BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13800_g1_i1 len=665 path=[1114:0-133 1719:134-664]

Length=665
                                                                      Score     E

ref|XP_009790868.1|  PREDICTED: structure-specific endonuclease s...    177   3e-51   
ref|XP_004229678.1|  PREDICTED: structure-specific endonuclease s...    174   2e-50   
ref|XP_009602384.1|  PREDICTED: uncharacterized protein LOC104097520    172   3e-49   
ref|XP_006345391.1|  PREDICTED: structure-specific endonuclease s...    166   5e-47   
ref|XP_010269715.1|  PREDICTED: structure-specific endonuclease s...    164   7e-47   
emb|CDP14371.1|  unnamed protein product                                163   3e-46   
ref|XP_010067785.1|  PREDICTED: structure-specific endonuclease s...    160   3e-45   
ref|XP_002298410.1|  hypothetical protein POPTR_0001s26780g             159   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004303087.1|  PREDICTED: structure-specific endonuclease s...    159   6e-45   
ref|XP_002298387.1|  hypothetical protein POPTR_0001s26700g             159   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010694700.1|  PREDICTED: structure-specific endonuclease s...    157   2e-44   
ref|XP_008231532.1|  PREDICTED: structure-specific endonuclease s...    156   7e-44   
emb|CBI28599.3|  unnamed protein product                                155   9e-44   
ref|XP_002298390.2|  hypothetical protein POPTR_0001s26730g             156   9e-44   Populus trichocarpa [western balsam poplar]
gb|EYU42980.1|  hypothetical protein MIMGU_mgv1a014500mg                155   2e-43   
ref|XP_011008278.1|  PREDICTED: structure-specific endonuclease s...    155   2e-43   
ref|XP_004516472.1|  PREDICTED: structure-specific endonuclease s...    154   4e-43   
gb|KDP43613.1|  hypothetical protein JCGZ_16900                         154   5e-43   
ref|XP_003533500.2|  PREDICTED: structure-specific endonuclease s...    154   6e-43   
gb|KEH17663.1|  structure-specific endonuclease subunit SLX1-like...    153   7e-43   
gb|KHN11715.1|  Structure-specific endonuclease subunit slx1            153   8e-43   
ref|XP_011091781.1|  PREDICTED: structure-specific endonuclease s...    154   8e-43   
ref|XP_008354910.1|  PREDICTED: structure-specific endonuclease s...    153   2e-42   
ref|XP_006438929.1|  hypothetical protein CICLE_v10032919mg             152   3e-42   
ref|XP_008354909.1|  PREDICTED: structure-specific endonuclease s...    152   5e-42   
ref|XP_009354395.1|  PREDICTED: structure-specific endonuclease s...    151   5e-42   
ref|XP_007219127.1|  hypothetical protein PRUPE_ppa015867mg             151   7e-42   
gb|KHG08841.1|  slx1                                                    150   1e-41   
ref|XP_007052427.1|  LRR and NB-ARC domains-containing disease re...    161   2e-41   
ref|XP_007131435.1|  hypothetical protein PHAVU_011G013300g             149   3e-41   
ref|XP_006587691.1|  PREDICTED: structure-specific endonuclease s...    147   2e-40   
ref|XP_002271242.2|  PREDICTED: putative disease resistance prote...    157   8e-40   Vitis vinifera
ref|XP_010558908.1|  PREDICTED: structure-specific endonuclease s...    143   1e-38   
ref|XP_010557824.1|  PREDICTED: structure-specific endonuclease s...    142   2e-38   
ref|XP_004151512.1|  PREDICTED: structure-specific endonuclease s...    142   2e-38   
ref|XP_008461838.1|  PREDICTED: structure-specific endonuclease s...    140   1e-37   
gb|KFK31729.1|  hypothetical protein AALP_AA6G151500                    138   4e-37   
ref|XP_010481892.1|  PREDICTED: structure-specific endonuclease s...    137   1e-36   
ref|XP_009123871.1|  PREDICTED: structure-specific endonuclease s...    137   2e-36   
ref|XP_010494293.1|  PREDICTED: structure-specific endonuclease s...    137   2e-36   
ref|XP_006403276.1|  hypothetical protein EUTSA_v10003279mg             136   3e-36   
ref|XP_006281183.1|  hypothetical protein CARUB_v10027218mg             136   4e-36   
ref|XP_010093574.1|  Structure-specific endonuclease subunit            136   7e-36   
emb|CAN82122.1|  hypothetical protein VITISV_009093                     145   2e-35   Vitis vinifera
ref|XP_002865442.1|  hypothetical protein ARALYDRAFT_494683             134   2e-35   
ref|NP_199135.1|  Excinuclease ABC, C subunit, N-terminal               133   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442057.1|  PREDICTED: structure-specific endonuclease s...    131   5e-34   
ref|XP_006853037.1|  hypothetical protein AMTR_s00038p00020170          128   7e-33   
ref|XP_010922213.1|  PREDICTED: structure-specific endonuclease s...    127   8e-33   
ref|XP_008806563.1|  PREDICTED: structure-specific endonuclease s...    125   5e-32   
ref|XP_009383244.1|  PREDICTED: structure-specific endonuclease s...    124   1e-31   
ref|XP_004977516.1|  PREDICTED: structure-specific endonuclease s...    121   1e-30   
ref|XP_006663810.1|  PREDICTED: structure-specific endonuclease s...    119   6e-30   
gb|ABK21086.1|  unknown                                                 119   9e-30   Picea sitchensis
gb|EEC67666.1|  hypothetical protein OsI_35089                          120   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004978649.1|  PREDICTED: structure-specific endonuclease s...    118   2e-29   
gb|KCW65982.1|  hypothetical protein EUGRSUZ_G03277                     118   2e-29   
emb|CBX25491.1|  hypothetical_protein                                   118   5e-29   
gb|KDO83286.1|  hypothetical protein CISIN_1g0473621mg                  114   1e-28   
ref|XP_002441709.1|  hypothetical protein SORBIDRAFT_08g001060          116   2e-28   Sorghum bicolor [broomcorn]
gb|EEE52756.1|  hypothetical protein OsJ_35194                          116   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68850.1|  hypothetical protein OsI_37440                          116   2e-28   Oryza sativa Indica Group [Indian rice]
gb|KEH17664.1|  structure-specific endonuclease subunit SLX1-like...    115   3e-28   
ref|XP_003577888.1|  PREDICTED: structure-specific endonuclease s...    115   3e-28   
dbj|BAJ98541.1|  predicted protein                                      114   1e-27   
gb|AFW55817.1|  holiday junction resolvase, S1x1p, URI domain nuc...    112   3e-27   
ref|NP_001150522.1|  holiday junction resolvase, S1x1p, URI domai...    112   3e-27   Zea mays [maize]
ref|XP_010694707.1|  PREDICTED: structure-specific endonuclease s...    107   5e-26   
ref|XP_004170728.1|  PREDICTED: structure-specific endonuclease s...    107   1e-25   
ref|XP_002527946.1|  nuclease, putative                                 103   1e-23   Ricinus communis
gb|KHG08842.1|  slx1                                                    102   2e-23   
ref|XP_008806564.1|  PREDICTED: structure-specific endonuclease s...  96.3    2e-21   
ref|NP_001176349.1|  Os11g0146550                                     92.0    7e-20   
ref|NP_001066136.2|  Os12g0143300                                     88.2    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010442058.1|  PREDICTED: structure-specific endonuclease s...  85.5    2e-17   
gb|EMT29300.1|  hypothetical protein F775_13440                       84.0    1e-16   
ref|XP_001778001.1|  predicted protein                                83.2    2e-15   
gb|EJK67830.1|  hypothetical protein THAOC_11076                      78.6    2e-13   
gb|EJK48000.1|  hypothetical protein THAOC_33238                      78.2    5e-13   
ref|XP_002287643.1|  predicted protein                                73.2    2e-11   Thalassiosira pseudonana CCMP1335
gb|EPY49714.1|  structure-specific endonuclease catalytic subunit     69.3    6e-11   
gb|EPX74925.1|  structure-specific endonuclease catalytic subunit     68.6    1e-10   
gb|KFK23759.1|  hypothetical protein AALP_AAs62422U000100             64.7    2e-10   
gb|KIG14069.1|  Endo/excinuclease amino terminal domain protein       63.9    5e-10   
ref|XP_003692278.1|  PREDICTED: structure-specific endonuclease s...  64.7    7e-10   
ref|WP_020881224.1|  Excinuclease ABC C subunit domain protein        63.5    9e-10   
ref|XP_005790036.1|  hypothetical protein EMIHUDRAFT_225154           63.5    2e-09   
ref|XP_002142784.1|  GIY-YIG catalytic domain-containing protein      65.1    4e-09   Cryptosporidium muris RN66
ref|XP_005763140.1|  hypothetical protein EMIHUDRAFT_215514           63.5    5e-09   
gb|KDQ56849.1|  hypothetical protein JAAARDRAFT_59073                 64.7    8e-09   
ref|XP_006624425.1|  PREDICTED: structure-specific endonuclease s...  62.8    1e-08   
ref|XP_003723181.1|  conserved hypothetical protein                   64.3    1e-08   
ref|XP_003692277.1|  PREDICTED: structure-specific endonuclease s...  62.8    1e-08   
ref|WP_009575055.1|  excinuclease ABC subunit C                       59.7    2e-08   
ref|XP_010699706.1|  structure-specific endonuclease, putative        63.9    2e-08   
ref|NP_593420.1|  structure-specific endonuclease catalytic subunit   62.4    2e-08   Schizosaccharomyces pombe
ref|XP_005535276.1|  hypothetical protein, conserved                  63.2    2e-08   
emb|CBN80129.1|  endo/excinuclease amino terminal domain-containi...  62.8    2e-08   
ref|XP_006678112.1|  hypothetical protein BATDEDRAFT_87437            62.8    3e-08   
ref|XP_006572323.1|  PREDICTED: structure-specific endonuclease s...  62.0    3e-08   
ref|WP_029898546.1|  hypothetical protein                             58.9    3e-08   
ref|XP_001880448.1|  predicted protein                                63.2    3e-08   Laccaria bicolor S238N-H82
ref|XP_003861467.1|  hypothetical protein, conserved                  63.2    3e-08   
ref|XP_665907.1|  hypothetical protein                                61.2    3e-08   Cryptosporidium hominis TU502
gb|EJU03443.1|  hypothetical protein DACRYDRAFT_49905                 58.9    3e-08   
ref|XP_003060854.1|  predicted protein                                59.7    4e-08   
ref|XP_001466168.1|  conserved hypothetical protein                   62.8    4e-08   Leishmania infantum JPCM5
ref|WP_006977032.1|  Excinuclease ABC, C subunit-like protein         58.5    4e-08   
ref|XP_005708442.1|  endo/excinuclease amino terminal domain-cont...  62.4    4e-08   
ref|WP_033425376.1|  hypothetical protein                             58.5    5e-08   
ref|XP_005770693.1|  hypothetical protein EMIHUDRAFT_447996           62.0    5e-08   
ref|WP_011370525.1|  excinuclease ABC subunit C                       58.2    5e-08   
ref|XP_005769695.1|  hypothetical protein EMIHUDRAFT_458995           62.0    5e-08   
ref|XP_002172727.1|  structure-specific endonuclease catalytic su...  61.2    6e-08   Schizosaccharomyces japonicus yFS275
ref|XP_002962079.1|  hypothetical protein SELMODRAFT_66109            59.7    7e-08   
gb|EYE98502.1|  structure-specific endonuclease subunit slx1          61.6    7e-08   
emb|CBY93775.1|  putative slx1 protein                                59.7    7e-08   
gb|EUC61342.1|  GIY-YIG-SLX1 domain protein                           61.2    7e-08   
gb|EPS34535.1|  hypothetical protein PDE_09499                        61.6    7e-08   
ref|WP_006954776.1|  excinuclease ABC subunit C                       57.8    8e-08   
ref|XP_009528982.1|  hypothetical protein PHYSODRAFT_509109           59.3    8e-08   
emb|CCD78399.1|  hypothetical protein Smp_106040                      59.7    1e-07   
gb|AAX25793.2|  SJCHGC08377 protein                                   58.2    1e-07   Schistosoma japonicum
gb|EPS59593.1|  hypothetical protein M569_15212                       58.9    1e-07   
ref|XP_005845200.1|  hypothetical protein CHLNCDRAFT_26241            59.3    1e-07   
ref|XP_626607.1|  holiday junction resolvase, S1x1p, URI domain n...  61.2    1e-07   Cryptosporidium parvum Iowa II
ref|XP_002895726.1|  conserved hypothetical protein                   58.9    1e-07   
gb|EPY19434.1|  structure-specific endonuclease subunit SLX1          60.5    1e-07   
gb|KDQ09537.1|  hypothetical protein BOTBODRAFT_524952                60.8    1e-07   
ref|XP_004339959.1|  GIYYIG catalytic domain containing protein       60.5    1e-07   
ref|XP_001692487.1|  predicted protein                                60.5    1e-07   Chlamydomonas reinhardtii
gb|KDR75326.1|  hypothetical protein GALMADRAFT_545850                61.2    1e-07   
gb|EAS31361.2|  GIY-YIG catalytic domain-containing protein           60.5    1e-07   
gb|KFB42360.1|  AGAP002259-PA-like protein                            60.5    2e-07   
gb|EGE82095.1|  GIY-YIG catalytic domain-containing protein           60.5    2e-07   
ref|XP_004183089.1|  hypothetical protein EIN_469570                  60.1    2e-07   
ref|XP_002628459.1|  GIY-YIG catalytic domain-containing protein      60.5    2e-07   Blastomyces gilchristii SLH14081
gb|EQL33419.1|  structure-specific endonuclease subunit SLX1          60.5    2e-07   
gb|EEQ89270.1|  GIY-YIG catalytic domain-containing protein           60.5    2e-07   Blastomyces dermatitidis ER-3
dbj|BAB02177.1|  unnamed protein product                              55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008860164.1|  GIY-YIG catalytic domain containing protein      60.1    2e-07   
ref|XP_652913.1|  hypothetical protein                                60.1    2e-07   Entamoeba histolytica HM-1:IMSS
ref|XP_001734615.1|  structure-specific endonuclease SLX1             60.1    2e-07   Entamoeba dispar SAW760
gb|KGB75671.1|  structure-specific endonuclease subunit SLX1          60.5    2e-07   
gb|ETM03396.1|  hypothetical protein L917_00378                       59.3    2e-07   
ref|XP_003849881.1|  hypothetical protein MYCGRDRAFT_87006            59.7    3e-07   
gb|ESA23594.1|  hypothetical protein GLOINDRAFT_90863                 58.5    3e-07   
gb|EKG18784.1|  Excinuclease ABC C subunit                            59.7    3e-07   
ref|YP_003986802.1|  uncharacterized endo/excinuclease amino term...  57.4    3e-07   
ref|XP_004955835.1|  PREDICTED: uncharacterized protein LOC101777363  59.3    4e-07   
emb|CCA71396.1|  related to SLX1-Subunit of a complex, with Slx4p...  59.3    4e-07   
ref|WP_034839405.1|  hypothetical protein                             55.8    4e-07   
emb|CBK22023.2|  unnamed protein product                              56.2    5e-07   
ref|XP_005756601.1|  hypothetical protein EMIHUDRAFT_250660           57.0    5e-07   
gb|EFW16058.1|  conserved hypothetical protein                        58.9    5e-07   
ref|XP_003069834.1|  GIY-YIG catalytic domain containing protein      58.9    5e-07   
gb|EXX56438.1|  hypothetical protein RirG_216170                      58.9    5e-07   
ref|XP_003389448.1|  PREDICTED: structure-specific endonuclease s...  58.5    5e-07   
ref|XP_001648514.1|  hypothetical protein AaeL_AAEL004145             57.0    6e-07   Aedes aegypti
ref|XP_007927485.1|  hypothetical protein MYCFIDRAFT_99264            58.5    6e-07   
ref|XP_002170246.1|  PREDICTED: structure-specific endonuclease s...  58.5    6e-07   
emb|CDS10590.1|  hypothetical protein LRAMOSA11076                    58.2    6e-07   
ref|XP_010685968.1|  PREDICTED: uncharacterized protein LOC104900278  58.9    6e-07   
dbj|GAD92142.1|  hypothetical protein PVAR5_0729                      58.5    7e-07   
ref|WP_006003850.1|  excinuclease ABC subunit C                       55.5    7e-07   
gb|ETP27002.1|  hypothetical protein F441_00430                       58.5    8e-07   
gb|ETL50336.1|  hypothetical protein L916_00405                       58.2    8e-07   
ref|XP_505695.1|  YALI0F21131p                                        58.2    8e-07   Yarrowia lipolytica CLIB122
gb|ETK96988.1|  hypothetical protein L915_00403                       58.2    8e-07   
ref|XP_001216691.1|  predicted protein                                58.5    8e-07   Aspergillus terreus NIH2624
gb|ETM56654.1|  hypothetical protein L914_00407                       58.2    8e-07   
ref|XP_008889987.1|  hypothetical protein PPTG_00355                  58.2    8e-07   
ref|YP_003969786.1|  putative GIY-YIG endonuclease                    55.1    9e-07   
ref|WP_012487274.1|  nuclease                                         55.1    9e-07   
gb|AFR92528.1|  structure-specific endonuclease subunit SLX1          58.2    9e-07   
emb|CCD17159.1|  unnamed protein product                              58.2    1e-06   
ref|XP_003191354.1|  GIY-YIG type nuclease catalytic domain conta...  58.2    1e-06   
ref|XP_007873445.1|  hypothetical protein PNEG_01506                  58.2    1e-06   
gb|KDQ27950.1|  hypothetical protein PLEOSDRAFT_173769                58.2    1e-06   
ref|XP_567159.1|  hypothetical protein                                58.2    1e-06   Cryptococcus neoformans var. neoformans JEC21
ref|WP_007020733.1|  endonuclease                                     54.3    1e-06   
ref|XP_001822706.2|  structure-specific endonuclease subunit slx1     57.8    1e-06   Aspergillus oryzae RIB40
gb|KEY75720.1|  structure specific endonuclease subunit slx1          57.8    1e-06   
ref|XP_747999.1|  GIY-YIG catalytic domain containing protein         57.8    1e-06   Aspergillus fumigatus Af293
sp|B0Y2U0.1|SLX1_ASPFC  RecName: Full=Structure-specific endonucl...  57.8    1e-06   Aspergillus fumigatus A1163
emb|CCC46866.1|  conserved hypothetical protein                       58.2    1e-06   
ref|XP_001421690.1|  predicted protein                                57.8    1e-06   Ostreococcus lucimarinus CCE9901
ref|XP_007869679.1|  hypothetical protein GLOTRDRAFT_80778            57.8    1e-06   
ref|XP_009410527.1|  PREDICTED: uncharacterized protein LOC103992...  57.8    1e-06   
ref|WP_014950250.1|  endonuclease                                     54.7    1e-06   
gb|EHA28533.1|  hypothetical protein ASPNIDRAFT_189208                57.4    2e-06   
gb|EHK20008.1|  hypothetical protein TRIVIDRAFT_77206                 57.4    2e-06   
ref|XP_002147721.1|  GIY-YIG catalytic domain containing protein      57.4    2e-06   Talaromyces marneffei ATCC 18224
emb|CAX69857.1|  Structure-specific endonuclease SLX1                 57.0    2e-06   
ref|XP_002840567.1|  hypothetical protein                             57.4    2e-06   Tuber melanosporum Mel28
emb|CCW70937.1|  unnamed protein product                              57.4    2e-06   
emb|CAX69856.1|  Structure-specific endonuclease SLX1                 57.0    2e-06   
ref|XP_001276188.1|  GIY-YIG catalytic domain protein                 57.4    2e-06   Aspergillus clavatus NRRL 1
ref|XP_004364864.1|  predicted protein                                57.0    2e-06   
gb|EEZ79597.1|  endonuclease                                          53.9    2e-06   uncultured SUP05 cluster bacterium
ref|WP_036228302.1|  hypothetical protein                             53.9    2e-06   
gb|KFH62914.1|  hypothetical protein MVEG_11438                       57.0    2e-06   
ref|WP_039228460.1|  endonuclease                                     54.3    2e-06   
ref|XP_007876048.1|  hypothetical protein PFL1_00361                  57.4    2e-06   
gb|EIT79846.1|  GIY-YIG type nuclease                                 57.0    2e-06   
ref|WP_020888065.1|  Excinuclease ABC C subunit domain protein        53.5    2e-06   
emb|CDI52725.1|  giy-yig type nuclease catalytic domain containin...  57.0    3e-06   
ref|XP_565552.4|  AGAP002259-PA                                       57.0    3e-06   Anopheles gambiae str. PEST
ref|XP_007756829.1|  hypothetical protein A1O7_04629                  57.0    3e-06   
ref|XP_008810572.1|  PREDICTED: structure-specific endonuclease s...  57.0    3e-06   
ref|XP_008223476.1|  PREDICTED: structure-specific endonuclease s...  53.9    3e-06   
ref|XP_002420332.1|  DNA replication structure-specific endonucle...  56.6    3e-06   Candida dubliniensis CD36
emb|CCA36410.1|  hypothetical protein PP7435_Chr1-0249                55.5    3e-06   
gb|ETO22224.1|  hypothetical protein RFI_14976                        57.0    3e-06   
ref|XP_001624938.1|  predicted protein                                56.2    3e-06   Nematostella vectensis
ref|WP_028880503.1|  hypothetical protein                             53.5    3e-06   
ref|XP_003707232.1|  PREDICTED: structure-specific endonuclease s...  56.2    3e-06   
gb|EMG45412.1|  Structure-specific endonuclease subunit SLX1          55.5    3e-06   
ref|XP_003235498.1|  hypothetical protein TERG_04552                  56.6    3e-06   
gb|EFW43952.2|  hypothetical protein CAOG_01996                       56.6    3e-06   
ref|WP_039231427.1|  endonuclease                                     53.9    3e-06   
gb|EPB92971.1|  hypothetical protein HMPREF1544_00045                 56.2    3e-06   
ref|XP_010032939.1|  PREDICTED: uncharacterized protein LOC104422335  56.6    3e-06   
ref|WP_014977101.1|  endonuclease                                     53.9    3e-06   
gb|KHJ33271.1|  putative giy-yig catalytic domain-containing protein  56.6    4e-06   
sp|A2QUJ2.1|SLX1_ASPNC  RecName: Full=Structure-specific endonucl...  56.6    4e-06   Aspergillus niger CBS 513.88
dbj|GAC92732.1|  hypothetical protein PHSY_000287                     56.6    4e-06   
ref|YP_008052740.1|  GIY-YIG superfamily protein                      53.9    4e-06   
ref|XP_007728989.1|  hypothetical protein A1O3_00649                  56.2    4e-06   
emb|CDY54009.1|  BnaCnng25920D                                        56.2    4e-06   
ref|WP_025255993.1|  endonuclease                                     53.5    4e-06   
sp|Q5TXB2.3|SLX1_ANOGA  RecName: Full=Structure-specific endonucl...  55.8    4e-06   Anopheles gambiae
gb|EXF49663.1|  putative endonuclease containing a URI domain         53.5    4e-06   
ref|XP_002848911.1|  GIY-YIG catalytic domain-containing protein      56.2    4e-06   Arthroderma otae CBS 113480
gb|EME43420.1|  hypothetical protein DOTSEDRAFT_174260                56.2    4e-06   
ref|XP_002481886.1|  GIY-YIG catalytic domain containing protein      56.2    5e-06   Talaromyces stipitatus ATCC 10500
emb|CDH49839.1|  structure-specific endonuclease subunit slx1         55.8    5e-06   
ref|WP_038126070.1|  hypothetical protein                             52.8    5e-06   
ref|XP_002461708.1|  hypothetical protein SORBIDRAFT_02g006850        56.2    5e-06   Sorghum bicolor [broomcorn]
gb|EGD93010.1|  GIY-YIG catalytic domain containing protein           55.1    5e-06   
ref|XP_010922708.1|  PREDICTED: structure-specific endonuclease s...  56.2    5e-06   
ref|WP_037338634.1|  hypothetical protein                             52.8    5e-06   
