQPLNAR  15
            +IAMP  +DQ + A 
Sbjct  292  LIAMPFNMDQFITAN  306



>gb|AFJ53041.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
 gb|AGD95006.1| UDP-glucosyltransferase [Linum usitatissimum]
Length=379

 Score =   237 bits (604),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 192/312 (62%), Gaps = 22/312 (7%)
 Frame = -3

Query  890  MPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQS----IPAVLFLSPGAA  723
            MP LK+A D S+P F  +L  LKPDL+VYD LQPW  A AAA+S    I  VLF+  GAA
Sbjct  1    MPALKEAFDDSRPEFCKILKRLKPDLLVYDVLQPWA-AEAAAESNVVGIKCVLFVPGGAA  59

Query  722  ACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSS  543
              S+L H        +YP  +  +   E    KR   P    D    D +    C+  SS
Sbjct  60   CYSFLAHYSIKPAGAQYPLQDWGIASREGFLKKRATYPNGLRD---EDLDTYTDCMKRSS  116

Query  542  SIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLV-------RSLVADGENPEIKEWLD-M  387
             IILIKT R +E KYID LS L+ K  VPVGPLV       R+     ++ +I +WL+ +
Sbjct  117  DIILIKTSRNIEAKYIDYLSELLGKEVVPVGPLVNDKPEDHRTGAEGDDDNKILKWLNSI  176

Query  386  KPRCSTVFVSFGSEYFlteeemeevalgleLSK--VNFLWVIRFP----AAEAGEKARAI  225
                  V+VSFGSEYF ++EEM E+A GLE+++  + F+WV+RFP      E   K   +
Sbjct  177  DSDSPVVYVSFGSEYFPSKEEMGEIARGLEMNQALIRFIWVVRFPPDDHHREKNNKTLLL  236

Query  224  GDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMP  45
             +ALPEG+LERV  RG +VEGWAPQ  IL +  +GGFVSHCGWSSV+EA+ +GVPI+AMP
Sbjct  237  QEALPEGFLERVEGRGLLVEGWAPQAEILRNERVGGFVSHCGWSSVIEAVVYGVPIVAMP  296

Query  44   MQLDQPLNARVV  9
            MQLDQP NA +V
Sbjct  297  MQLDQPWNANLV  308



>emb|CDP12000.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 195/319 (61%), Gaps = 22/319 (7%)
 Frame = -3

Query  1154  DTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAIS  975
             +++ R  RVLMFPWLAHGH+ PFL L++ L K NF IY CST +NLS IKK  +  +  S
Sbjct  8     ESNTRRFRVLMFPWLAHGHMSPFLELSKRLAKNNFQIYFCSTEINLSFIKKDRNLDEYFS  67

Query  974   ---IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
                I+LV+L LP  P+LPPHYHTT  LP HL PTL  A  M +  F N+L+ L+PDL++Y
Sbjct  68    DHSIELVQLDLPHFPELPPHYHTTRNLPLHLNPTLHVAFYMGRTNFQNILNILQPDLLIY  127

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLF-----HVGRGHPAEEYPFPELYLRDHE  639
             D  Q W   +A+   IPAVLFL  GA   S+ +     + G       YPFP ++LRD+E
Sbjct  128   DMFQAWASELASMFHIPAVLFLGGGAVFWSWYYFYDINNKGYSDIDGTYPFPAIFLRDYE  187

Query  638   FIRNKRLFEPPEQIDGDVSD--TERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKR  465
                 K++    +++  +V +     +    + SS I+L+K  R+++GKYID LS+   K+
Sbjct  188   I---KKMAAFLQELKKNVPEEVVLSMTKGFEVSSDIVLLKACREIQGKYIDHLSSSRGKK  244

Query  464   CVPVGPLVRSLVADGENPE--------IKEWLDMKPRCSTVFVSFGSEYFlteeemeeva  309
              + VGPL+  L  DG   E        I E+L+ +   S V+V FGSEYFL+EEE EE+A
Sbjct  245   VLAVGPLIE-LKHDGTKMEEETENSSHIIEFLNGREESSVVYVCFGSEYFLSEEEREEMA  303

Query  308   lgleLSKVNFLWVIRFPAA  252
              GLELS  NF+WV+RFP  
Sbjct  304   YGLELSNANFVWVVRFPVG  322