ref|XP_001393894.2|  structure-specific endonuclease subunit slx1     56.2    5e-06   Aspergillus niger CBS 513.88
gb|ADD38884.1|  Structure-specific endonuclease subunit slx1          55.5    5e-06   Lepeophtheirus salmonis
ref|XP_457305.2|  DEHA2B08030p                                        55.8    5e-06   Debaryomyces hansenii CBS767
dbj|GAA88241.1|  GIY-YIG catalytic domain containing protein          56.2    5e-06   
gb|KEH34436.1|  endo/excinuclease amino terminal domain protein       56.2    5e-06   
gb|EER41154.1|  GIY-YIG catalytic protein                             56.2    5e-06   Histoplasma capsulatum H143
ref|XP_004145233.1|  PREDICTED: uncharacterized protein LOC101203492  55.8    5e-06   
gb|EPE08502.1|  giy-yig catalytic domain containing protein           56.2    5e-06   
ref|WP_020744792.1|  URI domain endonuclease                          53.1    6e-06   
ref|XP_971859.1|  PREDICTED: structure-specific endonuclease subu...  55.1    6e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_007849676.1|  giy-yig catalytic domain containing protein      55.8    6e-06   
ref|WP_020744001.1|  URI domain endonuclease                          53.1    6e-06   
dbj|GAA99290.1|  hypothetical protein E5Q_05985                       55.8    6e-06   
ref|XP_758004.1|  hypothetical protein UM01857.1                      56.2    6e-06   Ustilago maydis 521
emb|CBQ72079.1|  conserved hypothetical protein                       56.2    6e-06   
ref|XP_002550947.1|  hypothetical protein CTRG_05245                  55.5    6e-06   Candida tropicalis MYA-3404
ref|XP_008045071.1|  hypothetical protein TRAVEDRAFT_136355           55.8    6e-06   
ref|XP_003561283.1|  PREDICTED: uncharacterized protein LOC100832723  55.8    6e-06   
ref|XP_007739810.1|  hypothetical protein A1O5_01001                  55.8    6e-06   
ref|XP_010108498.1|  Structure-specific endonuclease subunit          55.8    7e-06   
ref|XP_003329451.2|  hypothetical protein PGTG_11201                  55.8    7e-06   
ref|XP_008457313.1|  PREDICTED: uncharacterized protein LOC103497035  55.8    7e-06   
ref|XP_007339793.1|  hypothetical protein AURDEDRAFT_181521           55.8    7e-06   
ref|NP_001132010.1|  hypothetical protein                             55.8    7e-06   Zea mays [maize]
ref|XP_001731830.1|  hypothetical protein MGL_1098                    55.8    7e-06   Malassezia globosa CBS 7966
ref|XP_001313690.1|  GIY-YIG catalytic domain containing protein      55.1    7e-06   Trichomonas vaginalis G3
ref|XP_002325655.2|  endo/excinuclease amino terminal domain-cont...  54.7    7e-06   Populus trichocarpa [western balsam poplar]
emb|CDP04061.1|  unnamed protein product                              55.5    7e-06   
emb|CCD48288.1|  hypothetical protein BofuT4_P106720.1                55.8    7e-06   
ref|XP_008726620.1|  hypothetical protein G647_04053                  55.8    7e-06   
ref|XP_007678720.1|  hypothetical protein BAUCODRAFT_47071            55.5    7e-06   
ref|XP_843716.1|  hypothetical protein                                55.8    7e-06   Trypanosoma brucei brucei TREU927
ref|WP_037046251.1|  hypothetical protein                             52.4    7e-06   
emb|CBH09758.1|  hypothetical protein, conserved                      55.8    7e-06   Trypanosoma brucei gambiense DAL972
ref|XP_001778791.1|  predicted protein                                55.8    8e-06   
gb|EFZ22540.1|  hypothetical protein SINV_06653                       55.1    8e-06   
ref|XP_008079937.1|  Structure-specific endonuclease subunit slx1     55.5    8e-06   
emb|CCF53299.1|  uncharacterized protein UHOR_02758                   55.8    8e-06   
gb|ACO15278.1|  Structure-specific endonuclease SLX1                  55.1    8e-06   
ref|WP_007231297.1|  endonuclease                                     52.0    8e-06   
ref|WP_019894937.1|  hypothetical protein                             52.4    8e-06   
ref|XP_008613003.1|  hypothetical protein SDRG_08882                  55.5    8e-06   
gb|EGE04683.1|  GIY-YIG catalytic domain-containing protein           55.5    9e-06   
ref|XP_011080735.1|  PREDICTED: structure-specific endonuclease s...  55.5    9e-06   
ref|XP_002489586.1|  Subunit of a complex, with Slx4p, that hydro...  54.7    9e-06   
emb|CDY24007.1|  BnaC03g16840D                                        55.5    9e-06   
dbj|BAJ98296.1|  predicted protein                                    55.5    1e-05   
gb|EPT01956.1|  hypothetical protein FOMPIDRAFT_1119107               55.1    1e-05   
ref|XP_007394957.1|  hypothetical protein PHACADRAFT_172822           55.5    1e-05   
gb|KDO30663.1|  hypothetical protein SPRG_04564                       55.1    1e-05   
ref|XP_009141060.1|  PREDICTED: uncharacterized protein LOC103865032  55.1    1e-05   
sp|Q2UA42.1|SLX1_ASPOR  RecName: Full=Structure-specific endonucl...  55.1    1e-05   
gb|KFK24520.1|  hypothetical protein AALP_AAs65934U001100             55.1    1e-05   
ref|XP_002596620.1|  hypothetical protein BRAFLDRAFT_219192           53.1    1e-05   
ref|WP_009023470.1|  excinuclease ABC subunit C                       52.0    1e-05   
gb|KFM27249.1|  Structure-specific endonuclease subunit SLX1-like...  54.7    1e-05   
ref|WP_012517967.1|  endonuclease                                     52.4    1e-05   
gb|EMD86132.1|  hypothetical protein COCHEDRAFT_1185965               55.1    1e-05   
ref|XP_009600656.1|  PREDICTED: uncharacterized protein LOC104096...  55.1    1e-05   
gb|ELT87595.1|  hypothetical protein CAPTEDRAFT_226573                54.7    1e-05   
gb|EUN29179.1|  hypothetical protein COCVIDRAFT_93305                 55.1    1e-05   
gb|KEQ95063.1|  hypothetical protein AUEXF2481DRAFT_233669            55.1    1e-05   
ref|XP_007688687.1|  hypothetical protein COCMIDRAFT_97271            55.1    1e-05   
ref|WP_015067677.1|  URI domain endonuclease                          52.4    1e-05   
ref|WP_024016682.1|  URI domain endonuclease                          52.4    1e-05   
ref|XP_002517715.1|  nuclease, putative                               55.1    1e-05   
ref|XP_003174049.1|  hypothetical protein MGYG_04223                  54.7    1e-05   
gb|EZF35776.1|  hypothetical protein H101_00679                       54.7    1e-05   
ref|NP_001090376.1|  structure-specific endonuclease subunit slx1     54.7    1e-05   
ref|XP_009550886.1|  hypothetical protein HETIRDRAFT_173988           55.1    1e-05   
ref|XP_009132726.1|  PREDICTED: structure-specific endonuclease s...  54.7    1e-05   
ref|XP_011052863.1|  PREDICTED: structure-specific endonuclease s...  54.3    1e-05   
gb|EMS19758.1|  structure-specific endonuclease subunit SLX1          55.1    1e-05   
dbj|GAM36267.1|  GIY-YIG catalytic domain containing protein          54.7    1e-05   
ref|XP_002943477.2|  PREDICTED: structure-specific endonuclease s...  54.3    1e-05   
ref|XP_007713238.1|  hypothetical protein COCCADRAFT_5843             54.7    1e-05   
gb|KDR08427.1|  Structure-specific endonuclease subunit slx1          54.3    1e-05   
ref|XP_002319418.2|  hypothetical protein POPTR_0013s15190g           54.7    1e-05   
ref|XP_007017048.1|  Excinuclease ABC                                 54.7    1e-05   
ref|XP_006410121.1|  hypothetical protein EUTSA_v10016841mg           54.7    1e-05   
emb|CDY29679.1|  BnaA04g17480D                                        54.7    1e-05   
ref|XP_008028628.1|  hypothetical protein SETTUDRAFT_93729            54.7    2e-05   
gb|EAZ03286.1|  hypothetical protein OsI_25432                        54.7    2e-05   
ref|XP_009600654.1|  PREDICTED: uncharacterized protein LOC104096...  54.7    2e-05   
gb|EGU11133.1|  Structure-specific endonuclease subunit SLX1          54.7    2e-05   
ref|XP_011021033.1|  PREDICTED: uncharacterized protein LOC105123220  54.7    2e-05   
ref|WP_029406555.1|  hypothetical protein                             51.6    2e-05   
gb|EZA53653.1|  Structure-specific endonuclease subunit slx1          54.3    2e-05   
ref|WP_039218300.1|  endonuclease                                     52.0    2e-05   
ref|XP_007296421.1|  GIY-YIG catalytic domain-containing protein      54.7    2e-05   
ref|XP_009803218.1|  PREDICTED: structure-specific endonuclease s...  54.3    2e-05   
gb|KDP45724.1|  hypothetical protein JCGZ_17331                       54.7    2e-05   
ref|XP_004913978.1|  PREDICTED: structure-specific endonuclease s...  54.3    2e-05   
gb|KGQ87079.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
ref|XP_716870.1|  potential DNA replication structure-specific en...  54.3    2e-05   
gb|KFA60996.1|  hypothetical protein S40285_02727                     54.7    2e-05   
ref|NP_001059231.1|  Os07g0230500                                     54.7    2e-05   
gb|EKF30795.1|  hypothetical protein MOQ_005381                       54.7    2e-05   
gb|KEQ86671.1|  hypothetical protein M438DRAFT_269002                 54.3    2e-05   
gb|KGU06580.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
gb|KGR12940.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
gb|KGR06188.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
gb|KGQ91903.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
gb|KGQ84996.1|  structure-specific endonuclease subunit SLX1          54.3    2e-05   
gb|AGF85201.1|  nuclease superfamily protein                          52.8    2e-05   
ref|XP_006431991.1|  hypothetical protein CICLE_v10001469mg           54.3    2e-05   
gb|KEY68051.1|  hypothetical protein S7711_06962                      54.3    2e-05   
ref|XP_011041810.1|  PREDICTED: uncharacterized protein LOC105137678  54.7    2e-05   
ref|YP_007354501.1|  GIY-YIG nuclease superfamily protein             52.8    2e-05   
ref|XP_810370.1|  hypothetical protein                                54.7    2e-05   
gb|ESS63945.1|  hypothetical protein TCDM_08110                       54.3    2e-05   
gb|KDO49767.1|  hypothetical protein CISIN_1g016815mg                 54.3    2e-05   
gb|EKG03035.1|  hypothetical protein TCSYLVIO_005929                  54.3    2e-05   
ref|XP_007303687.1|  hypothetical protein STEHIDRAFT_139121           54.7    2e-05   
ref|XP_010469867.1|  PREDICTED: uncharacterized protein LOC104749854  54.3    2e-05   
emb|CDK24693.1|  unnamed protein product                              54.3    2e-05   
ref|WP_008044763.1|  excinuclease ABC subunit C                       51.2    2e-05   
ref|XP_805589.1|  hypothetical protein                                54.3    2e-05   
gb|EYU46004.1|  hypothetical protein MIMGU_mgv1a007264mg              54.3    2e-05   
ref|XP_006964732.1|  predicted protein                                53.9    2e-05   
dbj|GAC76826.1|  GIY-YIG type nuclease                                54.3    2e-05   
ref|XP_004246967.1|  PREDICTED: uncharacterized protein LOC101267927  54.3    2e-05   
ref|XP_010414278.1|  PREDICTED: uncharacterized protein LOC104700453  54.3    2e-05   
ref|XP_007696904.1|  hypothetical protein COCSADRAFT_285650           54.3    2e-05   
ref|NP_180594.2|  Excinuclease ABC, C subunit, N-terminal             54.3    2e-05   
dbj|GAK63716.1|  conserved hypothetical protein                       54.3    2e-05   
emb|CEF65398.1|  Structure-specific endonuclease subunit SLX1 hom...  53.9    2e-05   
ref|XP_006361297.1|  PREDICTED: uncharacterized protein LOC102597488  53.9    2e-05   
gb|KEF54805.1|  hypothetical protein A1O9_09247                       53.9    2e-05   
ref|XP_008721520.1|  hypothetical protein HMPREF1541_08980            53.9    2e-05   
emb|CEJ89774.1|  Putative Structure-specific endonuclease subunit...  53.9    3e-05   
gb|AAC16937.1|  hypothetical protein                                  53.9    3e-05   
ref|XP_009301807.1|  PREDICTED: structure-specific endonuclease s...  53.5    3e-05   
gb|EHK42053.1|  hypothetical protein TRIATDRAFT_16910                 53.9    3e-05   
ref|XP_006658414.1|  PREDICTED: uncharacterized protein LOC102707229  53.9    3e-05   
ref|XP_001337124.1|  PREDICTED: structure-specific endonuclease s...  53.5    3e-05   
ref|XP_010510375.1|  PREDICTED: uncharacterized protein LOC104786625  53.9    3e-05   
ref|XP_007375199.1|  hypothetical protein SPAPADRAFT_50535            53.5    3e-05   
emb|CCX06856.1|  Similar to Structure-specific endonuclease subun...  53.9    3e-05   
ref|XP_007817624.1|  hypothetical protein MAA_01435                   53.1    3e-05   
ref|XP_010785808.1|  PREDICTED: structure-specific endonuclease s...  52.4    3e-05   
ref|XP_003966868.1|  PREDICTED: structure-specific endonuclease s...  53.5    3e-05   
ref|WP_005959126.1|  endonuclease                                     50.8    3e-05   
ref|XP_002782502.1|  conserved hypothetical protein                   53.5    3e-05   
gb|KID95551.1|  GIY-YIG catalytic domain containing protein           53.1    3e-05   
gb|EGT54325.1|  hypothetical protein CAEBREN_11013                    53.9    3e-05   
gb|EGT50705.1|  hypothetical protein CAEBREN_02710                    53.9    3e-05   
ref|XP_007224990.1|  hypothetical protein PRUPE_ppa020498mg           53.5    3e-05   
ref|XP_008599925.1|  GIY-YIG catalytic domain-containing protein      53.5    3e-05   
ref|XP_004294742.1|  PREDICTED: uncharacterized protein LOC101299940  53.9    3e-05   
gb|KEQ58223.1|  hypothetical protein M437DRAFT_70190                  53.9    3e-05   
gb|KGO63973.1|  Zinc finger, RING/FYVE/PHD-type                       53.5    3e-05   
ref|XP_002502748.1|  predicted protein                                53.9    3e-05   
gb|KHN48399.1|  Structure-specific endonuclease subunit SLX1          53.5    3e-05   
gb|KDN42998.1|  hypothetical protein K437DRAFT_155841                 53.9    3e-05   
sp|A6RYJ8.2|SLX1_BOTFB  RecName: Full=Structure-specific endonucl...  53.5    3e-05   
ref|XP_008326150.1|  PREDICTED: structure-specific endonuclease s...  53.1    3e-05   
gb|KFH46568.1|  Structure-specific endonuclease subunit-like protein  53.5    3e-05   
ref|XP_007721498.1|  hypothetical protein A1O1_02397                  53.5    3e-05   
sp|C0NTM8.1|SLX1_AJECG  RecName: Full=Structure-specific endonucl...  53.5    3e-05   
gb|ERT00482.1|  hypothetical protein HMPREF1624_03855                 53.5    3e-05   
ref|XP_007255803.1|  PREDICTED: structure-specific endonuclease s...  53.1    4e-05   
ref|WP_007018575.1|  endonuclease                                     50.4    4e-05   
ref|XP_006687031.1|  hypothetical protein CANTEDRAFT_105926           53.1    4e-05   
ref|XP_001941375.1|  GIY-YIG catalytic domain containing protein      53.5    4e-05   
ref|XP_009343299.1|  PREDICTED: uncharacterized protein LOC103935260  53.5    4e-05   
gb|KIH91089.1|  structure-specific endonuclease subunit SLX1          53.5    4e-05   
gb|KDB18745.1|  GIY-YIG catalytic domain containing protein           53.5    4e-05   
gb|KEQ74900.1|  hypothetical protein M436DRAFT_42777                  53.5    4e-05   
ref|XP_006673162.1|  GIY-YIG catalytic domain containing protein      53.5    4e-05   
ref|XP_001266190.1|  GIY-YIG catalytic domain containing protein      53.5    4e-05   
ref|WP_037054694.1|  hypothetical protein                             50.4    4e-05   
gb|ETN58850.1|  hypothetical protein AND_009583                       53.5    4e-05   
emb|CEG00278.1|  GIY-YIG nuclease superfamily                         53.5    4e-05   
gb|ENH82300.1|  giy-yig catalytic domain-containing protein           53.1    4e-05   
gb|KID73345.1|  GIY-YIG catalytic domain containing protein           53.1    4e-05   
gb|KID64364.1|  GIY-YIG catalytic domain containing protein           53.1    4e-05   
gb|EGA87961.1|  Slx1p                                                 53.1    4e-05   
gb|EKC31875.1|  Structure-specific endonuclease subunit slx1          53.1    4e-05   
gb|EFZ04361.2|  GIY-YIG catalytic domain containing protein           53.1    4e-05   
ref|XP_002568603.1|  Pc21g15940                                       53.1    5e-05   
ref|XP_003092877.1|  CRE-SLX-1 protein                                53.1    5e-05   
emb|CDM29662.1|  Structure-specific endonuclease subunit slx1         53.1    5e-05   
ref|XP_006843734.1|  hypothetical protein AMTR_s00007p00225130        53.1    5e-05   
ref|XP_681481.1|  hypothetical protein AN8212.2                       53.1    5e-05   
gb|KGO43361.1|  Zinc finger, FYVE/PHD-type                            53.1    5e-05   
gb|ETS63078.1|  hypothetical protein PaG_02853                        53.1    5e-05   
ref|WP_034819452.1|  endonuclease                                     50.1    5e-05   
ref|XP_010557184.1|  PREDICTED: structure-specific endonuclease s...  53.1    5e-05   
ref|XP_005807958.1|  PREDICTED: structure-specific endonuclease s...  52.8    5e-05   
ref|XP_008881705.1|  GIY-YIG catalytic domain-containing protein      53.5    5e-05   
ref|XP_008470073.1|  PREDICTED: structure-specific endonuclease s...  52.0    5e-05   
ref|XP_007205306.1|  hypothetical protein PRUPE_ppa006794mg           53.1    5e-05   
gb|ESZ98181.1|  hypothetical protein SBOR_1450                        53.1    5e-05   
ref|XP_007205311.1|  hypothetical protein PRUPE_ppa006827mg           53.1    5e-05   
ref|XP_006294402.1|  hypothetical protein CARUB_v10023419mg           53.1    5e-05   
ref|WP_014703392.1|  endonuclease                                     50.1    6e-05   
gb|KHJ75912.1|  GIY-YIG catalytic domain protein                      50.8    6e-05   
ref|XP_002371819.1|  hypothetical protein TGME49_012170               53.1    6e-05   
ref|WP_014999113.1|  endonuclease                                     50.4    6e-05   
ref|XP_009354638.1|  PREDICTED: uncharacterized protein LOC103945776  52.8    6e-05   
gb|KFH01849.1|  GIY-YIG catalytic domain-containing protein           53.1    6e-05   
emb|CBI15837.3|  unnamed protein product                              52.8    6e-05   
gb|KFG57317.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
gb|KFG31223.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
gb|EPR61922.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
gb|ESS32307.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
ref|XP_001801442.1|  hypothetical protein SNOG_11198                  52.8    7e-05   
gb|KFH13680.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
ref|WP_035489684.1|  endonuclease                                     49.7    7e-05   
ref|XP_008243781.1|  PREDICTED: uncharacterized protein LOC103341969  52.8    7e-05   
gb|EPT26832.1|  GIY-YIG catalytic domain-containing protein           53.1    7e-05   
ref|XP_008230594.1|  PREDICTED: uncharacterized protein LOC103329817  52.8    7e-05   
ref|WP_009471643.1|  excinuclease ABC subunit C                       49.7    7e-05   
ref|XP_002276725.2|  PREDICTED: structure-specific endonuclease s...  52.8    7e-05   
ref|XP_003537333.1|  PREDICTED: uncharacterized protein LOC100801307  52.8    7e-05   
ref|XP_005100714.1|  PREDICTED: structure-specific endonuclease s...  52.0    7e-05   
ref|WP_029511012.1|  endonuclease                                     49.7    7e-05   
sp|B3LMT5.1|SLX1_YEAS1  RecName: Full=Structure-specific endonucl...  52.4    7e-05   
ref|XP_003884521.1|  hypothetical protein NCLIV_049200                52.8    8e-05   
ref|XP_008384697.1|  PREDICTED: structure-specific endonuclease s...  52.4    8e-05   
gb|ELR05835.1|  hypothetical protein GMDG_07608                       52.4    8e-05   
ref|NP_009787.3|  Slx1p                                               52.4    8e-05   
ref|XP_003845040.1|  similar to GIY-YIG catalytic domain containi...  52.4    8e-05   
ref|XP_010886361.1|  PREDICTED: structure-specific endonuclease s...  51.6    8e-05   
sp|A6ZLG6.1|SLX1_YEAS7  RecName: Full=Structure-specific endonucl...  52.4    8e-05   
ref|WP_038977529.1|  hypothetical protein                             49.3    9e-05   
ref|WP_010504225.1|  excinuclease ABC subunit C                       49.7    9e-05   
gb|EIF46711.1|  putative dna replication structure-specific endon...  52.4    9e-05   
ref|XP_007601526.1|  GIY-YIG catalytic domain-containing protein      52.4    9e-05   
ref|XP_011080671.1|  PREDICTED: structure-specific endonuclease s...  52.4    9e-05   
gb|ENN71852.1|  hypothetical protein YQE_11470                        52.0    9e-05   
gb|AEE61515.1|  unknown                                               52.0    9e-05   
sp|Q0UAL6.3|SLX1_PHANO  RecName: Full=Structure-specific endonucl...  52.4    9e-05   
ref|XP_009016408.1|  hypothetical protein HELRODRAFT_77631            52.0    1e-04   
ref|WP_012822551.1|  MULTISPECIES: GIY-YIG nuclease                   49.7    1e-04   
gb|EFQ35583.1|  GIY-YIG catalytic domain-containing protein           52.0    1e-04   
ref|XP_003050623.1|  hypothetical protein NECHADRAFT_49413            52.0    1e-04   
ref|XP_008433147.1|  PREDICTED: structure-specific endonuclease s...  51.6    1e-04   
ref|XP_011102594.1|  slx1p                                            52.0    1e-04   
emb|CAF93873.1|  unnamed protein product                              51.2    1e-04   
ref|XP_007146860.1|  hypothetical protein PHAVU_006G076300g           52.0    1e-04   
ref|WP_023660331.1|  putative endonuclease                            49.7    1e-04   
ref|XP_007567944.1|  PREDICTED: structure-specific endonuclease s...  51.6    1e-04   
ref|XP_010252109.1|  PREDICTED: structure-specific endonuclease s...  52.0    1e-04   
gb|KDN69266.1|  putative GIY-YIG catalytic domain-containing protein  51.6    1e-04   
gb|EFX02422.1|  giy-yig catalytic domain containing protein           52.0    1e-04   
ref|XP_006460922.1|  hypothetical protein AGABI2DRAFT_117837          52.0    1e-04   
ref|XP_010749840.1|  PREDICTED: structure-specific endonuclease s...  51.6    1e-04   
ref|XP_007328399.1|  hypothetical protein AGABI1DRAFT_126840          52.0    1e-04   
emb|CDQ66138.1|  unnamed protein product                              51.6    1e-04   
ref|XP_007418271.1|  hypothetical protein MELLADRAFT_40851            51.2    1e-04   
ref|WP_020028147.1|  hypothetical protein                             48.9    1e-04   
ref|XP_003958388.1|  hypothetical protein KAFR_0G02190                51.6    1e-04   
emb|CCF31730.1|  GIY-YIG catalytic domain-containing protein          51.6    1e-04   
gb|EQB59097.1|  GIY-YIG catalytic domain-containing protein           51.6    1e-04   
ref|XP_001496640.2|  PREDICTED: structure-specific endonuclease s...  51.6    1e-04   
gb|EKV10879.1|  Structure-specific endonuclease subunit slx1          48.5    1e-04   



>ref|XP_009790868.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Nicotiana sylvestris]
Length=233

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTNPPIKTYVGVTTNFSRRLK+HNGE+KGGAKASR+GRPWICACLIRGF  RS
Sbjct  105  WCVYLILSTNPPIKTYVGVTTNFSRRLKQHNGEIKGGAKASRSGRPWICACLIRGFEGRS  164

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EACAFE++WKQ+SR+LP K K  EEQK E+  S +LL+HR+AAL++
Sbjct  165  EACAFESKWKQVSRRLPRKRKTTEEQKPEDNGSSVLLQHRHAALNR  210



>ref|XP_004229678.1| PREDICTED: structure-specific endonuclease subunit slx1 [Solanum 
lycopersicum]
Length=200

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTNPPIKTYVGVTTNF RRLKEHNGELKGGAKASR+GRPWICACLIRGF  RS
Sbjct  75   WCVYLILSTNPPIKTYVGVTTNFCRRLKEHNGELKGGAKASRSGRPWICACLIRGFKGRS  134

Query  273  EACAFETRWKQLSRKLPCKGKGN-EEQKLEETKSVLLLKHRYAALDQ  136
            EACAFE++WKQ+SRKLP K K + EEQ+ E+  S+ LL+HR+AALD+
Sbjct  135  EACAFESKWKQISRKLPRKRKSSTEEQEPEDNGSLALLQHRHAALDR  181



>ref|XP_009602384.1| PREDICTED: uncharacterized protein LOC104097520 [Nicotiana tomentosiformis]
Length=230

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTTN SRRLK+HNGELKGGAK+SR+GRPWICACLIRGF  RS
Sbjct  104  WCVYLILSTNSPIKTYVGVTTNISRRLKQHNGELKGGAKSSRSGRPWICACLIRGFEGRS  163

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALD  139
            EACAFE++WKQ+SRKLP K K  EEQK E+  S  LL+HR+AALD
Sbjct  164  EACAFESKWKQVSRKLPRKRKTTEEQKPEDNGSFALLQHRHAALD  208



>ref|XP_006345391.1| PREDICTED: structure-specific endonuclease subunit SLX1-like 
[Solanum tuberosum]
Length=221

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 5/111 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASR+GRPWICACLIRGF  RS
Sbjct  92   WCVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRSGRPWICACLIRGFKGRS  151

Query  273  EACAFETRWKQLSRKLPCKGKGNE-----EQKLEETKSVLLLKHRYAALDQ  136
            EACAFE++WKQ+SRKLP K K        EQ+ E+  S+ LL+HR+AALD+
Sbjct  152  EACAFESKWKQISRKLPRKRKSTTEEQEQEQEPEDNGSLALLQHRHAALDR  202



>ref|XP_010269715.1| PREDICTED: structure-specific endonuclease subunit SLX1 [Nelumbo 
nucifera]
Length=170

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W+VYLILSTN PIKTYVGVTT+F RRLK+HNGELKGGAKASRAGRPW+CAC+IRGF D+S
Sbjct  46   WTVYLILSTNTPIKTYVGVTTDFPRRLKQHNGELKGGAKASRAGRPWVCACIIRGFKDQS  105

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK +S+KLP K K ++  K  +  S+LLL+HR AALD+
Sbjct  106  EACEFESKWKSISQKLPRKRKADDTSKHMDNGSLLLLQHRKAALDR  151



>emb|CDP14371.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTNPPIKTYVGVTTNFSRRLK+HNGE+ GGAKASRAGRPW+CACLI+GF D+S
Sbjct  77   WSVYLILSTNPPIKTYVGVTTNFSRRLKQHNGEVNGGAKASRAGRPWVCACLIKGFRDKS  136

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK  SRKL  K K  E ++ ++ +S+ LL HR+AAL +
Sbjct  137  EACEFESKWKLFSRKLSRKRKTTEVEEQDDNRSLALLHHRHAALSR  182



>ref|XP_010067785.1| PREDICTED: structure-specific endonuclease subunit slx1 [Eucalyptus 
grandis]
 ref|XP_010067786.1| PREDICTED: structure-specific endonuclease subunit slx1 [Eucalyptus 
grandis]
 gb|KCW65981.1| hypothetical protein EUGRSUZ_G03277 [Eucalyptus grandis]
Length=203

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTNPPIKTYVGVTT+F RRLK+HNGEL GGAKASRAGRPW+CACL++GF DRS
Sbjct  79   WCVYLILSTNPPIKTYVGVTTDFRRRLKQHNGELSGGAKASRAGRPWVCACLVQGFKDRS  138

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK LSRKLP +    + +K  E  S LLL+HR  ALD+
Sbjct  139  EACVFESKWKSLSRKLPRQRSCGDMEKQAEDISQLLLQHRQMALDR  184



>ref|XP_002298410.1| hypothetical protein POPTR_0001s26780g [Populus trichocarpa]
 gb|EEE83215.1| hypothetical protein POPTR_0001s26780g [Populus trichocarpa]
Length=177

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASRAGRPWICAC+IRGF DRSEA
Sbjct  55   VYLILSTNRPIKTYVGVTTNFSRRLKQHNGELKGGAKASRAGRPWICACIIRGFNDRSEA  114

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE++WK  SRKLP K   +++ K     S  LL+HR  ALD+
Sbjct  115  CKFESKWKIFSRKLPRKRIDDDQMKQSSKDSHRLLQHRKTALDR  158



>ref|XP_004303087.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Fragaria vesca subsp. vesca]
Length=174

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKASRAGRPWICACL+ GF D++
Sbjct  50   WSVYLILSTNAPIKTYVGVTTDFSRRLKQHNGELKGGAKASRAGRPWICACLVHGFKDQN  109

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            E C+FE++WK LSR LP K K + E +     S+ LL+HR AAL++
Sbjct  110  EVCSFESKWKTLSRSLPRKRKDDSEAEQANNLSLPLLQHRQAALNR  155



>ref|XP_002298387.1| hypothetical protein POPTR_0001s26700g [Populus trichocarpa]
 gb|EEE83192.1| hypothetical protein POPTR_0001s26700g [Populus trichocarpa]
Length=178

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASRAGRPWICAC+IRGF DRSEA
Sbjct  56   VYLILSTNHPIKTYVGVTTNFSRRLKQHNGELKGGAKASRAGRPWICACIIRGFNDRSEA  115

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE++WK  SRK P K   +++ K     S  LL+HR  ALD+
Sbjct  116  CKFESKWKSFSRKFPRKRIDDDQMKQSRKDSHRLLQHRKTALDR  159



>ref|XP_010694700.1| PREDICTED: structure-specific endonuclease subunit slx1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI STNPP KTYVGVTTNFSRRLK+HNGELKGGAKASRAGRPWICACL++GF ++S
Sbjct  46   WCVYLIASTNPPFKTYVGVTTNFSRRLKQHNGELKGGAKASRAGRPWICACLVQGFRNQS  105

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK +SRKLP K K  +++ L++    LLL+HR+AA+++
Sbjct  106  EACEFESKWKNISRKLPRKQKSVDKKGLDDN-GRLLLQHRHAAMEK  150



>ref|XP_008231532.1| PREDICTED: structure-specific endonuclease subunit slx1 [Prunus 
mume]
Length=171

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKAS AGRPWICACLI GF D+S
Sbjct  47   WSVYLILSTNTPIKTYVGVTTDFSRRLKQHNGELKGGAKASSAGRPWICACLIHGFKDQS  106

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETK--SVLLLKHRYAALDQ  136
            EAC FE++WK LSR LP K K   + K+E+ K  S+ LL+HR AAL++
Sbjct  107  EACEFESKWKSLSRSLPRKRKN--DNKVEQVKHLSLPLLQHRQAALNR  152



>emb|CBI28599.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASR GRPW+CAC+I+GF D+S
Sbjct  38   WLVYLILSTNTPIKTYVGVTTNFSRRLKQHNGELKGGAKASRTGRPWVCACIIQGFKDKS  97

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK  SRKLP   K N+  +  +  S+LLL+HR AAL++
Sbjct  98   EACQFESKWKSFSRKLP--RKRNDTVRQVDNDSLLLLQHREAALNR  141



>ref|XP_002298390.2| hypothetical protein POPTR_0001s26730g [Populus trichocarpa]
 gb|EEE83195.2| hypothetical protein POPTR_0001s26730g [Populus trichocarpa]
Length=178

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASRAGRPWICAC+IRGF DRSEA
Sbjct  56   VYLILSTNHPIKTYVGVTTNFSRRLKQHNGELKGGAKASRAGRPWICACIIRGFNDRSEA  115

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
              FE++WK  SRK P K   +++ K     S  LL+HR  ALD+
Sbjct  116  SKFESKWKSFSRKFPRKRIDDDQMKQSRKDSHRLLQHRKTALDR  159



>gb|EYU42980.1| hypothetical protein MIMGU_mgv1a014500mg [Erythranthe guttata]
Length=187

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W+VYLI+STNPPIKTYVG T NFSRRLK+HNGELKGGAKASRAGRPWICACL++GF ++S
Sbjct  63   WTVYLIVSTNPPIKTYVGATNNFSRRLKQHNGELKGGAKASRAGRPWICACLVQGFTNKS  122

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            +A  FE++WK +SRK P K    + ++ +    +LLL+HRYAAL++
Sbjct  123  KAYVFESKWKTVSRKSPRKRSSQKTEQTDSNPQLLLLQHRYAALNK  168



>ref|XP_011008278.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Populus euphratica]
Length=179

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGV TNFSRRLK+HNGELKGGAKASRAGRPWICAC+I GF DRSEA
Sbjct  57   VYLILSTNHPIKTYVGVATNFSRRLKQHNGELKGGAKASRAGRPWICACIILGFNDRSEA  116

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE++WK  SRKLP K   +++ K     S  LL+HR  ALD+
Sbjct  117  CKFESKWKSFSRKLPRKRIDDDQMKQSSKDSHRLLQHRKTALDR  160



>ref|XP_004516472.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Cicer arietinum]
Length=169

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTTNF RRLK+HNGELKGGAKASRAGRPWICACLI GF DRS
Sbjct  45   WCVYLILSTNHPIKTYVGVTTNFPRRLKQHNGELKGGAKASRAGRPWICACLICGFADRS  104

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            EAC FE++WK  +R+ P K + +   K  E  S+ LL+HR AAL++ +N+  C 
Sbjct  105  EACVFESKWKAFTRRFPRKNQNDNLSKECEDPSLPLLRHRQAALNRVKNSLDCT  158



>gb|KDP43613.1| hypothetical protein JCGZ_16900 [Jatropha curcas]
Length=169

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVT NFSRRLK+HNG+LKGGAKASRAGRPWICACLI+GF D+S
Sbjct  45   WCVYLILSTNAPIKTYVGVTNNFSRRLKQHNGDLKGGAKASRAGRPWICACLIQGFSDQS  104

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK LSRKLP   K ++  K     S  LL+HR  AL +
Sbjct  105  EACEFESKWKSLSRKLPRNRKNDDSTKDSINGSHALLQHRQTALSR  150



>ref|XP_003533500.2| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Glycine max]
Length=173

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+T NF RRLK+HNGELKGGAKASRAGRPWICAC+I GF DRS
Sbjct  49   WSVYLILSTNHPIKTYVGITNNFPRRLKQHNGELKGGAKASRAGRPWICACIICGFTDRS  108

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EA  FE++WK  SR+ P K + +   K  E  S+ LL+HR AAL++
Sbjct  109  EASVFESKWKTFSRRAPRKNQNDNLSKQSEDSSLPLLRHRQAALNR  154



>gb|KEH17663.1| structure-specific endonuclease subunit SLX1-like protein [Medicago 
truncatula]
Length=168

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTTNF RRLKEHNG+LKGGAKASRAGRPWICAC++ GF +RS
Sbjct  42   WCVYLILSTNHPIKTYVGVTTNFPRRLKEHNGDLKGGAKASRAGRPWICACIVCGFTNRS  101

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETK--SVLLLKHRYAALDQENT  127
            EAC FE++WK LSR++P K + ++  K  E++  S  LL+HR AAL++  T
Sbjct  102  EACVFESKWKALSRRVPRKKQNDDSSKQSESEDPSRPLLQHRQAALNRVKT  152



>gb|KHN11715.1| Structure-specific endonuclease subunit slx1 [Glycine soja]
Length=173

 Score =   153 bits (387),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+T NF RRLK+HNGELKGGAKASRAGRPWICAC+I GF DRS
Sbjct  49   WSVYLILSTNHPIKTYVGITNNFPRRLKQHNGELKGGAKASRAGRPWICACIICGFTDRS  108

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EA  FE++WK  SR+ P K + +   K  E  S+ LL+HR AAL++
Sbjct  109  EASVFESKWKTFSRRAPRKNQNDNLSKQSEDSSLPLLRHRQAALNR  154