>gb|ABR16160.1| unknown [Picea sitchensis]
Length=476

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 160/401 (40%), Positives = 223/401 (56%), Gaps = 25/401 (6%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKD-AIS  975
             T ++ +  L+FPWLA GHI PFL L++AL      +   STPVN+S I+  +  +D    
Sbjct  6     TGKKKVHFLLFPWLAQGHINPFLELSKALAIHGHKVSFLSTPVNISRIRPSLQLQDWPGQ  65

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I L+EL LP    L P    T  +P  +   LK ALD  +  F +LL  L PD +V+DF+
Sbjct  66    IDLMELPLPPTEGLTPGAECTADIPTEMAFPLKVALDGIEKPFRSLLRQLSPDYLVHDFV  125

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGH----PAEE-------YPFPELYLR  648
             Q W  + AA   +PA+ F     A+ +Y  H  +       AEE       +P   +  R
Sbjct  126   QYWTQSAAAEMQVPAIYFSIFPPASFAYALHPSKLRNQDITAEELAAPPFGFPSSVIRFR  185

Query  647   DHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
              HE    + L      I G ++   R   CL+G  ++IL   F + E KY+    + +  
Sbjct  186   LHE---ARDLLVMYRGIPGHIAPISRFAKCLEGCMAVILKSCF-EYEEKYMSYFEDALGV  241

Query  467   RCVPVGPLVRSLV--ADG---ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg  303
               + VGPL  +++  A G   ++ ++ EWLD +   S VFVSFGSE FL+E+++ E+ALG
Sbjct  242   PVLSVGPLTPAVLPGASGNGSDHSDLLEWLDRQREASVVFVSFGSEAFLSEDQIHELALG  301

Query  302   leLSKVNFLWVIRFPA-AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             LE S + FLW IRFP  ++ G     +    PEG+  R   RG VVEGW PQ  IL H S
Sbjct  302   LEASGLPFLWSIRFPRYSDGGHDPLGV---FPEGFQIRTQDRGLVVEGWVPQVQILSHRS  358

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             IGGF+SH GWSS ME+L FG+P+I +P+QLDQ LNAR +AA
Sbjct  359   IGGFLSHGGWSSAMESLSFGIPLIVLPIQLDQGLNARQIAA  399



>gb|ABR18376.1| unknown [Picea sitchensis]
Length=476

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 158/401 (39%), Positives = 223/401 (56%), Gaps = 25/401 (6%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKD-AIS  975
               ++ +  L+FPWLA GHI PFL L++AL      +   STPVN+S I+  +  +D    
Sbjct  6     NGKKKLHFLLFPWLAQGHINPFLELSKALAIHGHKVSFLSTPVNISRIRPSLQLQDWPGR  65

Query  974   IKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFL  795
             I L+EL LP    L P    T  +P  +   LK ALD  +  F +LL  L PD +V+DF+
Sbjct  66    IDLMELPLPPTEGLTPGAECTADIPTEMAFPLKVALDGIEKPFRSLLRQLSPDYLVHDFV  125

Query  794   QPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVG--RGH--PAEE-------YPFPELYLR  648
             Q W  + AA   +PA+ F     A+ +Y FH    R H   AEE       +P   +  R
Sbjct  126   QYWTQSAAAEMQVPAIYFCVFPPASFAYAFHPSKFRNHDITAEELAAPPFGFPSSVMRFR  185

Query  647   DHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKK  468
              HE    + L      I G ++   R   CL+G  ++I +K+  + E KY+    + +  
Sbjct  186   LHE---ARDLLVMYRGIPGHIALMSRFAKCLEGCMAVI-VKSCFEYEEKYMSYFEDAIGV  241

Query  467   RCVPVGPLVRSLV--ADGENPE---IKEWLDMKPRCSTVFVSFGSEYFlteeemeevalg  303
               + VGPL R++   A G   +   + EWLD +   S VFVSFGSE FL+E+++ E+ALG
Sbjct  242   PVLSVGPLTRAVRPGASGNGSDHSGLLEWLDRQREASVVFVSFGSEAFLSEDQIHELALG  301

Query  302   leLSKVNFLWVIRFPA-AEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSS  126
             LE S + FLW IRFP  ++ G     +    PEG+  R   RG V++GW PQ  IL H S
Sbjct  302   LEASGLPFLWSIRFPRYSDGGHDPLGV---FPEGFQIRTQDRGLVIKGWVPQVRILSHPS  358

Query  125   IGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             IGGF+SH GW+S ME+L FG+P+I +P+QLDQ LNAR +A+
Sbjct  359   IGGFLSHGGWNSAMESLSFGIPLIVLPIQLDQGLNARQIAS  399



>ref|XP_002463370.1| hypothetical protein SORBIDRAFT_02g042580 [Sorghum bicolor]
 gb|EER99891.1| hypothetical protein SORBIDRAFT_02g042580 [Sorghum bicolor]
Length=479

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 237/402 (59%), Gaps = 30/402 (7%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRN----------FYIYICSTPVNLSSIKKRV  996
             +  + V+MFPWLAHGHI P+L LA+ LT  +            +++ STPVNLS+I +  
Sbjct  6     REQLSVVMFPWLAHGHITPYLELARRLTSADRRRAAGDNIDVTVHLVSTPVNLSAIARHQ  65

Query  995   SEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPD  816
             + +    I+ VEL LP+ PDLPP  HTT  LP  LMPTLK+A D++ P F  LLD L+PD
Sbjct  66    TPR----IRFVELHLPAPPDLPPDLHTTKHLPSRLMPTLKRACDLAAPRFGALLDDLRPD  121

Query  815   LVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH-VGRGHPAEEYPFPELYL-RDH  642
             L+++DFL PW P  AAA+ + AV   +  AAA S+  H +G G     +PF  + L    
Sbjct  122   LLLFDFLYPWAPLEAAARGVAAVHLSTCSAAATSFFVHCLGTGR---AFPFQGVGLGTAE  178

Query  641   EFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLV-KKR  465
             E  +   LF   E  D  V + +R+   L  SS  + IKT   +E  Y+  LS L+  K 
Sbjct  179   EEAKYTSLFAVREHPDALVPERDRLLLSLARSSGFVAIKTCADIERPYMGYLSELLGGKE  238

Query  464   CVPVGPLVRSLVADG-----ENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgl  300
              VPVGPL+      G     E+  +  WLD +P  S V VS GSEYF+TEE++  +A GL
Sbjct  239   IVPVGPLLVDDSDGGGGNSSESDRVTRWLDAQPPASVVLVSVGSEYFMTEEQLARMARGL  298

Query  299   eLSKVNFLWVIRFPAA----EAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEH  132
             ELS   FLWV+RFP +    +    A A   ALP G+    G RG VVEGWAPQ  +L H
Sbjct  299   ELSGERFLWVVRFPKSPEEDDDAAPAPAPARALPRGFAPAPG-RGLVVEGWAPQRRVLAH  357

Query  131   SSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVA  6
              + G F+SHCGWSSV+E+L  GVPI+A+P+ +DQPL A + A
Sbjct  358   PACGTFLSHCGWSSVLESLAAGVPIVALPLHIDQPLGANLAA  399



>ref|XP_008344517.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=311

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 177/244 (73%), Gaps = 12/244 (5%)
 Frame = -3

Query  728  AAACSYLFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGD-VSDTERIDGCLD  552
            AA    +F     + + ++PFP ++LRD+E     R+F+   +   + + D +RI  C  
Sbjct  7    AATIISIFANHFKNSSLKFPFPGIHLRDYEI----RMFKNQVEFSSNGLKDGDRIQQCSS  62

Query  551  GSSSIILIKTFRQLEGKYIDQLSNLVKKRCVPVGPLVRSLV---ADGENPEIKEWLDMKP  381
             S +IIL KT R++E KYID LS+LV K+ VPVGPLV+  +    D E+P I +WL+ + 
Sbjct  63   SSCNIILAKTSREIEAKYIDYLSDLVGKKIVPVGPLVQDPLDQKTDEESP-IIQWLNKRE  121

Query  380  RCSTVFVSFGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGY  201
            + S V+VSFGSEYFL++EE+EE+A GLELSKV+F+WVIRFP  +   K   + + LP+G+
Sbjct  122  KSSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWVIRFPKED---KTTKVEEVLPKGF  178

Query  200  LERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLN  21
            +ER G+RG +VEGWAPQ  IL+H S+GGFVSHCGWSSV+E++KFGVPIIA+PMQLDQP+N
Sbjct  179  VERXGERGMIVEGWAPQAKILQHPSVGGFVSHCGWSSVLESIKFGVPIIALPMQLDQPVN  238