>ref|XP_011091781.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Sesamum indicum]
Length=187

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W+VYLILSTN PIKTYVGVT NFSRRLK+HNGE++GGAKASRAGRPWICACLI+GF D+S
Sbjct  64   WAVYLILSTNSPIKTYVGVTNNFSRRLKQHNGEVRGGAKASRAGRPWICACLIKGFQDKS  123

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            +A  FE++WK  SRKLP K + ++  +  +   +LLL+HRYA+L+Q
Sbjct  124  KAYEFESKWKSFSRKLPRK-RSSKNLENADNPQILLLQHRYASLNQ  168



>ref|XP_008354910.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
isoform X2 [Malus domestica]
Length=198

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKAS AGRPWICACLI GF  +SEA
Sbjct  77   VYLILSTNSPIKTYVGVTTDFSRRLKQHNGELKGGAKASSAGRPWICACLIHGFKGQSEA  136

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE++WK LSR+LP K K ++E++     S+ LL+HR AALD+
Sbjct  137  CEFESKWKTLSRRLPRKRKKHDEEERANDLSLPLLQHRQAALDR  180



>ref|XP_006438929.1| hypothetical protein CICLE_v10032919mg [Citrus clementina]
 ref|XP_006482939.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Citrus sinensis]
 gb|ESR52169.1| hypothetical protein CICLE_v10032919mg [Citrus clementina]
Length=170

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+STNPPIKTYVG TTNF RRLK+HNGEL+GGAKAS+AGRPWI AC+I+GF D+S
Sbjct  52   WSVYLIISTNPPIKTYVGTTTNFPRRLKQHNGELRGGAKASQAGRPWISACIIQGFHDQS  111

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +AC FE++WK +SR+LP K K +E+  L       LL+HR  AL++ +  C C+
Sbjct  112  DACEFESKWKSISRRLPRKRKKSEDSSLH------LLQHRQTALNRVKEVCNCS  159



>ref|XP_008354909.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Malus domestica]
Length=199

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKAS AGRPWICACLI GF  +SEA
Sbjct  77   VYLILSTNSPIKTYVGVTTDFSRRLKQHNGELKGGAKASSAGRPWICACLIHGFKGQSEA  136

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE++WK LSR+LP K K ++E++     S+ LL+HR AALD+
Sbjct  137  CEFESKWKTLSRRLPRKRKKHDEEERANDLSLPLLQHRQAALDR  180



>ref|XP_009354395.1| PREDICTED: structure-specific endonuclease subunit slx1 [Pyrus 
x bretschneideri]
Length=174

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEA  268
            VYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKAS AGRPWICACLI GF  +SEA
Sbjct  52   VYLILSTNSPIKTYVGVTTDFSRRLKQHNGELKGGAKASSAGRPWICACLIHGFKGQSEA  111

Query  267  CAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            C FE +WK LSR LP K K ++E++     S+ LL+HR AALD+
Sbjct  112  CEFEAKWKTLSRHLPRKRKKHDEEEQANDLSLPLLQHRQAALDR  155



>ref|XP_007219127.1| hypothetical protein PRUPE_ppa015867mg [Prunus persica]
 gb|EMJ20326.1| hypothetical protein PRUPE_ppa015867mg [Prunus persica]
Length=171

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKAS AGRPWICACLI GF D+S
Sbjct  47   WSVYLILSTNTPIKTYVGVTTDFSRRLKQHNGELKGGAKASCAGRPWICACLIHGFKDQS  106

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK LSR L  K K + + +  +  S+ LL+HR AAL++
Sbjct  107  EACEFESKWKSLSRSLSRKRKNDNKVEQVKDLSLPLLQHRQAALNR  152



>gb|KHG08841.1| slx1 [Gossypium arboreum]
Length=168

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 4/106 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVT NFSRRLK+HNGEL GGAKASRAGRPW+CAC++RGF D+S
Sbjct  48   WCVYLILSTNSPIKTYVGVTNNFSRRLKQHNGELSGGAKASRAGRPWVCACVVRGFHDQS  107

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE +WK  SRKLP K K  E        S+ LL+HR  AL++
Sbjct  108  EACEFEFKWKMASRKLPRKKKNKEADDC----SLTLLQHRQTALNK  149



>ref|XP_007052427.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX96584.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 1 [Theobroma cacao]
Length=1289

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = -3

Query  453   WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
             W VYLILSTN PIKTYVGVTT+FSRRLK+HNGELKGGAKASRAGRPWICAC+IRGF D+S
Sbjct  1163  WCVYLILSTNAPIKTYVGVTTDFSRRLKQHNGELKGGAKASRAGRPWICACIIRGFNDQS  1222

Query  273   EACAFETRWKQLSRKLPCKGKGNEEQK--LEETKSVLLLKHRYAALDQ  136
             EAC FE++WK+ SRKLPCK K ++  K   E+  S+ LL+HR  AL++
Sbjct  1223  EACEFESKWKRFSRKLPCKRKNSDLTKEVDEDDGSLTLLQHRQTALNR  1270



>ref|XP_007131435.1| hypothetical protein PHAVU_011G013300g [Phaseolus vulgaris]
 gb|ESW03429.1| hypothetical protein PHAVU_011G013300g [Phaseolus vulgaris]
Length=168

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVG+T NF RRLK+HNGEL GGAKASRAGRPWICAC+I GF DRS
Sbjct  44   WCVYLILSTNHPIKTYVGITNNFPRRLKQHNGELNGGAKASRAGRPWICACIICGFTDRS  103

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAAL  142
            EA  FE++WK +SR+ P K K +   +  E  S  LL+HR AAL
Sbjct  104  EASIFESKWKAISRRAPRKNKNDHHSQQSEDPSSPLLQHRQAAL  147



>ref|XP_006587691.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X2 [Glycine max]
Length=176

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRR---LKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            WSVYLILSTN PIKTYVG+T NF RR   LK+HNGELKGGAKASRAGRPWICAC+I GF 
Sbjct  49   WSVYLILSTNHPIKTYVGITNNFPRRWCSLKQHNGELKGGAKASRAGRPWICACIICGFT  108

Query  282  DRSEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            DRSEA  FE++WK  SR+ P K + +   K  E  S+ LL+HR AAL++
Sbjct  109  DRSEASVFESKWKTFSRRAPRKNQNDNLSKQSEDSSLPLLRHRQAALNR  157



>ref|XP_002271242.2| PREDICTED: putative disease resistance protein RGA1 [Vitis vinifera]
Length=1278

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = -3

Query  453   WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
             W VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASR GRPW+CAC+I+GF D+S
Sbjct  1156  WLVYLILSTNTPIKTYVGVTTNFSRRLKQHNGELKGGAKASRTGRPWVCACIIQGFKDKS  1215

Query  273   EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
             EAC FE++WK  SRKLP   K N+  +  +  S+LLL+HR AAL++
Sbjct  1216  EACQFESKWKSFSRKLP--RKRNDTVRQVDNDSLLLLQHREAALNR  1259



>ref|XP_010558908.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Tarenaya hassleriana]
Length=177

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTT+FSRRLK+HNGE++GGAKAS AGRPW+CAC++ GF  +S
Sbjct  55   WCVYLILSTNKPIKTYVGVTTDFSRRLKQHNGEIRGGAKASCAGRPWLCACIVHGFNGQS  114

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EA +FE+ WK +SRKLP K K  +  +  +  S  LL+HR  ALD+
Sbjct  115  EASSFESNWKSISRKLPRKQKNRDTLEQSDDGSHALLQHRKTALDK  160



>ref|XP_010557824.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Tarenaya hassleriana]
 ref|XP_010557828.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010557830.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X2 [Tarenaya hassleriana]
Length=179

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTT+FSRRLK+HNGE++GGAKAS AGRPW+CAC++ GF  +S
Sbjct  55   WCVYLILSTNKPIKTYVGVTTDFSRRLKQHNGEIRGGAKASCAGRPWLCACIVHGFNGQS  114

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EA +FE+ WK +SRKLP K K  +  +  +  S  LL+HR  ALD+
Sbjct  115  EASSFESNWKSISRKLPRKQKNRDTLEQSDDGSHALLQHRKTALDK  160



>ref|XP_004151512.1| PREDICTED: structure-specific endonuclease subunit SLX1-like 
[Cucumis sativus]
 gb|KGN58557.1| hypothetical protein Csa_3G683170 [Cucumis sativus]
Length=170

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VYLI+S+N PIKTYVGVT +F RRLK+HNGE+KGGAKA+RAGRPWICAC I GF D+
Sbjct  45   QWCVYLIISSNSPIKTYVGVTLDFDRRLKQHNGEIKGGAKATRAGRPWICACTIHGFKDQ  104

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAAL  142
            S+AC FE++WK++SRK+  + K  +  KL + +++ LLKHR  AL
Sbjct  105  SQACEFESKWKKVSRKISYEKKEEDVGKLLDDQTLRLLKHRERAL  149



>ref|XP_008461838.1| PREDICTED: structure-specific endonuclease subunit slx1 [Cucumis 
melo]
 ref|XP_008461839.1| PREDICTED: structure-specific endonuclease subunit slx1 [Cucumis 
melo]
Length=169

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VYLI+S+N PIKTYVGVT +F RRLK+HNGE+KGGAKA++AGRPWICAC I GF D+
Sbjct  44   QWCVYLIISSNSPIKTYVGVTLDFDRRLKQHNGEIKGGAKATQAGRPWICACTIHGFKDQ  103

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAAL  142
            S+AC FE++WK++SRK+  + K ++  K  + +++ LLKHR  AL
Sbjct  104  SQACEFESKWKKVSRKISYEKKEDDVGKQLDNQTLRLLKHRQRAL  148



>gb|KFK31729.1| hypothetical protein AALP_AA6G151500 [Arabis alpina]
Length=166

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+F+RRLK+HNGE++GGAKAS AGRPW+CACLI GF   S
Sbjct  49   WSVYLILSTNQPIKTYVGITTDFTRRLKQHNGEIRGGAKASSAGRPWLCACLINGFTCLS  108

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE +WK  SRKLP + K NEE      +S  LL+HR  ALD+ +++  C+
Sbjct  109  QASSFEAKWKIFSRKLP-RRKINEEM----NQSDALLQHRRRALDKVQDSLECS  157



>ref|XP_010481892.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Camelina sativa]
 ref|XP_010481893.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Camelina sativa]
Length=173

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+F+RRLK+HNGE++GGAKAS AGRPW+CAC+I GF   S
Sbjct  57   WSVYLILSTNEPIKTYVGITTDFARRLKQHNGEIRGGAKASSAGRPWLCACIITGFTCLS  116

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE++WK  SRKLP + K       E ++S  LL HR  ALD+ E +  C+
Sbjct  117  QAASFESKWKIFSRKLPRRKKDE-----EMSQSDALLLHRRRALDKVEESLECS  165



>ref|XP_009123871.1| PREDICTED: structure-specific endonuclease subunit slx1 [Brassica 
rapa]
 emb|CDY46487.1| BnaA02g36710D [Brassica napus]
Length=169

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILST  PIKTYVG+TT+F+RRLK+HNGE+KGGAKAS AGRPW+CAC+I GF   S
Sbjct  50   WSVYLILSTKEPIKTYVGITTDFARRLKQHNGEIKGGAKASSAGRPWLCACIITGFTCLS  109

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            +A +FE++WK  +RKLP + KG E  + E      LL+HR  ALD+
Sbjct  110  KASSFESKWKIFTRKLPRRKKGEEMSQSEA-----LLQHRRRALDK  150



>ref|XP_010494293.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Camelina sativa]
Length=172

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+F+RRLK+HNGE++GGAKAS AGRPW+CAC+I GF   S
Sbjct  56   WSVYLILSTNEPIKTYVGITTDFARRLKQHNGEIRGGAKASSAGRPWLCACIITGFTCLS  115

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE++WK  SRKLP + K       E ++S  LL HR  ALD+ E +  C+
Sbjct  116  QAASFESKWKIFSRKLPRRKKDE-----EMSQSDALLLHRRRALDKVEESLECS  164



>ref|XP_006403276.1| hypothetical protein EUTSA_v10003279mg [Eutrema salsugineum]
 gb|ESQ44729.1| hypothetical protein EUTSA_v10003279mg [Eutrema salsugineum]
Length=168

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+ +RRLK+HNGE++GGAKAS AGRPW+CAC+I GF   S
Sbjct  52   WSVYLILSTNEPIKTYVGITTDIARRLKQHNGEIRGGAKASSAGRPWLCACIITGFTCLS  111

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE++WK LSRKLP + K       E  +S  LL+HR  ALD+ +++ +C+
Sbjct  112  QASSFESKWKILSRKLPRRKKDE-----EINQSDALLQHRKRALDKVQDSLKCS  160



>ref|XP_006281183.1| hypothetical protein CARUB_v10027218mg, partial [Capsella rubella]
 gb|EOA14081.1| hypothetical protein CARUB_v10027218mg, partial [Capsella rubella]
Length=181

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+F+RRLK+HNGE++GGAKAS +GRPW+CAC+I GF   S
Sbjct  65   WSVYLILSTNEPIKTYVGITTDFARRLKQHNGEIRGGAKASSSGRPWLCACIITGFTCLS  124

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE++WK  SRKLP + K       E ++S  LL+HR  ALD+ E +  C+
Sbjct  125  QAASFESKWKLFSRKLPRRKKDE-----EMSQSDALLQHRRRALDKVEESLDCS  173



>ref|XP_010093574.1| Structure-specific endonuclease subunit [Morus notabilis]
 gb|EXB54291.1| Structure-specific endonuclease subunit [Morus notabilis]
Length=192

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI+STN PIKTYVGVTT+FSRRLK+HNGELKGGAKA+R+GRPWICACLI GF D+S
Sbjct  53   WCVYLIISTNTPIKTYVGVTTSFSRRLKQHNGELKGGAKATRSGRPWICACLIEGFKDQS  112

Query  273  EACAFETRWKQLSRKLPCKGKG----NEEQKLEETKSVL  169
            EA  FE +WK  SRK P K K     N+  ++ + +S+L
Sbjct  113  EASEFEAKWKIFSRKSPRKKKNESTENQSSEIRKLQSLL  151



>emb|CAN82122.1| hypothetical protein VITISV_009093 [Vitis vinifera]
Length=1697

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  453   WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
             W VYLILSTN PIKTYVGVTTNFSRRLK+HNGELKGGAKASR GRPW+CAC+I+GF D+S
Sbjct  1176  WLVYLILSTNTPIKTYVGVTTNFSRRLKQHNGELKGGAKASRTGRPWVCACIIQGFXDKS  1235

Query  273   EACAFETRWKQLSRKLPCKGKGNEEQKL  190
             EAC FE++WK  SRKLP K      Q L
Sbjct  1236  EACQFESKWKSFSRKLPRKRNDTVRQAL  1263



>ref|XP_002865442.1| hypothetical protein ARALYDRAFT_494683 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41701.1| hypothetical protein ARALYDRAFT_494683 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 5/106 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILST  PIKTYVG+TT+F+RRLK+HNGE++GGAKAS AGRPW+CAC+I GF   S
Sbjct  49   WSVYLILSTTEPIKTYVGITTDFARRLKQHNGEIRGGAKASSAGRPWLCACIITGFTCLS  108

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            +A +FE++WK  SRKLP + K +EE     ++S  LL+HR  AL++
Sbjct  109  QASSFESKWKIFSRKLP-RRKEDEEM----SQSDALLQHRRRALEK  149



>ref|NP_199135.1| Excinuclease ABC, C subunit, N-terminal [Arabidopsis thaliana]
 dbj|BAB10584.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94924.1| Excinuclease ABC, C subunit, N-terminal [Arabidopsis thaliana]
Length=170

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILST  PIKTYVG+TT+FSRRLK+HNGE++GGAKAS AGRPW+CAC+I GF   S
Sbjct  54   WSVYLILSTTEPIKTYVGITTDFSRRLKQHNGEIRGGAKASSAGRPWLCACIITGFTCLS  113

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +FE++WK  +RKLP + K       + ++S  LL+HR  AL++ E +  C+
Sbjct  114  QASSFESKWKIFTRKLPRRKKDE-----DMSQSDALLQHRRRALNKVEESLDCS  162



>ref|XP_010442057.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Camelina sativa]
Length=192

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 6/114 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLILSTN PIKTYVG+TT+F+RRLK+HNGE++GGAKAS AGRPW+CAC+I  F    
Sbjct  76   WSVYLILSTNEPIKTYVGITTDFARRLKQHNGEIRGGAKASSAGRPWLCACIITAFTCLI  135

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            +A +F+++WK  SRKLP + K       E ++S  LL HR  ALD+ E +  C+
Sbjct  136  QAASFKSKWKIFSRKLPRRKKDE-----EMSQSDALLLHRRRALDKVEESLECS  184



>ref|XP_006853037.1| hypothetical protein AMTR_s00038p00020170 [Amborella trichopoda]
 gb|ERN14504.1| hypothetical protein AMTR_s00038p00020170 [Amborella trichopoda]
Length=202

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VYLI+S++   KTYVGVT NF +RLK+HNGEL+GGAKASRAGRPW   C I GF+DR
Sbjct  78   KWCVYLIISSDLS-KTYVGVTVNFDKRLKQHNGELRGGAKASRAGRPWARVCTIEGFIDR  136

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            SEAC FE++WK +SRKLP K     E +  +   + ++KHR  ALD+
Sbjct  137  SEACQFESKWKTISRKLPRKRNHANEGEQSDLHFIPVVKHRETALDR  183



>ref|XP_010922213.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Elaeis guineensis]
 ref|XP_010922214.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Elaeis guineensis]
 ref|XP_010922215.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Elaeis guineensis]
 ref|XP_010922217.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Elaeis guineensis]
Length=172

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 8/106 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+S+  P KTYVGVTTN  RRLK+HNGEL+GGAKAS +GRPW+ AC++RGF D+S
Sbjct  56   WSVYLIVSSRLP-KTYVGVTTNIIRRLKQHNGELRGGAKASSSGRPWVLACIVRGFKDQS  114

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK +SRK+P K K       E   S  LL+HR +AL++
Sbjct  115  EACEFESKWKGISRKMPRKKK-------EGCVSNSLLQHRESALNR  153



>ref|XP_008806563.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
isoform X1 [Phoenix dactylifera]
Length=172

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 8/106 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+S+  P KTYVGVTTN  RRLK+HNGEL+GGAKAS +GRPW+ AC+I+GF D+S
Sbjct  56   WSVYLIVSSRLP-KTYVGVTTNIIRRLKQHNGELRGGAKASSSGRPWVLACIIQGFKDQS  114

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK +SRK+P K K       E      LL+HR AAL++
Sbjct  115  EACVFESKWKGISRKMPRKKK-------EGCALNSLLEHREAALNR  153



>ref|XP_009383244.1| PREDICTED: structure-specific endonuclease subunit slx1 [Musa 
acuminata subsp. malaccensis]
Length=177

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+S+  P +TYVGVTTNF RRLK+HNG LKGGAKA  AGRPW  AC+IRGF DRS
Sbjct  61   WSVYLIVSSRLP-RTYVGVTTNFLRRLKQHNGILKGGAKACSAGRPWTLACIIRGFKDRS  119

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALD  139
            EAC FE++WK +SR++P K K       ++  +  LL+HR AAL+
Sbjct  120  EACEFESKWKSVSRRVPRKTK-------QDCAANPLLEHRRAALN  157



>ref|XP_004977516.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Setaria italica]
Length=156

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 9/110 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKA+ AGRPW  ACL+ GF+ RS
Sbjct  43   WCVYLIASSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKAASAGRPWNLACLVEGFVSRS  101

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENTC  124
            EAC FE++WK +SRK+    +   E  +E      +L+HR AAL +  TC
Sbjct  102  EACEFESKWKNISRKM---ARKRTEHSVES-----VLQHRQAALSKVETC  143



>ref|XP_006663810.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Oryza brachyantha]
Length=162

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 9/110 (8%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            RW VYLI S   P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++R
Sbjct  48   RWCVYLIASYRIP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNR  106

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            SEAC FE++WK +SRK+         +K  E     LL+HR  AL +  T
Sbjct  107  SEACEFESKWKNISRKM--------ARKRGEPSMTSLLQHRDMALSRVKT  148