Query  20   ARVV  9
            A++V
Sbjct  239  AKLV  242



>ref|XP_009620578.1| PREDICTED: crocetin glucoside glucosyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=259

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 155/265 (58%), Gaps = 48/265 (18%)
 Frame = -3

Query  1124  MFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVELQLPS  945
             M PWLAHGHI PFL LA+ LT  NF+IY+CSTPVNLSSIKK V+EK + SI+LVEL LPS
Sbjct  1     MVPWLAHGHISPFLELAKKLTNGNFHIYMCSTPVNLSSIKKNVTEKYSQSIELVELHLPS  60

Query  944   LPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAA  765
             LP+LPPHYHTTNGLPPHLM TLK A +M+ P F  +L+TL PDLV+YD+ QPW   +A++
Sbjct  61    LPNLPPHYHTTNGLPPHLMNTLKTAFEMAAPKFSKILETLNPDLVIYDYNQPWTAQLASS  120

Query  764   QSIPAVLFLSPGAAACSYLFH-------------------------------------VG  696
              +IPAV  L+  AA  + +                                       V 
Sbjct  121   MNIPAVQLLTFSAAVVAXILETLNPDLVIYDYNQPWTAQLASSMNIPAVQLLTFSAAVVA  180

Query  695   RG-HPAEE----YPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIIL  531
              G H +E+    +PFPE+YLR++E      +F   + I+            L  S  I+L
Sbjct  181   LGIHMSEDKEDKFPFPEIYLREYE------MFSLKKAINESPGKEFPFGEALRRSRDIVL  234

Query  530   IKTFRQLEGKYIDQLSNLVKKRCVP  456
             +KT R  EGKY+D LSNLV K  VP
Sbjct  235   VKTCRDFEGKYMDYLSNLVTKNIVP  259



>emb|CBI37520.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             + S++V++ PWLAHGHI PFL LA+ L++RNFYIY CSTPVNLSSIK +++E+D++SI+L
Sbjct  4     RSSMKVVLLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLSSIKGKLTEEDSLSIEL  63

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VE+ LPSLPDLPPHY TTNGLPPHLMPTLKKA DM+ PGF ++L TL PDL++YD LQPW
Sbjct  64    VEIHLPSLPDLPPHYQTTNGLPPHLMPTLKKAFDMASPGFADILTTLNPDLIIYDILQPW  123

Query  785   VPAMAAAQSIPAVLFLSPGAA  723
              P  A++Q+IPAVLFLS GA 
Sbjct  124   APVAASSQNIPAVLFLSTGAT  144


 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  227  IGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAM  48
            + +ALPEG+L RVG+RGKVV+ WAPQ  IL HSS GGFVSHCGWSSVME+LKFGVPI+A+
Sbjct  186  VEEALPEGFLSRVGERGKVVKDWAPQREILNHSSTGGFVSHCGWSSVMESLKFGVPIVAI  245

Query  47   PMQLDQPLNAR  15
            PM LDQPLNA+
Sbjct  246  PMHLDQPLNAK  256



>gb|ABR18123.1| unknown [Picea sitchensis]
Length=491

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 146/397 (37%), Positives = 213/397 (54%), Gaps = 24/397 (6%)
 Frame = -3

Query  1154  DTSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKK---RVSEKD  984
             + S + + VLMFPWLA GH+  +  LA  L  R   +   +TP+N+  ++      +   
Sbjct  14    ERSSKKLHVLMFPWLARGHLSTYAQLANRLADRGINVSFLTTPLNVPKMEPLFIMANRNS  73

Query  983   AISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVY  804
                +++VEL LP++   PP    T   P HL P L +A+ + +  F +LL  L PD+VV+
Sbjct  74    PGKVQVVELPLPAVEGFPPGIECTADTPAHLWPLLLRAVHLLEEPFESLLRRLAPDVVVF  133

Query  803   DFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEE------------YPFPE  660
             D +Q W P +A    IP V FL  GAA  SY          EE            YP   
Sbjct  134   DLVQYWTPRVATKLGIPTVFFLIFGAAYSSYQLSPPNAEYGEEITAEDLMVPPPGYPSST  193