>gb|ABK21086.1| unknown [Picea sitchensis]
Length=160

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI+S +   KTYVGVTT+F RRLK+HNGEL GGAKASRAGRPW C CL+ GF  RS
Sbjct  32   WYVYLIISADMR-KTYVGVTTDFERRLKQHNGELNGGAKASRAGRPWQCVCLVHGFEGRS  90

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETK-SVLLLKHRYAALDQ  136
            EAC FE +WK  SR    K +  +    +    S LL++HR AALD+
Sbjct  91   EACGFEWKWKYFSRNSSRKSRQLDNLNSQTGYFSSLLVQHRQAALDR  137



>gb|EEC67666.1| hypothetical protein OsI_35089 [Oryza sativa Indica Group]
Length=204

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  91   WCVYLIASSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  149

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +SRK+         +K  E     LL+HR  AL +  T
Sbjct  150  EACEFESKWKNISRKM--------ARKRSEPSMTSLLQHREMALSRLKT  190



>ref|XP_004978649.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Setaria italica]
Length=155

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKA+ AGRPW  ACL+ GF+ +S
Sbjct  42   WCVYLISSSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKAASAGRPWNLACLVEGFVSKS  100

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENTCRCALH  109
            EAC FE++WK +SRK+         +K  E     +L+HR AAL +  T    +H
Sbjct  101  EACEFESKWKNISRKM--------SRKRTEPSVESVLQHRQAALSKVETSMDCIH  147



>gb|KCW65982.1| hypothetical protein EUGRSUZ_G03277 [Eucalyptus grandis]
Length=171

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTNPPIKTYVGVTT+F RRLK+HNGEL GGAKASRAGRPW+CACL++GF DRS
Sbjct  79   WCVYLILSTNPPIKTYVGVTTDFRRRLKQHNGELSGGAKASRAGRPWVCACLVQGFKDRS  138

Query  273  E  271
            E
Sbjct  139  E  139



>emb|CBX25491.1| hypothetical_protein [Oryza glaberrima]
Length=201

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  88   WCVYLIASSWIP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  146

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +SRK+         +K  E     LL+HR  AL +  T
Sbjct  147  EACEFESKWKNISRKM--------ARKRSEPSMTSLLQHREMALSRLKT  187



>gb|KDO83286.1| hypothetical protein CISIN_1g0473621mg, partial [Citrus sinensis]
Length=102

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+STNPPIKTYVG TTNF RRLK+HNGEL+GGAKAS+AGRPWI AC+I+GF D+S
Sbjct  42   WSVYLIISTNPPIKTYVGTTTNFPRRLKQHNGELRGGAKASQAGRPWISACIIQGFHDQS  101

Query  273  E  271
            +
Sbjct  102  D  102



>ref|XP_002441709.1| hypothetical protein SORBIDRAFT_08g001060 [Sorghum bicolor]
 gb|EES15547.1| hypothetical protein SORBIDRAFT_08g001060 [Sorghum bicolor]
Length=163

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 9/106 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKA+ AGRPW  ACL+ GF +RS
Sbjct  50   WCVYLIASSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKAASAGRPWNLACLVEGFANRS  108

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ  136
            EAC FE++WK +SRK+         +K  E     +L+HR AAL +
Sbjct  109  EACEFESKWKNISRKM--------ARKRTEPSLKSVLQHREAALSR  146



>gb|EEE52756.1| hypothetical protein OsJ_35194 [Oryza sativa Japonica Group]
Length=164

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 10/114 (9%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+    +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  51   WCVYLIASSRIS-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  109

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            EAC FE++WK +SRK+         +K  E     LL+HR  AL + +N   C+
Sbjct  110  EACEFESKWKNISRKM--------ARKRSEPSMTSLLQHRDMALSRVKNDLACS  155



>gb|EEC68850.1| hypothetical protein OsI_37440 [Oryza sativa Indica Group]
Length=164

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 10/114 (9%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+    +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  51   WCVYLIASSRIS-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  109

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            EAC FE++WK +SRK+         +K  E     LL+HR  AL + +N   C+
Sbjct  110  EACEFESKWKNISRKM--------ARKRSEPSMTSLLQHRDMALSRVKNDLACS  155



>gb|KEH17664.1| structure-specific endonuclease subunit SLX1-like protein [Medicago 
truncatula]
Length=157

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILSTN PIKTYVGVTTNF RRLKEHNG+LKGGAKASRAGRPWICAC++ GF +RS
Sbjct  42   WCVYLILSTNHPIKTYVGVTTNFPRRLKEHNGDLKGGAKASRAGRPWICACIVCGFTNRS  101

Query  273  EACAF  259
            E  A 
Sbjct  102  EVEAI  106



>ref|XP_003577888.1| PREDICTED: structure-specific endonuclease subunit slx1 [Brachypodium 
distachyon]
Length=180

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 76/109 (70%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACL+ GF +RS
Sbjct  67   WCVYLIASSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLVEGFTNRS  125

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +S+K+         +K  +     +L+HR AAL +  T
Sbjct  126  EACEFESKWKNISKKM--------TRKSSKPGMSSVLQHREAALGKVKT  166



>dbj|BAJ98541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACL+ GF +RS
Sbjct  72   WCVYLIASSRVP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLVEGFTNRS  130

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +S+K+         +K  E     +L+HR  AL +  T
Sbjct  131  EACEFESKWKNISKKM--------TRKRSEPGLNAVLQHREVALSRVKT  171



>gb|AFW55817.1| holiday junction resolvase, S1x1p, URI domain nuclease [Zea mays]
Length=162

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+    +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACL+ GF +RS
Sbjct  49   WCVYLIASSRI-RRTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLVEGFANRS  107

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +SRK+         +K  E     +L+HR AAL +  T
Sbjct  108  EACEFESKWKIVSRKI--------ARKRTELSMKSVLQHREAALSRVET  148



>ref|NP_001150522.1| holiday junction resolvase, S1x1p, URI domain nuclease [Zea mays]
 gb|ACG39398.1| holiday junction resolvase, S1x1p, URI domain nuclease [Zea mays]
Length=162

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+    +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACL+ GF +RS
Sbjct  49   WCVYLIASSRI-RRTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLVEGFANRS  107

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENT  127
            EAC FE++WK +SRK+         +K  E     +L+HR AAL +  T
Sbjct  108  EACEFESKWKIVSRKI--------ARKRTELSMKSVLQHREAALSRVET  148



>ref|XP_010694707.1| PREDICTED: structure-specific endonuclease subunit slx1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=103

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = -3

Query  375  LKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRKLPCKGKGNEEQ  196
            LK+HNGELKGGAKASRAGRPWICACL++GF ++SEAC FE++WK +SRKLP K K  +++
Sbjct  6    LKQHNGELKGGAKASRAGRPWICACLVQGFRNQSEACEFESKWKNISRKLPRKQKSVDKK  65

Query  195  KLEETKSVLLLKHRYAALDQ  136
             L++    LLL+HR+AA+++
Sbjct  66   GLDDN-GRLLLQHRHAAMEK  84



>ref|XP_004170728.1| PREDICTED: structure-specific endonuclease subunit slx1-like, 
partial [Cucumis sativus]
Length=106

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VYLI+S+N PIKTYVGVT +F RRLK+HNGE+KGGAKA+RAGRPWICAC I GF D+
Sbjct  45   QWCVYLIISSNSPIKTYVGVTLDFDRRLKQHNGEIKGGAKATRAGRPWICACTIHGFKDQ  104

Query  276  SE  271
            S+
Sbjct  105  SQ  106



>ref|XP_002527946.1| nuclease, putative [Ricinus communis]
 gb|EEF34435.1| nuclease, putative [Ricinus communis]
Length=150

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  375  LKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRKLPCKGKGNEEQ  196
            LK+HNGELKGGAKAS AGRPWICAC++ GF D+SEAC FE++WK +SRKLP KGK  +  
Sbjct  52   LKQHNGELKGGAKASCAGRPWICACIVHGFNDQSEACKFESKWKSVSRKLPRKGKTVDGT  111

Query  195  KLEETKSVLLLKHRYAAL  142
            K     S  LL+HR  AL
Sbjct  112  KESVDDSHALLQHRQKAL  129



>gb|KHG08842.1| slx1 [Gossypium arboreum]
Length=143

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = -3

Query  375  LKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRKLPCKGKGNEEQ  196
            LK+HNGEL GGAKASRAGRPW+CAC++RGF D+SEAC FE +WK  SRKLP K K  E  
Sbjct  49   LKQHNGELSGGAKASRAGRPWVCACVVRGFHDQSEACEFEFKWKMASRKLPRKKKNKEAD  108

Query  195  KLEETKSVLLLKHRYAALDQ  136
                  S+ LL+HR  AL++
Sbjct  109  DC----SLTLLQHRQTALNK  124



>ref|XP_008806564.1| PREDICTED: structure-specific endonuclease subunit slx1 isoform 
X2 [Phoenix dactylifera]
Length=121

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            WSVYLI+S+  P KTYVGVTTN  RRLK+HNGEL+GGAKAS +GRPW+ AC+I+GF D+S
Sbjct  56   WSVYLIVSSRLP-KTYVGVTTNIIRRLKQHNGELRGGAKASSSGRPWVLACIIQGFKDQS  114

Query  273  E  271
            E
Sbjct  115  E  115



>ref|NP_001176349.1| Os11g0146550 [Oryza sativa Japonica Group]
 dbj|BAH95077.1| Os11g0146550 [Oryza sativa Japonica Group]
Length=125

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+  P +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  52   WCVYLIASSRIP-RTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  110

Query  273  E  271
            E
Sbjct  111  E  111



>ref|NP_001066136.2| Os12g0143300 [Oryza sativa Japonica Group]
 dbj|BAF29155.2| Os12g0143300 [Oryza sativa Japonica Group]
Length=112

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLI S+    +TYVGVTT+F RRL++HNGELKGGAKAS AGRPW  ACLI GF++RS
Sbjct  51   WCVYLIASSRI-SRTYVGVTTDFPRRLRQHNGELKGGAKASSAGRPWNLACLIEGFVNRS  109

Query  273  E  271
            E
Sbjct  110  E  110



>ref|XP_010442058.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X2 [Camelina sativa]
Length=126

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = -3

Query  399  VTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRKLPC  220
             T   S RLK+HNGE++GGAKAS AGRPW+CAC+I  F    +A +F+++WK  SRKLP 
Sbjct  28   TTKRLSPRLKQHNGEIRGGAKASSAGRPWLCACIITAFTCLIQAASFKSKWKIFSRKLPR  87

Query  219  KGKGNEEQKLEETKSVLLLKHRYAALDQ-ENTCRCA  115
            + K       E ++S  LL HR  ALD+ E +  C+
Sbjct  88   RKKDE-----EMSQSDALLLHRRRALDKVEESLECS  118



>gb|EMT29300.1| hypothetical protein F775_13440 [Aegilops tauschii]
Length=143

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 8/83 (10%)
 Frame = -3

Query  375  LKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRKLPCKGKGNEEQ  196
            L++HNGELKGGAKAS AGRPW  ACL+ GF +RSEAC FE++WK +S+K+         +
Sbjct  55   LRQHNGELKGGAKASSAGRPWNLACLVEGFTNRSEACEFESKWKNISKKM--------TR  106

Query  195  KLEETKSVLLLKHRYAALDQENT  127
            K  E     +L+HR  AL +  T
Sbjct  107  KRSEPGLNSVLQHREVALSRVKT  129



>ref|XP_001778001.1| predicted protein [Physcomitrella patens]
 gb|EDQ57214.1| predicted protein [Physcomitrella patens]
Length=347

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYLILS N   +TY+G T N +RRL++HNGEL GGAK++R GRPW   C +RG   RS
Sbjct  203  WCVYLILS-NDKRRTYMGATANITRRLRQHNGELAGGAKSTRGGRPWSLVCTMRGLSSRS  261

Query  273  EACAFETRWKQLSRK  229
            EA   E R ++ S++
Sbjct  262  EAQQIEWRLRKFSKE  276



>gb|EJK67830.1| hypothetical protein THAOC_11076 [Thalassiosira oceanica]
Length=545

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = -3

Query  453  WSVYLILSTNP--PIKTYVGVTTNFSRRLKEHNGELKGGA--KASRAGRPWICACLIRGF  286
            +  YL+ S +P  P+KTY+G TTN  RRL++HNG+LK G   +  RAGRPW   C++ GF
Sbjct  186  YHCYLLRSLDPGHPLKTYIGFTTNPERRLRQHNGDLKNGGARRTKRAGRPWTFVCVVHGF  245

Query  285  MDRSEACAFETRWKQLSR  232
             D+  A  FE  W+ + +
Sbjct  246  QDKINALQFEWAWQNVHK  263



>gb|EJK48000.1| hypothetical protein THAOC_33238 [Thalassiosira oceanica]
Length=733

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -3

Query  456  RWSVYLILSTNP--PIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAGRPWICACLIRGF  286
            R   YL+ S NP  P+KTY+G TT+  RR+++HNGE+ GGA + ++AGRPW C  ++ GF
Sbjct  68   RHHCYLMRSINPSYPLKTYIGYTTDPLRRVRQHNGEIVGGARRTAKAGRPWECVAVVSGF  127

Query  285  MDRSEACAFETRWKQLSR  232
             D+  A  FE  W+   R
Sbjct  128  ADKVAAMQFEWAWQHTGR  145



>ref|XP_002287643.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95086.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=774

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = -3

Query  453  WSVYLILSTNP--PIKTYVGVTTNFSRRLKEHNGELKGGA--KASRAGRPWICACLIRGF  286
            +  YL+ S +P  P+KTY+G TT+ SRR+++HNG LK G   +  R+GRPW   C+I GF
Sbjct  378  YHTYLLRSLSPDHPLKTYIGFTTHPSRRIRQHNGILKNGGARRTKRSGRPWTFTCVIAGF  437

Query  285  MDRSEACAFETRWKQLSR  232
             D+  A  FE  W+ + R
Sbjct  438  QDKITALQFEWAWQNVGR  455



>gb|EPY49714.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
cryophilus OY26]
Length=263

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = -3

Query  408  YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQLSRK  229
            Y+G T N  RRL++HNGE++GGA  +R GRPWI  CL+ GF ++  A  FE  W+  +  
Sbjct  26   YIGSTPNPIRRLRQHNGEIQGGAWKTRNGRPWIVLCLVHGFPNKISALQFEWIWQHPNIS  85

Query  228  LPCKGKGNEEQKLEETKSVLLLKHRYAALDQENTC  124
               K K   E K+ +T S   L +   AL Q  +C
Sbjct  86   RHTKDK---EAKINKTPS---LSNSLVALQQIVSC  114



>gb|EPX74925.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
octosporus yFS286]
Length=263

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -3

Query  444  YLILS--TNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YLI S  T      Y+G T N  RRL++HNGEL+GGA  +R GRPWI  CL+ GF +++ 
Sbjct  12   YLIQSKKTASSRSLYIGSTPNPIRRLRQHNGELQGGAWKTRNGRPWIVLCLVHGFPNKTS  71

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEE  199
            A  FE  W+   LSR      K N+E
Sbjct  72   ALQFEWIWQHPNLSR----HTKDNQE  93



>gb|KFK23759.1| hypothetical protein AALP_AAs62422U000100 [Arabis alpina]
Length=60

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  420  PIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPW  313
            P KTYVG+TT+F+RRLK+HNGE++GGAKAS AGR +
Sbjct  13   PFKTYVGITTDFTRRLKQHNGEIRGGAKASSAGRSF  48



>gb|KIG14069.1| Endo/excinuclease amino terminal domain protein [Enhygromyxa 
salina]
Length=89

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            RW +YL+ S     +TYVG+TT   RRL +HNGE  GGAK++RAGRPW       G   R
Sbjct  6    RWWLYLLRSAG--GRTYVGITTELERRLAQHNGEQDGGAKSTRAGRPWTLDRSW-GPYSR  62

Query  276  SEACAFETRWKQLSRK  229
            S+A A E    QL R+
Sbjct  63   SQASAHEY---QLKRR  75



>ref|XP_003692278.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
isoform 2 [Apis florea]
Length=149

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGF  286
            + VYL+ S NP  K   Y+G T +  RRLKEHN   E KG  K S  G PW    +I GF
Sbjct  11   YGVYLLYSMNPQFKGRIYIGFTVDPCRRLKEHNAGKEHKGARKTSDKG-PWNMVLIIHGF  69

Query  285  MDRSEACAFETRWK--QLSRKLPCKGKGNEEQKLEETKSV  172
            ++++ A +FE  W+    SR+L      N ++KL++ + +
Sbjct  70   LNKTSALSFEWAWQHPHKSRRLKHVYVSNAKKKLQQKRKI  109



>ref|WP_020881224.1| Excinuclease ABC C subunit domain protein [Desulfovibrio sp. 
X2]
 gb|EPR39846.1| Excinuclease ABC C subunit domain protein [Desulfovibrio sp. 
X2]
Length=104

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYL+   +  +  Y GVTT+ SRRL EHNGEL GGA+ +R+ RP   A   R   DR+
Sbjct  11   WFVYLVRCADGTL--YCGVTTDLSRRLAEHNGELPGGARYTRSRRPVSLAAAAR-VGDRA  67

Query  273  EACAFETRWKQLSRK  229
            EAC  E R K L ++
Sbjct  68   EACRLERRIKLLRKE  82



>ref|XP_005790036.1| hypothetical protein EMIHUDRAFT_225154 [Emiliania huxleyi CCMP1516]
 gb|EOD37607.1| hypothetical protein EMIHUDRAFT_225154 [Emiliania huxleyi CCMP1516]
Length=151

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRW----  247
            +TYVG + +  RRL++HNGEL GG  A  AGRPW    ++RGF  +S+A AFE  W    
Sbjct  30   RTYVGASPDPVRRLRQHNGELSGGG-APAAGRPWRILLVVRGFSSKSDALAFEWAWQKPH  88

Query  246  --KQLSRKLPCKGKG  208
              + ++R+   KG G
Sbjct  89   TSRHIARQWGVKGFG  103



>ref|XP_002142784.1| GIY-YIG catalytic domain-containing protein [Cryptosporidium 
muris RN66]
 gb|EEA08435.1| GIY-YIG catalytic domain-containing protein [Cryptosporidium 
muris RN66]
Length=386

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL+LS +    +Y+G T N  RRL++HNGE+K GAK +++G PW  A  I GF +R  A 
Sbjct  17   YLLLSESKKKASYIGYTVNPVRRLRQHNGEIKKGAKKTKSGIPWYMAICIDGFPNRIAAL  76

Query  264  AFETRWKQ  241
             FE  W+ 
Sbjct  77   RFEWVWQH  84



>ref|XP_005763140.1| hypothetical protein EMIHUDRAFT_215514 [Emiliania huxleyi CCMP1516]
 gb|EOD10711.1| hypothetical protein EMIHUDRAFT_215514 [Emiliania huxleyi CCMP1516]
Length=231

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRW----  247
            +TYVG + +  RRL++HNGEL GG  A  AGRPW    ++RGF  +S+A AFE  W    
Sbjct  100  RTYVGASPDPVRRLRQHNGELSGGG-APAAGRPWRILLVVRGFSSKSDALAFEWAWQKPH  158

Query  246  --KQLSRKLPCKGKG  208
              + ++R+   KG G
Sbjct  159  TSRHIARQWGVKGFG  173



>gb|KDQ56849.1| hypothetical protein JAAARDRAFT_59073 [Jaapia argillacea MUCL 
33604]
Length=798

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLILS--TNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +S YL+ S  T+    TY+G T N  RR+++HNGE+  GA  ++ GRPW+   L+ GF  
Sbjct  19   YSCYLLKSIRTSRSTATYIGSTPNPPRRVRQHNGEITQGASKTKTGRPWVMQMLVHGFPS  78

Query  279  RSEACAFETRWK--QLSRKL  226
            R  A  FE  W+   +SR L
Sbjct  79   RLSALQFEWAWQHPHISRHL  98



>ref|XP_006624425.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Apis dorsata]
Length=260

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGF  286
            + VYL+ S NP  K   YVG T +  RRLKEHN   E KG  K S  G PW    +I GF
Sbjct  11   YGVYLLYSMNPQFKGRIYVGFTVDPCRRLKEHNAGKEHKGARKTSDKG-PWNMVLIIHGF  69

Query  285  MDRSEACAFETRWKQL--SRKLPCKGKGNEEQKLEETKSV  172
            ++++ A +FE  W+    SR+L      N ++KL++ + +
Sbjct  70   LNKTSALSFEWAWQHPHKSRRLKHIYISNAKKKLQQKRKI  109