Query  659   LYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSN  480
             +  R  E     ++F   +  DG +   +R+  C+DG  +I  IK+  + EGK+I+    
Sbjct  194   ISWRPFEAQFTFKIFHTRDDTDG-MRGIDRLVKCIDGCEAIA-IKSCYEFEGKFIEYFQQ  251

Query  479   LVKKRCVPVGPLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgl  300
             +  K  +PVGPL++S  A   + E  +WL  +   S V+  FG+E FL+ EE+ EVALGL
Sbjct  252   VTGKPVIPVGPLLQS-NAGPLDSECLKWLGRQAASSVVYACFGTECFLSNEEIREVALGL  310

Query  299   eLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIG  120
             E S   F+ V+RF    AG +  +   +LPE +  R+  RG V+  WAPQ  IL H S G
Sbjct  311   EASGHPFILVLRF----AGHRDSST--SLPEAFEGRIRDRGLVLTDWAPQKEILSHPSTG  364

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
              F++HCGWSS+ E +  G+P+IA+PMQ DQ LNAR++
Sbjct  365   AFLTHCGWSSLTEGMSVGLPLIALPMQWDQGLNARLI  401



>emb|CBI40234.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -3

Query  1145  QRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKL  966
             Q  I+VL+ PWLAHGHI PFL L++ L K+ FYIY CS+PVNLS IK +++   + SI+L
Sbjct  6     QSRIKVLVLPWLAHGHISPFLELSKQLMKQKFYIYFCSSPVNLSRIKGKLTGNYSHSIQL  65

Query  965   VELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPW  786
             VEL LPSLP+LPPHYHTTNGLPPHLMPTLK ALDM+ P F N+L TL PDL++YDF+QPW
Sbjct  66    VELHLPSLPELPPHYHTTNGLPPHLMPTLKMALDMASPSFTNILKTLSPDLLIYDFIQPW  125

Query  785   VPAMAAAQSIPAVLFLSPGAAACSYLFH  702
              PA AA+  IP+V FLS GAAA +++ H
Sbjct  126   APAAAASLGIPSVQFLSNGAAATAFMIH  153


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  494  DQLSNLVKKRCVPVGPLVR-SLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeeme  318
            D LSNL  K  VPVGPL++  L  +    E+ EWL  K   S+VFVSFGSEYFL++EE+E
Sbjct  159  DFLSNLNAKTVVPVGPLLQDQLDEEDAETEMVEWLSKKDPASSVFVSFGSEYFLSKEELE  218

Query  317  evalgleLSKVNFLWVIR  264
            EVA GLELSKVNF+WV+R
Sbjct  219  EVAYGLELSKVNFIWVVR  236



>ref|XP_009767153.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=354

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 179/286 (63%), Gaps = 12/286 (4%)
 Frame = -3

Query  863  MSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHP  684
            M+ P F N++  L P+L++YD  Q W P +A+A  IPAV ++  GAA  S+ +H+     
Sbjct  1    MAGPSFSNIVTNLNPNLIIYDIFQNWAPKIASALHIPAVSYIIIGAATASFFYHLYAFDG  60

Query  683  AEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEG  504
            A ++PFPE++L  +E    ++L+     +   + D     G +  S  IILI  ++  E 
Sbjct  61   ARDFPFPEIFLPRYEL---EKLYSKNASMTKFIDDIYASSG-VAMSQDIILINNWKCSET  116

Query  503  KYIDQLSNLVKKRCVPVGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlt  333
            KY++  S L KK  + VGPL+    S V D E  EI +WLD +   ST++ +FGSE  + 
Sbjct  117  KYMEYFSILTKKNVISVGPLIGKTESRVEDSE--EIIQWLDQRDPSSTLYAAFGSECVVN  174

Query  332  eeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAP  153
            +EE+EE+A GLELS VNF+WV+ F      +K   I   LPEGY+ERV +RG +V  WAP
Sbjct  175  KEEIEEIARGLELSNVNFIWVVNFSF---DDKISGIDGILPEGYIERVKERGMIVAKWAP  231

Query  152  QGMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNAR  15
            Q  IL HS+IGGF++HCG +S++E+L FGVP+IAMP+ +DQ + AR
Sbjct  232  QAKILRHSNIGGFLNHCGSNSILESLHFGVPLIAMPVLVDQFIAAR  277



>gb|KDO54370.1| hypothetical protein CISIN_1g044441mg, partial [Citrus sinensis]
Length=333

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 175/286 (61%), Gaps = 10/286 (3%)
 Frame = -3

Query  860  SKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFHVGRGHPA  681
            +KP F N+L+TLKP LV+YD  QPW    A    I AVLFL+  A A SYL H    +P+
Sbjct  4    AKPAFCNILETLKPTLVMYDLFQPWAAEAAYQYHIAAVLFLTISAVAGSYLLH-NIINPS  62

Query  680  EEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGK  501
             +YPF E    D E  +  R   P    +G + + +R     + S   + IKT R++E K
Sbjct  63   LKYPFFESDFLDRENKKINRFMHPT--ANGTL-NKDRNLKAFELSCKFVFIKTSREIESK  119

Query  500  YIDQLSNLVKKRCVPVGPLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeem  321
            Y+D   +L++   VPVGPLV+  +   ++ +I +WL  K   S VFVSFGSEYFL+++EM
Sbjct  120  YLDYFPSLMENEIVPVGPLVQESIFKEDDTKIMDWLSQKEPWSVVFVSFGSEYFLSKDEM  179

Query  320  eevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGK--RGKVVEGWAPQG  147
             E+A GL LS+V+F+ V+R    E       I +ALP+G+ E + +  +G +V+GW PQ 
Sbjct  180  HEIASGLLLSEVSFIRVLRLHPDEK----ITIEEALPQGFAEEIERNNKGMLVQGWVPQA  235

Query  146  MILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
             IL H  IGGF+SHCGW S +E + FGVPIIAMPM  +Q  NA+VV
Sbjct  236  KILRHGRIGGFLSHCGWGSAVEGMVFGVPIIAMPMVYEQSRNAKVV  281



>ref|XP_006658957.1| PREDICTED: LOW QUALITY PROTEIN: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Oryza brachyantha]
Length=424

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 213/372 (57%), Gaps = 38/372 (10%)
 Frame = -3

Query  1157  MDTSQRS-IRVLMFPWLAHGHICPFLVLAQALTKR------------------NFYIYIC  1035
             M  +QR  +RV+MFPWLAHGHI P+L LA+ LT                    +  +++ 
Sbjct  1     MAQAQRERLRVVMFPWLAHGHINPYLELARRLTSTSAAAPPPAPPPPAGREQIDVVVHLV  60

Query  1034  STPVNLSSIKKRVSEKDAISIKLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSK  855
             STPVNL+++  R +++    I+LVEL LP LP+LP   HTT  LPP LMP LK+A D++ 
Sbjct  61    STPVNLAAVAHRQTDR----IRLVELGLPELPELPSKLHTTKHLPPRLMPVLKRACDLAA  116

Query  854   PGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSYLFH---VGRGHP  684
             P F  +LD L+PD+++YDF+QPW P  A A+ +PAV F +  A A ++  H    G   P
Sbjct  117   PAFGAILDELRPDILLYDFIQPWAPVEATARGVPAVHFSTCSAVATAFFLHFLKAGDRDP  176

Query  683   AEEYPFPELYLRDHEFIRNKRLFEPPEQIDGD--VSDTERIDGCLDGSSSIILIKTFRQL  510
             +  +PF  + L   E   + R      Q DG   + + ER+   L  SS  + +KT  ++
Sbjct  177   S-AFPFEAISLGGAE--EDARYTMLTCQDDGTALLPEGERLPLSLVRSSEFVAVKTCVEI  233

Query  509   EGKYIDQLSNLVKKRCVPVGPLV---RSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYF  339
             E KY+D LSNLV K  +P GPL+     + +  E   +  WLD +   S V VSFGSEYF
Sbjct  234   ERKYMDYLSNLVGKEIIPCGPLLVDSGDVGSGSEADRVMRWLDGQEAASVVLVSFGSEYF  293

Query  338   lteeemeevalgleLSKVNFLWVIRFPAA-EAGEKARAIGDALPEGYLERVGKRGKVVEG  162
             +TE++M ++A GLELS   F+WV+R   + ++ ++ R    A+P G+       G VV+G
Sbjct  294   MTEKQMAQMARGLELSGAVFVWVVRXVRSPKSPDEDRGAARAMPPGF---APAHGLVVQG  350

Query  161   WAPQGMILEHSS  126
             WAPQ  +L H S
Sbjct  351   WAPQRRVLSHRS  362



>ref|XP_011071660.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=340

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 118/281 (42%), Positives = 172/281 (61%), Gaps = 8/281 (3%)
 Frame = -3