>ref|XP_003723181.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14723.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=701

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query  447  VYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDR  277
            VYL+ S +P  +   Y+G T N  RRL++HNGEL  GA+  SR GRPW   C + GF D 
Sbjct  8    VYLLTSLDPQCEGDFYIGYTVNPLRRLRQHNGELVNGARRTSRRGRPWTIVCCVSGFTDD  67

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  68   RAALKFEWCWQH  79



>ref|XP_003692277.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
isoform 1 [Apis florea]
Length=260

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGF  286
            + VYL+ S NP  K   Y+G T +  RRLKEHN   E KG  K S  G PW    +I GF
Sbjct  11   YGVYLLYSMNPQFKGRIYIGFTVDPCRRLKEHNAGKEHKGARKTSDKG-PWNMVLIIHGF  69

Query  285  MDRSEACAFETRWKQL--SRKLPCKGKGNEEQKLEETKSV  172
            ++++ A +FE  W+    SR+L      N ++KL++ + +
Sbjct  70   LNKTSALSFEWAWQHPHKSRRLKHVYVSNAKKKLQQKRKI  109



>ref|WP_009575055.1| excinuclease ABC subunit C [gamma proteobacterium IMCC3088]
 gb|EGG30301.1| endo/excinuclease amino terminal domain protein [gamma proteobacterium 
IMCC3088]
Length=93

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VY++   +  +  Y GVTT+  RRL++HNGE+ GGA+ +R  RP +     +G   RS
Sbjct  6    WIVYILNCADGTL--YTGVTTDAERRLRQHNGEIVGGARYTRVRRP-VAIVWQQGCDSRS  62

Query  273  EACAFETRWKQLSR  232
            +AC +E++ K LSR
Sbjct  63   QACQYESQIKALSR  76



>ref|XP_010699706.1| structure-specific endonuclease, putative [Leishmania panamensis]
 gb|AIN98999.1| structure-specific endonuclease, putative [Leishmania panamensis]
Length=701

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query  447  VYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDR  277
            VYL+ S +P  +   Y+G T N  RRL++HNGEL  GA+  SR GRPW   C + GF D 
Sbjct  8    VYLLTSLDPQCEGDFYIGYTVNPLRRLRQHNGELVNGARRTSRRGRPWTIVCCVSGFTDD  67

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  68   RAALKFEWCWQH  79



>ref|NP_593420.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
pombe 972h-]
 sp|Q9P7M3.1|SLX1_SCHPO RecName: Full=Structure-specific endonuclease subunit slx1 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB76036.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
pombe]
Length=271

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  411  TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQL  238
             Y+G T +  RRL++HNGE+ GGA  ++ GRPW  +CL+ GF ++  A  FE  W+ L
Sbjct  23   VYIGSTPDPPRRLRQHNGEIVGGASKTKHGRPWSISCLVYGFPNKVSALKFEWNWQNL  80



>ref|XP_005535276.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM78990.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=331

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = -3

Query  456  RWSVYLILSTNPPIK----TYVGVTTNFSRRLKEHNGELKG-GAKASRAGRPWICACLIR  292
            R+  YL++S +   +    TY+G TT+ SRRL++HNGELKG GA  +RA RPW     + 
Sbjct  46   RYCCYLLVSESTDKRARNRTYIGFTTDPSRRLRQHNGELKGAGAHRTRAFRPWRLLIFVE  105

Query  291  GFMDRSEACAFETRWKQ  241
            GF  + +A  FE +W+ 
Sbjct  106  GFRSQVQALQFEWQWQH  122



>emb|CBN80129.1| endo/excinuclease amino terminal domain-containing protein [Ectocarpus 
siliculosus]
Length=350

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  TY+G T +  RR+++HNG++ GGA  ++  RPW    ++ GF  +S 
Sbjct  14   YLLQSQDPKHKRSTYIGFTVDPGRRIRQHNGDIIGGAFRTKRKRPWDMVAIVHGFPSKSS  73

Query  270  ACAFETRWKQLSR  232
            A  FE  W+   R
Sbjct  74   ALQFEAAWQHPQR  86



>ref|XP_006678112.1| hypothetical protein BATDEDRAFT_87437 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81182.1| hypothetical protein BATDEDRAFT_87437 [Batrachochytrium dendrobatidis 
JAM81]
Length=447

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  453  WSVYLILSTNPP--IKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +S YL+ S  P   I  Y+G T + SRRL++HNG +KGGA+ +   RPW    ++ GF  
Sbjct  8    YSCYLLRSCQPGRRIPAYIGSTLDPSRRLRQHNGLIKGGAQQTIKWRPWEMVAIVYGFPS  67

Query  279  RSEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAAL  142
               A  FE  W+      P K +  ++ +  ET+S +++K +   L
Sbjct  68   DVTALQFEWAWQN-----PHKSRHFKKDQFSETRSNMVVKGKLKVL  108



>ref|XP_006572323.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
isoform X1 [Apis mellifera]
Length=259

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGF  286
            + VYL+ S NP  K   YVG T +  RRLKEHN   E KG  K S  G PW    +I GF
Sbjct  11   YGVYLLYSMNPQFKGRIYVGFTVDPCRRLKEHNAGKEHKGARKTSDKG-PWNMVLIIHGF  69

Query  285  MDRSEACAFETRWKQL--SRKLPCKGKGNEEQKLEETKSV  172
            ++++ A  FE  W+    SR+L      N ++KL++ + +
Sbjct  70   LNKTSALRFEWAWQHPHKSRRLKHIYVSNAKKKLQQKRKI  109



>ref|WP_029898546.1| hypothetical protein [Desulfovibrio sp. L21-Syr-AB]
Length=85

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYL+   +  +  Y GVTT+  RRL EHNGEL GGA+ +R+ RP   A       DRS
Sbjct  3    WFVYLLECADSTL--YCGVTTDLDRRLAEHNGELPGGARYTRSRRPVRLAAWAE-RADRS  59

Query  273  EACAFETRWKQ  241
             ACA E R K+
Sbjct  60   SACALEARVKR  70



>ref|XP_001880448.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR09135.1| predicted protein [Laccaria bicolor S238N-H82]
Length=611

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S   P+   TY+G T +  RR+++HNGEL  GA+ +R  RPW+   ++ GF  
Sbjct  13   YACYLLKSIQSPLSKATYIGSTPSPPRRIRQHNGELTQGARKTRHKRPWVMQMIVHGFPS  72

Query  279  RSEACAFETRWK--QLSRKL  226
            R  A  FE  W+   +SR L
Sbjct  73   RLAALQFEWAWQHPHVSRHL  92



>ref|XP_003861467.1| hypothetical protein, conserved [Leishmania donovani]
 emb|CBZ34767.1| hypothetical protein, conserved [Leishmania donovani]
Length=705

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query  447  VYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDR  277
            VYL+ S +P  +   Y+G T N  RRL++HNGEL  GA+  SR GRPW   C + GF D 
Sbjct  8    VYLLTSLDPQCEGDFYIGYTVNPLRRLRQHNGELVNGARRTSRRGRPWTIVCCVSGFPDD  67

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  68   RAALKFEWCWQH  79



>ref|XP_665907.1| hypothetical protein [Cryptosporidium hominis TU502]
Length=233

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            Y +LS      +Y+G + N  RRL++HNGE+K GAK +++G PW     + GF DR  A 
Sbjct  11   YFLLSEAKKKASYIGYSVNPCRRLRQHNGEIKKGAKKTKSGVPWNLGICVGGFPDRVAAL  70

Query  264  AFETRWKQ  241
             FE  W+ 
Sbjct  71   RFEWAWQH  78



>gb|EJU03443.1| hypothetical protein DACRYDRAFT_49905, partial [Dacryopinax sp. 
DJM-731 SS1]
Length=101

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S + P    TY+G T N  RR+++HNGEL  GA  +R  RPW+   ++ GF  
Sbjct  19   YACYLLKSLSSPRSRTTYIGSTPNPLRRIRQHNGELTQGAWKTRQHRPWVMVMIVYGFPS  78

Query  279  RSEACAFETRWK--QLSRKL  226
            +  A  FE  W+  ++SR +
Sbjct  79   KLHALQFEWAWQHPEVSRHM  98



>ref|XP_003060854.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH54504.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=147

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S NP +K  +YVG T N  RR+++HNG L  GAK +R  RP     ++ GF+   +
Sbjct  5    YLLASLNPAMKGRSYVGFTVNPPRRIRQHNGALSAGAKKTRKLRPCEMLVVVHGFLSDVQ  64

Query  270  ACAFETRWKQ  241
            A  FE  W+ 
Sbjct  65   ALQFEWAWQN  74



>ref|XP_001466168.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 sp|A4I1H7.1|SLX1_LEIIN RecName: Full=Structure-specific endonuclease subunit SLX1 homolog 
[Leishmania infantum]
 emb|CAM68607.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=705

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query  447  VYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDR  277
            VYL+ S +P  +   Y+G T N  RRL++HNGEL  GA+  SR GRPW   C + GF D 
Sbjct  8    VYLLTSLDPQCEGDFYIGYTVNPLRRLRQHNGELVNGARRTSRRGRPWTIVCCVSGFPDD  67

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  68   RAALKFEWCWQH  79



>ref|WP_006977032.1| Excinuclease ABC, C subunit-like protein, partial [Plesiocystis 
pacifica]
 gb|EDM73817.1| Excinuclease ABC, C subunit-like protein [Plesiocystis pacifica 
SIR-1]
Length=95

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICA  304
            W +YL+ S +   ++YVG+T +  RRL +HNGEL GGAK++R GRPW  A
Sbjct  20   WWLYLLRSAS--GRSYVGITVDLERRLAQHNGELPGGAKSTRGGRPWAFA  67



>ref|XP_005708442.1| endo/excinuclease amino terminal domain-containing protein [Galdieria 
sulphuraria]
 gb|EME31922.1| endo/excinuclease amino terminal domain-containing protein [Galdieria 
sulphuraria]
Length=384

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELK-GGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQL  238
            +TY+G TTN +RRL++HNG+LK GGA  ++  RPW     I GF  ++EA  FE  W+  
Sbjct  88   RTYIGFTTNPARRLRQHNGDLKAGGALRTKCFRPWQMVLFIHGFETKTEALQFEWAWQHP  147

Query  237  SRKLPCKGKGNE  202
            ++    K   N+
Sbjct  148  TKTRALKPVNND  159



>ref|WP_033425376.1| hypothetical protein, partial [Rheinheimera perlucida]
Length=90

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 10/90 (11%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W +Y++ +    +  Y G++T+  RRL++HNGELKGGAKA R   P +    ++    R+
Sbjct  10   WFLYMVRTAAGQL--YTGISTDPQRRLRQHNGELKGGAKALRGKGP-LQLVFVQAMASRA  66

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEE  184
            EA   E + KQLS       K  +EQ++ E
Sbjct  67   EASKAEYQLKQLS-------KAAKEQRISE  89



>ref|XP_005770693.1| hypothetical protein EMIHUDRAFT_447996 [Emiliania huxleyi CCMP1516]
 gb|EOD18264.1| hypothetical protein EMIHUDRAFT_447996 [Emiliania huxleyi CCMP1516]
Length=396

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  +  TY+G T +  RRL++HNGE+KGGA+ +   RPW     + GF D   
Sbjct  31   YLLRSLSPSARGRTYIGFTVDPQRRLRQHNGEVKGGARKTSRQRPWEMLGFVHGFSDNVS  90

Query  270  ACAFETRWKQLSRKLPCK  217
            A  FE  W+  +  L  +
Sbjct  91   ALQFEWAWQHPTVSLAVR  108



>ref|WP_011370525.1| excinuclease ABC subunit C [Thiomicrospira crunogena]
 ref|YP_391372.1| excinuclease ABC subunit C [Thiomicrospira crunogena XCL-2]
 gb|ABB41698.1| hypothetical protein with a GIY-YIG catalytic domain [Thiomicrospira 
crunogena XCL-2]
Length=87

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIR-GFMDR  277
            W VYL+   +  +  Y GVT +  RRL++HNGE+KGGAK ++A RP  C  + + G  D+
Sbjct  6    WVVYLLKCGDNTL--YCGVTNDLDRRLRQHNGEIKGGAKYTQARRP--CELVYQEGCEDK  61

Query  276  SEACAFETRWKQLSR  232
            S A   E   KQLSR
Sbjct  62   SSAMKREYNLKQLSR  76



>ref|XP_005769695.1| hypothetical protein EMIHUDRAFT_458995 [Emiliania huxleyi CCMP1516]
 gb|EOD17266.1| hypothetical protein EMIHUDRAFT_458995 [Emiliania huxleyi CCMP1516]
Length=396

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  +  TY+G T +  RRL++HNGE+KGGA+ +   RPW     + GF D   
Sbjct  31   YLLRSLSPSARGRTYIGFTVDPQRRLRQHNGEVKGGARKTSRQRPWEMLGFVHGFSDNVS  90

Query  270  ACAFETRWKQLSRKLPCK  217
            A  FE  W+  +  L  +
Sbjct  91   ALQFEWAWQHPTVSLAVR  108



>ref|XP_002172727.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
japonicus yFS275]
 sp|B6JY16.1|SLX1_SCHJY RecName: Full=Structure-specific endonuclease subunit slx1 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB06434.1| structure-specific endonuclease catalytic subunit [Schizosaccharomyces 
japonicus yFS275]
Length=273

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKT-YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +  YL++S     ++ Y+G T + +RRL++HNGE+KGGA  ++  RPW  AC + GF  +
Sbjct  3    YCCYLLVSEKAASRSVYIGSTPDPARRLRQHNGEIKGGAYKTKRSRPWKVACFVHGFPTK  62

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  63   IAALQFEWVWQH  74



>ref|XP_002962079.1| hypothetical protein SELMODRAFT_66109, partial [Selaginella moellendorffii]
 gb|EFJ37339.1| hypothetical protein SELMODRAFT_66109, partial [Selaginella moellendorffii]
Length=182

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +  YL+ S NP  K  TY+G T N  RR+++HNGE+  GA  ++  RPW     + GF  
Sbjct  2    YGCYLLRSINPRFKGQTYIGFTVNPRRRIRQHNGEITCGAFRTKKKRPWEMVLCVYGFSS  61

Query  279  RSEACAFETRWKQ  241
            +++A  FE  W+ 
Sbjct  62   KTDALQFEWAWQH  74



>gb|EYE98502.1| structure-specific endonuclease subunit slx1 [Aspergillus ruber 
CBS 135680]
Length=389

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMD  280
            ++ YL+ ST      Y+G T + SRRL +HNG +KGGAK +  G  RPW    L+ GFM+
Sbjct  12   YACYLLRSTVRHASLYIGSTPDPSRRLTQHNGAVKGGAKRTARGNLRPWEMTILVEGFMN  71

Query  279  RSEACAFETRWKQ  241
            R  A  FE  W+ 
Sbjct  72   RIGALQFEWAWQH  84



>emb|CBY93775.1| putative slx1 protein [Rhizophagus diaphanus]
Length=197

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  +Y+G T +  RRL++HNGE+  GAK +   RPW     + GF +   
Sbjct  23   YLLRSLSPKYKQTSYIGSTNDPKRRLRQHNGEIASGAKKTSNKRPWEMILFVYGFPNHVA  82

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLL  166
            A  FE  W+   ++R+L  K +   ++  ++  + LL
Sbjct  83   ALQFEWSWQNPSITRRLQLKNREEFKENDDKLSTSLL  119



>gb|EUC61342.1| GIY-YIG-SLX1 domain protein [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP53349.1| GIY-YIG-SLX1 domain protein [Rhizoctonia solani 123E]
Length=306

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  411  TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQ  241
            TYVG T +  RRL++HNGEL  GA  +R GRPW+   ++ GF  +  A  FE  W+ 
Sbjct  53   TYVGSTPDPPRRLRQHNGELTQGAYKTRRGRPWVMTMIVHGFPSKLAALQFEWAWQH  109



>gb|EPS34535.1| hypothetical protein PDE_09499 [Penicillium oxalicum 114-2]
Length=402

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T N +RRL +HNG++KGGAK +     RPW  A ++ GFM R  
Sbjct  17   YLLRSTVRHASLYIGSTPNPTRRLPQHNGDIKGGAKRTSRDKLRPWEMALVVEGFMSRLG  76

Query  270  ACAFETRWKQL--SRKLPCKGKGNEEQ  196
            A  FE  W+    SR L  +G+  +E+
Sbjct  77   ALQFEWAWQHPDKSRHLLKEGQDLDEE  103



>ref|WP_006954776.1| excinuclease ABC subunit C [Idiomarina baltica]
 gb|EAQ31544.1| Predicted endonuclease containing a URI domain [Idiomarina baltica 
OS145]
Length=101

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            RW VY++   +  +  Y GVTT   RR+++HNGEL GGA+ +++ RP + +   +G   +
Sbjct  21   RWYVYMVECGDRSL--YTGVTTCLERRIRQHNGELSGGARYTQSRRPVVLS-WRQGPFSK  77

Query  276  SEACAFETRWKQLSR  232
            + AC  E + KQLSR
Sbjct  78   TRACQLEAQLKQLSR  92



>ref|XP_009528982.1| hypothetical protein PHYSODRAFT_509109 [Phytophthora sojae]
 gb|EGZ15233.1| hypothetical protein PHYSODRAFT_509109 [Phytophthora sojae]
Length=176

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 8/89 (9%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+     P +   TYVG T + +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQAPQRLRCTYVGFTVDPTRRIRQHNGELANGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQLSRKLPCKGKGNEEQ  196
             +  A  FE  W+      P   K   EQ
Sbjct  64   SKFRAMQFEWVWQH-----PLVSKITREQ  87



>emb|CCD78399.1| hypothetical protein Smp_106040 [Schistosoma mansoni]
Length=225

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = -3

Query  453  WSVYLILSTNPPI--KTYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  Y++LS NP    KTY+G T N  RR+++HN G LKGGAK++    PW    ++ GF 
Sbjct  22   YGCYILLSLNPKFRGKTYIGFTVNPKRRIRQHNAGCLKGGAKSTAGKGPWEMVLIVYGFS  81

Query  282  DRSEACAFETRWK--QLSRKL  226
            +   A  FE  W+   LSR+L
Sbjct  82   NAISALRFEWAWQNPNLSRRL  102



>gb|AAX25793.2| SJCHGC08377 protein [Schistosoma japonicum]
Length=134

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  Y++LS NP  +  TY+G T N  RR+++HN G LKGGAK++    PW    ++ GF 
Sbjct  22   YGCYILLSLNPNFRGRTYIGFTVNPKRRIRQHNAGFLKGGAKSTAGKGPWEMVLIVHGFP  81

Query  282  DRSEACAFETRW------KQLSRKLPCK  217
            +   A  FE  W      ++L   LP K
Sbjct  82   NAISALRFEWAWQNPKSSRRLKDSLPVK  109



>gb|EPS59593.1| hypothetical protein M569_15212, partial [Genlisea aurea]
Length=164

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 67/144 (47%), Gaps = 3/144 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S +P  K  TY+G T N  RRL++HNGE+  GA  ++  RPW     I GF  
Sbjct  13   YACYLLASLSPRFKGHTYIGFTVNPRRRLRQHNGEIASGACRTKKRRPWEMVLCIYGFPT  72

Query  279  RSEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAALDQENTCRCALH*IP  100
               A  FE  W+     L  +   +  + L    + + L     +L   N+    ++   
Sbjct  73   NVSALQFEWAWQHPLESLAVRASASTFKSLSGLANKIKLAFSMLSLPPWNSLNIRVNVFS  132

Query  99   TFQEYIYVCCTFS*TIEVSILQYT  28
            T +  I+ CC  S   ++S+  ++
Sbjct  133  T-KYQIHTCCCPSLPHQMSLQMHS  155



>ref|XP_005845200.1| hypothetical protein CHLNCDRAFT_26241, partial [Chlorella variabilis]
 gb|EFN53098.1| hypothetical protein CHLNCDRAFT_26241 [Chlorella variabilis]
Length=208

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S NP  K  +YVG T N  RR+++HNGEL  GA  ++  RPW    ++ GF  + +
Sbjct  8    YLLESKNPRAKGRSYVGFTVNPRRRIRQHNGELVNGAAKTKRHRPWEMVLVVFGFPSQVQ  67

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLK  160
            A  FE  W+   + +  +G      + +    +LL++
Sbjct  68   ALQFEWAWQHPEKSIEVRGIAARLGRQKRYGVLLLME  104



>ref|XP_626607.1| holiday junction resolvase, S1x1p, URI domain nuclease [Cryptosporidium 
parvum Iowa II]
 sp|Q5CT62.1|SLX1_CRYPI RecName: Full=Structure-specific endonuclease subunit SLX1 homolog 
[Cryptosporidium parvum Iowa II]
 gb|EAK88615.1| holiday junction resolvase, S1x1p, URI domain nuclease [Cryptosporidium 
parvum Iowa II]
Length=410

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            Y +LS      +Y+G + N  RRL++HNGE+K GAK +++G PW     + GF DR  A 
Sbjct  11   YFLLSEAKKKASYIGYSVNPCRRLRQHNGEIKKGAKKTKSGVPWNLGICVGGFPDRVAAL  70

Query  264  AFETRWKQ  241
             FE  W+ 
Sbjct  71   RFEWAWQH  78



>ref|XP_002895726.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY55096.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=178

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T + +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPEQPPQRLRCSYIGFTVSPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>gb|EPY19434.1| structure-specific endonuclease subunit SLX1 [Angomonas deanei]
Length=291

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -3

Query  447  VYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDR  277
            VYL+ S +P  +   Y+G T +  RRL++HNGEL  GAK   R GRPW   C + GF + 
Sbjct  8    VYLLTSLDPQCEGDFYIGYTVDPLRRLRQHNGELVNGAKRTHRHGRPWCIVCCVSGFAED  67

Query  276  SEACAFETRWKQ  241
              A  FE  W+ 
Sbjct  68   RTALKFEWTWQH  79



>gb|KDQ09537.1| hypothetical protein BOTBODRAFT_524952 [Botryobasidium botryosum 
FD-172 SS1]
Length=560

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLILSTNPP--IKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S   P    TYVG T N  RR+++HNGE+  GA  ++ G+PWI   ++ GF  
Sbjct  21   YACYLLKSIRTPRASATYVGSTPNPPRRIRQHNGEISQGAWKTKHGQPWIMTMIVHGFPS  80

Query  279  RSEACAFETRWK--QLSRKL  226
            +  A  FE  W+  Q+SR +
Sbjct  81   KLAALQFEWAWQHPQISRHM  100



>ref|XP_004339959.1| GIYYIG catalytic domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17943.1| GIYYIG catalytic domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=297

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S N   +  TY+G T N SRR+++HNGEL  GAK +R  RPW    ++ GF  ++ 
Sbjct  31   YLLTSRNEAYRRHTYIGFTVNPSRRIRQHNGELVQGAKRTRTKRPWEMVMVVYGFPSKTA  90

Query  270  ACAFETRW--KQLSRKL  226
            A  FE  W   Q SR++
Sbjct  91   ALRFEWGWTYPQKSRRI  107



>ref|XP_001692487.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03965.1| predicted protein [Chlamydomonas reinhardtii]
Length=332

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  TY+G T N  RR+++HNG +K GA  +  GRPW    ++ GF  + +
Sbjct  8    YLLASQSPKHKGRTYIGFTVNPRRRIRQHNGLIKNGAWKTHKGRPWEMTLVLYGFPTKIQ  67

Query  270  ACAFETRWKQLSRKLPCK--GKGNEEQKLEETKSVLLL  163
            A  FE  W+   R L  +   +    Q+++  +  +LL
Sbjct  68   ALQFEWAWQHPERSLIVRPIAQALGRQRMQGVRGKILL  105



>gb|KDR75326.1| hypothetical protein GALMADRAFT_545850 [Galerina marginata CBS 
339.88]
Length=835

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S   P  T  Y+G T +  RR+++HNGEL  GA+ +R+ RPW+   ++ GF  
Sbjct  22   YACYLLKSIQTPQSTAIYIGSTPSPPRRIRQHNGELTQGARRTRSKRPWVMQMIVHGFPS  81

Query  279  RSEACAFETRWKQ  241
            R  A  FE  W+ 
Sbjct  82   RLAALQFEWAWQH  94



>gb|EAS31361.2| GIY-YIG catalytic domain-containing protein [Coccidioides immitis 
RS]
Length=383

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T N +RRL +HNG +KGGAK +     RPW    L+ GFM 
Sbjct  29   YCAYLLRSTVRHASLYIGSTPNPARRLAQHNGLIKGGAKRTHKDSLRPWEMVMLVSGFMS  88

Query  279  RSEACAFETRWKQ  241
            R+ A  FE  W+ 
Sbjct  89   RTAALQFEWAWQH  101



>gb|KFB42360.1| AGAP002259-PA-like protein [Anopheles sinensis]
Length=360

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = -3

Query  453  WSVYLILS--TNPPI--KTYVGVTTNFSRRLKEHNG-ELKGGAKASRAGRPWICACLIRG  289
            + VYL++S  TNP    +TYVG T + +RR+K+HNG +  GGAK +    PWI   +I G
Sbjct  11   YGVYLLVSKSTNPKFAGRTYVGYTVDPNRRIKQHNGGQDAGGAKRTSNRGPWIMVMIIHG  70

Query  288  FMDRSEACAFETRWKQ--LSRKL  226
            F +   A  FE  W+Q  +SR+L
Sbjct  71   FPNNISALRFEWAWQQPRVSRRL  93



>gb|EGE82095.1| GIY-YIG catalytic domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
Length=426

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK-ASRAG-RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T + SRRL +HNG+  GGAK  SR   RPW    ++ GFM+
Sbjct  16   YCCYLLRSTVRHASLYIGSTPDPSRRLAQHNGDKTGGAKRTSREKLRPWEMVVIVSGFMN  75

Query  279  RSEACAFETRWK--QLSRKLPCKGKGNEEQKL  190
            R  A  FE  W+  Q SR +  +  GNEE  L
Sbjct  76   RVGALQFEWAWQHTQGSRHVEVERGGNEEPGL  107



>ref|XP_004183089.1| hypothetical protein EIN_469570 [Entamoeba invadens IP1]
 gb|ELP83743.1| hypothetical protein EIN_469570 [Entamoeba invadens IP1]
Length=319

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 7/84 (8%)
 Frame = -3

Query  456  RWSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ VYL+ S NP  K  TY+G TT+  RR+K+HNG + GGA  + + RPW    ++  F 
Sbjct  9    KFCVYLLTSINPGFKYHTYIGKTTSPPRRIKQHNGIIAGGAFKTESKRPWEMVVVVHSFP  68

Query  282  DRSEACAFETRWKQLSRKLPCKGK  211
             +++   FE  W+      P KGK
Sbjct  69   TQAKVLQFEWDWQH-----PEKGK  87



>ref|XP_002628459.1| GIY-YIG catalytic domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ73137.1| GIY-YIG catalytic domain-containing protein [Blastomyces dermatitidis 
SLH14081]
Length=426

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK-ASRAG-RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T + SRRL +HNG+  GGAK  SR   RPW    ++ GFM+
Sbjct  16   YCCYLLRSTVRHASLYIGSTPDPSRRLAQHNGDKTGGAKRTSREKLRPWEMVVIVSGFMN  75

Query  279  RSEACAFETRWK--QLSRKLPCKGKGNEEQKL  190
            R  A  FE  W+  Q SR +  +  GNEE  L
Sbjct  76   RVGALQFEWAWQHTQGSRHVEVERGGNEEPGL  107



>gb|EQL33419.1| structure-specific endonuclease subunit SLX1 [Blastomyces dermatitidis 
ATCC 26199]
Length=426

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK-ASRAG-RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T + SRRL +HNG+  GGAK  SR   RPW    ++ GFM+
Sbjct  16   YCCYLLRSTVRHASLYIGSTPDPSRRLAQHNGDKTGGAKRTSREKLRPWEMVVIVSGFMN  75

Query  279  RSEACAFETRWK--QLSRKLPCKGKGNEEQKL  190
            R  A  FE  W+  Q SR +  +  GNEE  L
Sbjct  76   RVGALQFEWAWQHTQGSRHVEVERGGNEEPGL  107



>gb|EEQ89270.1| GIY-YIG catalytic domain-containing protein [Blastomyces dermatitidis 
ER-3]
Length=426

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK-ASRAG-RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T + SRRL +HNG+  GGAK  SR   RPW    ++ GFM+
Sbjct  16   YCCYLLRSTVRHASLYIGSTPDPSRRLAQHNGDKTGGAKRTSREKLRPWEMVVIVSGFMN  75

Query  279  RSEACAFETRWK--QLSRKLPCKGKGNEEQKL  190
            R  A  FE  W+  Q SR +  +  GNEE  L
Sbjct  76   RVGALQFEWAWQHTQGSRHVEVERGGNEEPGL  107



>dbj|BAB02177.1| unnamed protein product [Arabidopsis thaliana]
Length=34

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  393  TNFSRRLKEHNGELKGGAKASRAGRPWICACLI  295
            ++F+RRLK+H GE++GGAKAS  GRPW+CAC++
Sbjct  2    SDFARRLKQHYGEIRGGAKASSTGRPWLCACIL  34



>ref|XP_008860164.1| GIY-YIG catalytic domain containing protein [Entamoeba nuttalli 
P19]
 gb|EKE37506.1| GIY-YIG catalytic domain containing protein [Entamoeba nuttalli 
P19]
Length=308

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -3

Query  456  RWSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ VYL+ S NP  K  TY+G TT   RR+K+HNG + GGA  + A RPW    ++  F 
Sbjct  9    KFCVYLLTSINPGFKYHTYIGKTTCPPRRIKQHNGIISGGAFKTEAKRPWEMVIVVHSFP  68

Query  282  DRSEACAFETRWKQ  241
             +++   FE  W+ 
Sbjct  69   TQTKVLQFEWDWQH  82



>ref|XP_652913.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL47526.1| hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS]
 gb|EMD44948.1| structure-specific endonuclease SLX1, putative [Entamoeba histolytica 
KU27]
 gb|EMH74151.1| hypothetical protein EHI8A_122060 [Entamoeba histolytica HM-1:IMSS-B]
 gb|EMS12681.1| structure-specific endonuclease SLX1, putative [Entamoeba histolytica 
HM-3:IMSS]
 gb|ENY66007.1| structure-specific endonuclease SLX1, putative [Entamoeba histolytica 
HM-1:IMSS-A]
Length=308

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -3

Query  456  RWSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ VYL+ S NP  K  TY+G TT   RR+K+HNG + GGA  + A RPW    ++  F 
Sbjct  9    KFCVYLLTSINPGFKYHTYIGKTTCPPRRIKQHNGIISGGAFKTEAKRPWEMVIVVHSFP  68

Query  282  DRSEACAFETRWKQ  241
             +++   FE  W+ 
Sbjct  69   TQTKVLQFEWDWQH  82



>ref|XP_001734615.1| structure-specific endonuclease SLX1 [Entamoeba dispar SAW760]
 gb|EDR29249.1| structure-specific endonuclease SLX1, putative [Entamoeba dispar 
SAW760]
Length=308

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -3

Query  456  RWSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ VYL+ S NP  K  TY+G TT   RR+K+HNG + GGA  + A RPW    ++  F 
Sbjct  9    KFCVYLLTSINPGFKYHTYIGKTTCPPRRIKQHNGIISGGAFKTEAKRPWEMVIVVHSFP  68

Query  282  DRSEACAFETRWKQ  241
             +++   FE  W+ 
Sbjct  69   TQTKVLQFEWDWQH  82



>gb|KGB75671.1| structure-specific endonuclease subunit SLX1 [Cryptococcus gattii 
R265]
Length=458

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWK--Q  241
            +TYVG T +  RRL++HNGELK GA ++   RPW    ++ GF  +  A  FE  W+  +
Sbjct  43   RTYVGSTPDPPRRLRQHNGELKQGAWSTSRHRPWEMQMIVYGFPSKLSALQFEWAWQKPE  102

Query  240  LSRKLPCKGKGNEEQKL  190
            LSR L  +G+  E  ++
Sbjct  103  LSRHLKIRGEDEEYHRI  119



>gb|ETM03396.1| hypothetical protein L917_00378 [Phytophthora parasitica]
Length=253

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>ref|XP_003849881.1| hypothetical protein MYCGRDRAFT_87006 [Zymoseptoria tritici IPO323]
 gb|EGP84857.1| hypothetical protein MYCGRDRAFT_87006 [Zymoseptoria tritici IPO323]
Length=406

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            ++ YL+ S      TY+G T N  RRLK+HNGE KGGA + SR   RPW   CL+ GF  
Sbjct  12   YACYLLRSIARHSSTYIGSTPNPPRRLKQHNGEAKGGAVRTSRDTLRPWEMTCLVTGFPS  71

Query  279  RSEACAFETRWK  244
            +  A  FE  W+
Sbjct  72   KIAALQFEWAWQ  83



>gb|ESA23594.1| hypothetical protein GLOINDRAFT_90863 [Rhizophagus irregularis 
DAOM 181602]
Length=225

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  +Y+G T +  RRL++HNGE+  GAK +   RPW     + GF +   
Sbjct  23   YLLRSLSPKYKQTSYIGSTNDPKRRLRQHNGEIASGAKKTSNKRPWEMILFVYGFPNHVA  82

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLL  166
            A  FE  W+   ++R+L  K +   ++  ++  + LL
Sbjct  83   ALQFEWSWQNPSITRRLQLKNREEFKENDDKLSTSLL  119



>gb|EKG18784.1| Excinuclease ABC C subunit [Macrophomina phaseolina MS6]
Length=433

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGG-AKASRAG-RPWICACLIRGFMDRSE  271
            YL+ ST      YVG T N  RRLK+HNG+ KGG A+ SR   +PW  AC++ GF  +  
Sbjct  12   YLLRSTVRHRYLYVGSTPNPVRRLKQHNGQAKGGAARTSRVSLQPWEMACIVTGFPSKIA  71

Query  270  ACAFETRWK--QLSRKLPCKG  214
            A  FE  W+   L+R +P + 
Sbjct  72   ALQFEWAWQNTHLTRHIPAED  92



>ref|YP_003986802.1| uncharacterized endo/excinuclease amino terminal domain protein 
[Acanthamoeba polyphaga mimivirus]
 sp|Q5UPY6.1|YL300_MIMIV RecName: Full=Uncharacterized protein L300 [Acanthamoeba polyphaga 
mimivirus]
 gb|AAV50572.1| endo/excinuclease amino terminal domain protein [Acanthamoeba 
polyphaga mimivirus]
 gb|ADO18126.1| uncharacterized endo/excinuclease amino terminal domain protein 
[Acanthamoeba polyphaga mimivirus]
 gb|AEJ34540.1| endo/excinuclease amino terminal domain protein [Acanthamoeba 
polyphaga mimivirus]
 gb|AEQ60488.1| GIY-YIG nuclease superfamily protein [Acanthamoeba castellanii 
mamavirus]
 gb|EJN40751.1| endo/excinuclease amino terminal domain protein [Acanthamoeba 
polyphaga lentillevirus]
 gb|AHA45565.1| putative endo/excinuclease amino terminal domain protein [Hirudovirus 
strain Sangsue]
 gb|AHJ40027.1| putative endo/excinuclease amino terminal domain protein [Samba 
virus]
Length=166

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGFMD  280
            W  YLI+S +   +TY+G T N  RRL +HN     + GAK +R GR WI    I GF +
Sbjct  4    WVCYLIMSLDSK-ETYIGSTNNRQRRLNDHNNLNPSRKGAKRTR-GRTWIPILYISGFEN  61

Query  279  RSEACAFETRWKQLSRK  229
            ++   +FE+ WK+LS+K
Sbjct  62   KNACLSFESGWKRLSKK  78



>ref|XP_004955835.1| PREDICTED: uncharacterized protein LOC101777363 [Setaria italica]
Length=377

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 2/87 (2%)
 Frame = -3

Query  444  YLILSTNP--PIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S  P   I+TY+G T N  RR+++HNGE+  GA  +R GRPW     I GF     
Sbjct  53   YLLRSLCPRSKIRTYIGFTVNPRRRIRQHNGEIASGAWRTRRGRPWEMVLCIYGFPSNVA  112

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKL  190
            A  FE  W+  +  L  +    E + L
Sbjct  113  ALQFEWAWQHPAESLAVRKAAAEFKSL  139



>emb|CCA71396.1| related to SLX1-Subunit of a complex, with Slx4p, that hydrolyzes 
5` branches from duplex DNA [Piriformospora indica DSM 
11827]
Length=428

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKT--YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S   P  T  Y+G T +  RRL++HNGEL  GA+ +   RPW  A L+ GF  
Sbjct  19   YACYLLKSVKSPTATATYIGSTLHPVRRLRQHNGELVSGARRTARHRPWDMAMLVHGFPS  78

Query  279  RSEACAFETRWKQ  241
            R  A  FE  W+ 
Sbjct  79   RLAALQFEWAWQH  91



>ref|WP_034839405.1| hypothetical protein [Endozoicomonas numazuensis]
Length=100

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VY+IL++N  +  Y G+TTN  RR KEH+GE KGGA+     RP +    +    DRS
Sbjct  3    WFVYIILASNNSL--YTGITTNVERRWKEHSGEKKGGARFFYGKRP-VALMYVEEGHDRS  59

Query  273  EACAFETRWKQLSR  232
             A   E   K+++R
Sbjct  60   TAGKREVAIKKMTR  73



>emb|CBK22023.2| unnamed protein product [Blastocystis hominis]
Length=122

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S N   +  TY+G T N  RR+++HN E+K GA  +    PW   C++ GF D+ E
Sbjct  6    YLLRSLNEKYRNSTYIGYTVNPKRRIRQHNREIKNGAFKTHRAMPWEMICVVCGFPDKRE  65

Query  270  ACAFETRWKQ  241
               FE  W+ 
Sbjct  66   GLRFEWAWQH  75



>ref|XP_005756601.1| hypothetical protein EMIHUDRAFT_250660 [Emiliania huxleyi CCMP1516]
 gb|EOD04172.1| hypothetical protein EMIHUDRAFT_250660 [Emiliania huxleyi CCMP1516]
Length=169

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -3

Query  411  TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWKQ  241
            TYVG + +  RRL++HNGEL GG  A  AGRPW    ++ GF  +S+A AFE  W++
Sbjct  101  TYVGASPDPVRRLRQHNGELSGGG-APAAGRPWRILLVVCGFSSKSDALAFEWAWQK  156



>gb|EFW16058.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira]
Length=383

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASR--AGRPWICACLIRGFMD  280
            +  YL+ ST      Y+G T N +RRL +HNG ++GGAK +   + RPW    L+ GFM 
Sbjct  29   YCAYLLRSTVRHASLYIGSTPNPARRLAQHNGLIQGGAKRTHKVSLRPWEMVMLVSGFMS  88

Query  279  RSEACAFETRWKQ  241
            R+ A  FE  W+ 
Sbjct  89   RTAALQFEWAWQH  101



>ref|XP_003069834.1| GIY-YIG catalytic domain containing protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER27689.1| GIY-YIG catalytic domain containing protein [Coccidioides posadasii 
C735 delta SOWgp]
Length=383

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASR--AGRPWICACLIRGFMD  280
            +  YL+ ST      Y+G T N +RRL +HNG ++GGAK +   + RPW    L+ GFM 
Sbjct  29   YCAYLLRSTVRHASLYIGSTPNPARRLAQHNGLIQGGAKRTHKVSLRPWEMVMLVSGFMS  88

Query  279  RSEACAFETRWKQ  241
            R+ A  FE  W+ 
Sbjct  89   RTAALQFEWAWQH  101



>gb|EXX56438.1| hypothetical protein RirG_216170 [Rhizophagus irregularis DAOM 
197198w]
Length=313

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  +Y+G T +  RRL++HNGE+  GAK +   RPW     + GF +   
Sbjct  23   YLLRSLSPKYKQTSYIGSTNDPKRRLRQHNGEIASGAKKTSNKRPWEMILFVYGFPNHVA  82

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLL  166
            A  FE  W+   ++R+L  K +   ++  ++  + LL
Sbjct  83   ALQFEWSWQNPSITRRLQLKNREEFKENDDKLSTSLL  119



>ref|XP_003389448.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Amphimedon queenslandica]
Length=274

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  VYLILSTNPPIK--TYVGVTTNFSRRLKEHNGEL-KGGAKASRAGRPWICACLIRGFMDR  277
            VY +LS NP  K  TY+G T N  RRLK+HNG + KGGA+ +    PW    ++ GF + 
Sbjct  28   VYFLLSKNPKYKGRTYIGYTVNPIRRLKQHNGGIKKGGARKTSGRGPWDMILIVHGFPND  87