Query  890  MPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPAMAAAQSIPAVLFLSPGAAACSY  711
            MPTL  A  +S   F +++  LKPDL++YD  QPW   +A++Q IPAV F   G+ A S+
Sbjct  1    MPTLMHAFQLSASTFSDIITRLKPDLLIYDGFQPWSAKLASSQGIPAVYFALTGSTAISF  60

Query  710  LFHVGRGHPAEEYPFPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIIL  531
              H+     ++ +P+P +YL ++E    + L      I     D     G L  S  I+L
Sbjct  61   FHHLYVHKTSDTFPYPAIYLNEYE---KRDLIAQGATIKVQDVDEGFAFGVLKLSCDIVL  117

Query  530  IKT-FRQLEGKYIDQLSNLVKKRCVPVGPLVRSLVADGENPE-IKEWLDMKPRCSTVFVS  357
            IK+    +E KYID LS L K+R VPVGPLV+   AD E    I  WL  K + ST+++S
Sbjct  118  IKSCCTGIERKYIDYLSTLCKRRIVPVGPLVQENAADHETDSWILNWLSKKSKSSTLYIS  177

Query  356  FGSEYFlteeemeevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRG  177
            FGSE + +++++ E+A GLEL+KVNF+WV+R P    G     + +ALPEG+++RV +RG
Sbjct  178  FGSENYFSKDQIREIAKGLELTKVNFIWVVRSP---VGSDQINVEEALPEGFIDRVKERG  234

Query  176  KVVEGWAPQGMILEHSSIGGFVSHCGWSSVMEALKFGVPII  54
             +V+ WAPQ  IL   ++ GF+SHCGWSS+ E+  FGV ++
Sbjct  235  VLVQEWAPQAAILASPAVAGFMSHCGWSSITESAGFGVEVV  275



>ref|XP_007208586.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
 gb|EMJ09785.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
Length=470

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 142/402 (35%), Positives = 216/402 (54%), Gaps = 36/402 (9%)
 Frame = -3

Query  1151  TSQRSIRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISI  972
             T  + + + +FPWLA GHI PF  +A+ + +R   +   STP N+  + K + +     I
Sbjct  5     TEPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPK-IPQHLTPLI  63

Query  971   KLVELQLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQ  792
              LV++ LP + +LP +   T  +P H++P LK A D  + G  N L T KPD +++DF  
Sbjct  64    NLVQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIHDFAP  123

Query  791   PWVPAMAAAQSIPAVLFLSPGAAACSYL-------------------FHVGRGHPAEEYP  669
              W+P +A++  I    F    A+   ++                   F V    P E  P
Sbjct  124   HWLPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTV----PPEWIP  179

Query  668   FP-ELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYID  492
             FP  L  R  E    K+LF+  +Q    VSD  R+   + G   + LI++ R++EG+++D
Sbjct  180   FPSNLVFRSFE---AKKLFDATKQNASGVSDLFRVQSTVQGCQ-VYLIRSCREIEGEWLD  235

Query  491   QLSNLVKKRCVPVG---PLVRSLVADGENPEIKEWLDMKPRCSTVFVSFGSEYFlteeem  321
              L  L +   VP+G   PLV++     +   I +WLD +   + V+++ GSE  L++E+ 
Sbjct  236   LLQELQQFPVVPIGLLPPLVQTREDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDF  295

Query  320   eevalgleLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMI  141
              E+ALGLELS + F WV+R P+      +      LP+G+ ER   RG V   WAPQ  I
Sbjct  296   TELALGLELSGLPFFWVLRTPSWSGDSDSVK----LPDGFEERTKGRGLVWTTWAPQTKI  351

Query  140   LEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNAR  15
             L H SIGGF++HCGWSS++EAL++G P+I +P   DQ L AR
Sbjct  352   LAHDSIGGFLTHCGWSSLIEALQYGRPLIMLPFLYDQGLIAR  393



>gb|EPS66584.1| hypothetical protein M569_08191, partial [Genlisea aurea]
Length=447

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 149/399 (37%), Positives = 213/399 (53%), Gaps = 43/399 (11%)
 Frame = -3

Query  1136  IRVLMFPWLAHGHICPFLVLAQALTKRNFYIYICSTPVNLSSIKKRVSEKDAISIKLVEL  957
             +R+++ PWLA GH+ PFL LA++  ++   + + ST  N+  + K V E+ +  + LV  
Sbjct  6     LRIVVLPWLAMGHLRPFLRLAKSFARKGHRVSLISTTGNIRRLPK-VPEELSELVDLVGF  64

Query  956   QLPSLPDLPPHYHTTNGLPPHLMPTLKKALDMSKPGFLNLLDTLKPDLVVYDFLQPWVPA  777
              LP + DLPP   ++   PP     L+ ALD         L+  KPD +VYD+   WVP 
Sbjct  65    PLPEIRDLPPGCESSMDTPPQKQYLLRTALDSLHDPTRKYLEEEKPDWIVYDYSFSWVPK  124

Query  776   MAAAQSIPAVLFLSPGAAACSYLFHVGRGHPAEEY------------PFP-ELYLRDHEF  636
             MAA   I    F      AC +L  VG+G    EY            PFP  +  R HE 
Sbjct  125   MAAELGISGAYFCV--YPAC-FLTFVGQGKGHAEYKLEDLVNVPKWIPFPSNMAFRPHEL  181

Query  635   IRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQLSNLVKKRCVP  456
             +RNK +    E      SD ER +  +  SSSI L+++  ++E ++I+ L+    K   P
Sbjct  182   MRNKEMQHATE------SDVERFN-LVKESSSIFLLRSSPEIESEWIELLAKQYDKPVFP  234

Query  455   VGPLVRSLVADGENP--------EIKEWLDMKPRCSTVFVSFGSEYFlteeemeevalgl  300
              G L    VAD EN         +I +WLD +P  S V+VSFGSE  LT +E+ E+++GL
Sbjct  235   TGFLS---VADEENETPADDRWIQITDWLDAQPPSSVVYVSFGSEVVLTRKEVHEISIGL  291

Query  299   eLSKVNFLWVIRFPAAEAGEKARAIGDALPEGYLERVGKRGKVVEGWAPQGMILEHSSIG  120
             E S   FLW +   + +         + LPEG+L+ VG RG+V  GWAPQ  IL H S+G
Sbjct  292   ERSGSPFLWALLDRSDQL--------ELLPEGFLQNVGDRGRVYSGWAPQVAILSHPSVG  343

Query  119   GFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVVAA  3
             GF++HCGW+SV EAL  G  +I  P+  DQ L AR++ +
Sbjct  344   GFLTHCGWNSVTEALGCGRVLILFPVMNDQGLIARLMDS  382



>ref|XP_004166802.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
Length=336

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -3

Query  668  FPELYLRDHEFIRNKRLFEPPEQIDGDVSDTERIDGCLDGSSSIILIKTFRQLEGKYIDQ  489
            FPE++L + E  + K LF+       D  D +RI+ C   S  I+L+K+ R++E KYID 
Sbjct  20   FPEIHLSEFEIKQLKNLFKSS---VNDAKDKQRIEECYKRSCGILLLKSLREIEAKYIDF  76

Query  488  LSNLVKKRCVPVGPLVRSLVAD----GENPEIKEWLDMKPRCSTVFVSFGSEYFlteeem  321
            +S  ++ + +PVGPLV     D     E+ E  +WL+ K + S + VSFGSE++L++ +M
Sbjct  77   VSTSLQIKAIPVGPLVEEQEEDIVVLAESFE--KWLNKKEKRSCILVSFGSEFYLSKGDM  134

Query  320  eevalgleLSKVNFLWVIRFPAA-EAGEKAR--AIGDALPEGYLERVGKRGKVVEGWAPQ  150
            EE+A GLELS VNF+WV+RFP + E GE+ +   + + LP+G+LERVG+RG VVE W PQ
Sbjct  135  EEIAHGLELSHVNFIWVVRFPGSGEQGERKKKNVVEEELPKGFLERVGERGMVVEEWVPQ  194

Query  149  GMILEHSSIGGFVSHCGWSSVMEALKFGVPIIAMPMQLDQPLNARVV  9
              IL+H S GGF+SHCGWSSV+E++K GVPIIA PMQLDQPLNAR+V
Sbjct  195  VQILKHRSTGGFLSHCGWSSVLESIKSGVPIIAAPMQLDQPLNARLV  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3213648280796