Query  276  SEACAFETRWKQLSR  232
              A  FE  W+  S+
Sbjct  88   IAALRFEWAWQHPSK  102



>ref|XP_001648514.1| hypothetical protein AaeL_AAEL004145 [Aedes aegypti]
 gb|EAT44512.1| AAEL004145-PA [Aedes aegypti]
Length=175

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -3

Query  453  WSVYLILS--TNPPI--KTYVGVTTNFSRRLKEHNG-ELKGGAKASRAGRPWICACLIRG  289
            + VYL++S   NP    +TY+G T + +RR+K+HNG +  GGAK +    PW+   ++ G
Sbjct  15   YGVYLLVSKSINPKFAGRTYIGYTVDPNRRIKQHNGGQDAGGAKRTSNRGPWVMVMIVHG  74

Query  288  FMDRSEACAFETRWKQ--LSRKL  226
            F +   A  FE  W+Q  +SR+L
Sbjct  75   FPNNISALRFEWAWQQPKVSRRL  97



>ref|XP_007927485.1| hypothetical protein MYCFIDRAFT_99264, partial [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME82009.1| hypothetical protein MYCFIDRAFT_99264, partial [Pseudocercospora 
fijiensis CIRAD86]
Length=322

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            ++ YL+ S      TY+G T N  RRL++HNGE KGGA + SR   RPW   CL+ GF  
Sbjct  6    YACYLLRSIARHSSTYIGSTPNPPRRLRQHNGESKGGAVRTSRDSLRPWEMTCLVTGFPS  65

Query  279  RSEACAFETRWK  244
            +  A  FE  W+
Sbjct  66   KIAALQFEWAWQ  77



>ref|XP_002170246.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Hydra vulgaris]
Length=302

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGR-PWICACLIRGFM  283
            + VY++ + NP  K   Y+G T N  RR+++HN E+KGGA  +   R PW    +I GF 
Sbjct  16   YGVYILYNINPKYKGSVYIGFTVNPERRIRQHNREIKGGALKTGNNRGPWDMVLIIHGFR  75

Query  282  DRSEACAFETRWK--QLSRKL  226
             R  A  FE  W+  ++S++L
Sbjct  76   TRCAALQFEWAWQNPKISKRL  96



>emb|CDS10590.1| hypothetical protein LRAMOSA11076 [Absidia idahoensis var. thermophila]
Length=275

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 3/71 (4%)
 Frame = -3

Query  444  YLILSTNPP---IKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            YLI S N P    K Y+G T +   RL++HNGE+  GAK +  GRPW     + GF + S
Sbjct  7    YLIRSLNLPKYHNKVYIGTTPDPIHRLRQHNGEIVQGAKKTEHGRPWEMVMFVYGFPNDS  66

Query  273  EACAFETRWKQ  241
             A  FE  W+ 
Sbjct  67   YALQFEWAWQN  77



>ref|XP_010685968.1| PREDICTED: uncharacterized protein LOC104900278 [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +  YL+ S NP  K  TY+G T N  RR+++HNGE+  GA  ++  RPW     I GF  
Sbjct  58   YGCYLLTSVNPRFKGHTYIGFTVNPKRRIRQHNGEITSGAFRTKKKRPWEMILCIHGFPT  117

Query  279  RSEACAFETRWKQ  241
               A  FE  W+ 
Sbjct  118  NVAALQFEWAWQH  130



>dbj|GAD92142.1| hypothetical protein PVAR5_0729 [Byssochlamys spectabilis No. 
5]
Length=411

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL+ ST    K Y+G T N  RRL +HNG   GGAK +   RPW     + GFM R+ A 
Sbjct  31   YLLRSTVNNGKLYIGSTPNPRRRLAQHNGFSNGGAKHTAKLRPWEMVLFVEGFMSRTGAL  90

Query  264  AFETRWKQ  241
             FE  W+ 
Sbjct  91   QFEWSWQH  98



>ref|WP_006003850.1| excinuclease ABC subunit C [Desulfovibrio piger]
 gb|EEB34896.1| GIY-YIG catalytic domain protein [Desulfovibrio piger ATCC 29098]
Length=97

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 10/90 (11%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYL+   +  +  Y GVTT+  RRL +HNG L GGA+ +R  RP +   L R    R 
Sbjct  8    WHVYLLRCADDTL--YCGVTTDLDRRLAQHNGSLPGGARYTRPRRP-VALLLSRACTSRQ  64

Query  273  EACAFETRWKQLSRKLPCKGKGNEEQKLEE  184
            EA   E   K+L R         +EQ L+E
Sbjct  65   EALRLEYHIKRLPR-------SRKEQALKE  87



>gb|ETP27002.1| hypothetical protein F441_00430 [Phytophthora parasitica CJ01A1]
Length=349

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>gb|ETL50336.1| hypothetical protein L916_00405 [Phytophthora parasitica]
 gb|ETP54969.1| hypothetical protein F442_00424 [Phytophthora parasitica P10297]
Length=349

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>ref|XP_505695.1| YALI0F21131p [Yarrowia lipolytica]
 sp|Q6C0W7.1|SLX1_YARLI RecName: Full=Structure-specific endonuclease subunit SLX1 [Yarrowia 
lipolytica CLIB122]
 emb|CAG78504.1| YALI0F21131p [Yarrowia lipolytica CLIB122]
Length=288

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 50/96 (52%), Gaps = 14/96 (15%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA--KASRAG-RPWICACLIRGFM  283
            + VYL+ ST  P+  YVG T N  RR+++HNG+LK G   +  RA  RPW    ++ GF 
Sbjct  9    YGVYLLQSTKKPLSCYVGSTPNPFRRIRQHNGDLKAGGAWRTKRAHLRPWSMVLIVNGFP  68

Query  282  DRSEACAFE--------TRW---KQLSRKLPCKGKG  208
             +  A  FE        TR    K + RK+P K + 
Sbjct  69   SKISALKFEHALQHPNMTRLITTKDIKRKVPQKARA  104



>gb|ETK96988.1| hypothetical protein L915_00403 [Phytophthora parasitica]
 gb|ETO85971.1| hypothetical protein F444_00429 [Phytophthora parasitica P1976]
Length=349

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>ref|XP_001216691.1| predicted protein [Aspergillus terreus NIH2624]
 sp|Q0CE14.1|SLX1_ASPTN RecName: Full=Structure-specific endonuclease subunit slx1 [Aspergillus 
terreus NIH2624]
 gb|EAU31243.1| predicted protein [Aspergillus terreus NIH2624]
Length=390

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = -3

Query  444  YLILST-NPPIKTYVGVTTNFSRRLKEHNGELKGGAK-ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST N     YVG T N  RRL +HNG  KGGAK  +   RPW    L+ GFM R+ 
Sbjct  19   YLLRSTVNKRAGLYVGSTPNPPRRLPQHNGLSKGGAKKTATKNRPWEMVLLVEGFMSRTA  78

Query  270  ACAFETRWKQLSRKLPCKGK-GNEEQKLEETKSV  172
            A  FE  W+    +   KG+ GN +++    +S+
Sbjct  79   ALQFEWAWQHEDSRHMSKGEPGNTKRRQRPRRSL  112



>gb|ETM56654.1| hypothetical protein L914_00407 [Phytophthora parasitica]
Length=349

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>ref|XP_008889987.1| hypothetical protein PPTG_00355 [Phytophthora parasitica INRA-310]
 gb|ETN23851.1| hypothetical protein PPTG_00355 [Phytophthora parasitica INRA-310]
Length=349

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK---TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            ++ YL+    PP +   +Y+G T   +RR+++HNGEL  GAK +R  RPW    ++ GF 
Sbjct  4    FACYLLTPVQPPQRLRCSYIGFTVAPTRRIRQHNGELVNGAKRTRKFRPWEMIAVVHGFP  63

Query  282  DRSEACAFETRWKQ  241
             +  A  FE  W+ 
Sbjct  64   SKFRALQFEWVWQH  77



>ref|YP_003969786.1| putative GIY-YIG endonuclease [Cafeteria roenbergensis virus 
BV-PW1]
 gb|ADO67187.1| putative GIY-YIG endonuclease [Cafeteria roenbergensis virus 
BV-PW1]
Length=103

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 11/88 (13%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRA----GRPWICACLIRGF  286
            + +YL+   N   +TY+G++ N  RR ++HNGE+KGGAK++ A    G+ W   C I   
Sbjct  3    YYLYLLYHQNKN-RTYLGISNNLKRRWRQHNGEIKGGAKSTTALLSYGK-WTPVC-ISPM  59

Query  285  MDRSEACAFETRWKQLSRKLPCKGKGNE  202
             D+S A ++E + K + R    K KGN 
Sbjct  60   KDKSSALSYEIKIKNMRR----KAKGNH  83



>ref|WP_012487274.1| nuclease [Cellvibrio japonicus]
 ref|YP_001982130.1| GIY-YIG catalytic domain-containing protein [Cellvibrio japonicus 
Ueda107]
 gb|ACE85985.1| GIY-YIG catalytic domain protein [Cellvibrio japonicus Ueda107]
Length=108

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VY+IL+T+  +  Y G+TTN +RR  EH    K GAK  R GR  +  CL+    DRS
Sbjct  3    WFVYMILATDSQL--YSGITTNMARRWHEHRSG-KTGAKYFR-GRAPMALCLLEAAADRS  58

Query  273  EACAFETRWKQLSRK  229
             A   E + KQL+R+
Sbjct  59   SASKREAQLKQLTRR  73



>gb|AFR92528.1| structure-specific endonuclease subunit SLX1 [Cryptococcus neoformans 
var. grubii H99]
Length=459

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWK--Q  241
            +TYVG T +  RR+++HNGE+K GA ++   RPW    ++ GF  +  A  FE  W+  +
Sbjct  44   RTYVGSTPDPPRRIRQHNGEIKQGAWSTSRHRPWEMQMIVYGFPSKLAALQFEWAWQKPE  103

Query  240  LSRKLPCKGKGNEEQKL  190
            LSR L  +G+  E   +
Sbjct  104  LSRHLKVRGEDQEYHHI  120



>emb|CCD17159.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=520

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = -3

Query  450  SVYLILSTNP--PIKTYVGVTTNFSRRLKEHNGELKGGAKASR-AGRPWICACLIRGFMD  280
            SVYL+ S +P  P   Y+G + N  RRL++HNGEL  GA+ +R  GRPWI    + GF +
Sbjct  7    SVYLLTSLDPQLPGAYYIGYSLNPVRRLRQHNGELVNGARRTRKCGRPWILLLCVSGFGE  66

Query  279  RSEACAFETRWKQ  241
               A  FE  W+ 
Sbjct  67   DRIALKFEWCWQH  79



>ref|XP_003191354.1| GIY-YIG type nuclease catalytic domain containing protein [Cryptococcus 
gattii WM276]
 gb|ADV19567.1| GIY-YIG type nuclease catalytic domain containing protein [Cryptococcus 
gattii WM276]
Length=466

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWK--Q  241
            +TYVG T +  RRL++HNGEL  GA ++   RPW    ++ GF  +  A  FE  W+  +
Sbjct  43   RTYVGSTPDPPRRLRQHNGELTQGAWSTSRHRPWEMQMIVYGFPSKLSALQFEWAWQKPE  102

Query  240  LSRKLPCKGKGNEEQKL  190
            LSR L  +G+  E  ++
Sbjct  103  LSRHLKIRGEDEEYHRI  119



>ref|XP_007873445.1| hypothetical protein PNEG_01506 [Pneumocystis murina B123]
 gb|EMR10235.1| hypothetical protein PNEG_01506 [Pneumocystis murina B123]
Length=330

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  414  KTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWK  244
            +TY+G T+N   RL++HNGE+  GA+ +  GRPW   CL+ GF     A  FE  W+
Sbjct  20   RTYIGSTSNPFNRLRQHNGEIVSGAQKTVKGRPWNIICLVYGFPSVVSALQFEWAWQ  76



>gb|KDQ27950.1| hypothetical protein PLEOSDRAFT_173769 [Pleurotus ostreatus PC15]
Length=414

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLI--LSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+  + T+    TY+G T N  RR+++HNGE+  GA  ++  RPWI   ++ GF  
Sbjct  21   YACYLLKSIQTSKSTATYIGSTPNPPRRIRQHNGEITAGAWKTKHKRPWIMQMIVHGFPS  80

Query  279  RSEACAFETRWK--QLSRKL  226
            +  A  FE  W+   +SR L
Sbjct  81   KLAALQFEWAWQHPHISRHL  100



>ref|XP_567159.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_777895.1| hypothetical protein CNBA3640 [Cryptococcus neoformans var. neoformans 
B-3501A]
 sp|P0CN81.1|SLX1_CRYNB RecName: Full=Structure-specific endonuclease subunit SLX1 [Cryptococcus 
neoformans var. neoformans B-3501A]
 sp|P0CN80.1|SLX1_CRYNJ RecName: Full=Structure-specific endonuclease subunit SLX1 [Cryptococcus 
neoformans var. neoformans JEC21]
 gb|EAL23248.1| hypothetical protein CNBA3640 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41340.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=487

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  453  WSVYLILS--TNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S  T    +TYVG T +  RR+++HNGELK GA ++   RPW    ++ GF  
Sbjct  29   YACYLLRSKATANSNRTYVGSTPDPPRRIRQHNGELKQGAWSTSRHRPWEMQMIVYGFPS  88

Query  279  RSEACAFETRWK--QLSRKLPCKGKGNE  202
            +  A  FE  W+  +LSR L  +G+  E
Sbjct  89   KLAALQFEWAWQKPELSRHLRIRGEDQE  116



>ref|WP_007020733.1| endonuclease [Neptuniibacter caesariensis]
 gb|EAR62423.1| Predicted endonuclease containing a URI domain [Oceanospirillum 
sp. MED92]
Length=85

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VY++   +  +  Y GVTT   RR +EHNGEL+GGAK +R  RP +         +R
Sbjct  3    KWYVYIVRCADSSL--YTGVTTELKRREREHNGELQGGAKYTRVRRP-VEIVWSEPHENR  59

Query  276  SEACAFETRWKQLSRK  229
            S+A   E + K+ SRK
Sbjct  60   SDATKREYQIKRYSRK  75



>ref|XP_001822706.2| structure-specific endonuclease subunit slx1 [Aspergillus oryzae 
RIB40]
Length=401

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAGRPWICACLIRGFMDR  277
            +  YL+ ST      Y+G T + SRRL +HNG  +GGA K +   RPW    ++ GFM R
Sbjct  16   YCCYLLRSTVRQTSLYIGSTPHPSRRLAQHNGVSRGGARKTANDKRPWEMVLIVEGFMSR  75

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQKLEETKS  175
            + A  FE  W++  +        N E   E+ K+
Sbjct  76   TAALQFEWAWQKPGKSRHLGDDDNTESAREKGKT  109



>gb|KEY75720.1| structure specific endonuclease subunit slx1 [Aspergillus fumigatus 
var. RP-2014]
Length=423

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 14/101 (14%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T N +RRL +HNG +KGGA+  A+   RPW    ++ GFM R  
Sbjct  19   YLLRSTVRHASLYIGSTPNPARRLIQHNGVVKGGARRTAAEKLRPWEMVLVVEGFMSRLA  78

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLLLKHR  154
            A  FE  W+    SR L          + EE+ ++  +KHR
Sbjct  79   ALQFEWAWQNPWYSRHL----------RSEESSALAEVKHR  109



>ref|XP_747999.1| GIY-YIG catalytic domain containing protein [Aspergillus fumigatus 
Af293]
 sp|Q4WEL6.1|SLX1_ASPFU RecName: Full=Structure-specific endonuclease subunit slx1 [Aspergillus 
fumigatus Af293]
 gb|EAL85961.1| GIY-YIG catalytic domain containing protein [Aspergillus fumigatus 
Af293]
Length=423

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 14/101 (14%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T N +RRL +HNG +KGGA+  A+   RPW    ++ GFM R  
Sbjct  19   YLLRSTVRHASLYIGSTPNPARRLIQHNGVVKGGARRTAAEKLRPWEMVLVVEGFMSRLA  78

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLLLKHR  154
            A  FE  W+    SR L          + EE+ ++  +KHR
Sbjct  79   ALQFEWAWQNPWYSRHL----------RSEESSALAEVKHR  109



>sp|B0Y2U0.1|SLX1_ASPFC RecName: Full=Structure-specific endonuclease subunit slx1 [Aspergillus 
fumigatus A1163]
 gb|EDP51192.1| GIY-YIG catalytic domain containing protein [Aspergillus fumigatus 
A1163]
Length=423

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 14/101 (14%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T N +RRL +HNG +KGGA+  A+   RPW    ++ GFM R  
Sbjct  19   YLLRSTVRHASLYIGSTPNPARRLIQHNGVVKGGARRTAAEKLRPWEMVLVVEGFMSRLA  78

Query  270  ACAFETRWKQ--LSRKLPCKGKGNEEQKLEETKSVLLLKHR  154
            A  FE  W+    SR L          + EE+ ++  +KHR
Sbjct  79   ALQFEWAWQNPWYSRHL----------RSEESSALAEVKHR  109



>emb|CCC46866.1| conserved hypothetical protein [Trypanosoma vivax Y486]
Length=536

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 6/110 (5%)
 Frame = -3

Query  447  VYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRA-GRPWICACLIRGFMDR  277
            VYL+ S NP      YVG T N  RRL++HNGEL  GA  +R+ GRPW+    + GF + 
Sbjct  8    VYLLTSLNPQCSGAYYVGYTVNPIRRLRQHNGELVNGAHRTRSRGRPWLLLLCVSGFGED  67

Query  276  SEACAFETRWKQLSRKLPCKGKGNEEQ---KLEETKSVLLLKHRYAALDQ  136
              A  FE  W+  ++    K   +  +   +L+    VL L  R A   Q
Sbjct  68   RIALKFEWCWQNPTKSTRLKAHMSLLRGVYRLQYAVGVLFLLLRVAPFAQ  117



>ref|XP_001421690.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99983.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=370

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL++S +P  K  +YVG TTN  RRL +HNG +  GAK +   RP     ++ GF D
Sbjct  20   YACYLVVSLDPSKKGKSYVGFTTNPPRRLAQHNGAIANGAKYTMRLRPCDMVLVVSGFSD  79

Query  279  RSEACAFETRWKQ  241
            + +A  FE  W++
Sbjct  80   KVQALQFEWAWQR  92



>ref|XP_007869679.1| hypothetical protein GLOTRDRAFT_80778, partial [Gloeophyllum 
trabeum ATCC 11539]
 gb|EPQ51778.1| hypothetical protein GLOTRDRAFT_80778, partial [Gloeophyllum 
trabeum ATCC 11539]
Length=398

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 4/80 (5%)
 Frame = -3

Query  453  WSVYLILSTNPP--IKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S   P    TY+G T N  RR+++HNGE+  GA  ++  RPW+   ++ GF  
Sbjct  21   YACYLLKSIRTPRSNATYIGSTPNPPRRIRQHNGEISQGAWKTQRSRPWVMQMIVHGFPS  80

Query  279  RSEACAFETRWK--QLSRKL  226
            +  A  FE  W+   LSR L
Sbjct  81   KLAALQFEWAWQHPHLSRHL  100



>ref|XP_009410527.1| PREDICTED: uncharacterized protein LOC103992523 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL++S +P  K  TY+G T N  RR+++HNGE++ GA  ++ GRPW     I GF  
Sbjct  37   FACYLLVSLSPRHKSRTYIGFTVNPRRRIRQHNGEIRCGAWRTKHGRPWGMVLCIYGFPS  96

Query  279  RSEACAFETRWKQ  241
               A  FE  W+ 
Sbjct  97   NVSALQFEWAWQH  109



>ref|WP_014950250.1| endonuclease [Alteromonas macleodii]
 ref|YP_006748717.1| URI domain endonuclease [Alteromonas macleodii ATCC 27126]
 ref|YP_006803703.1| URI domain endonuclease [Alteromonas macleodii str. 'Balearic 
Sea AD45']
 gb|AFS38163.1| URI domain endonuclease [Alteromonas macleodii ATCC 27126]
 gb|AFT96222.1| URI domain endonuclease [Alteromonas macleodii str. 'Balearic 
Sea AD45']
Length=115

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL L  N   + Y G+TTN  RR+ +H GELKGGAKA +   P     +    +D+S A 
Sbjct  22   YLYLVENKLGQLYTGITTNPKRRIAQHRGELKGGAKALKGKAPLTFKAIFE-MIDKSHAS  80

Query  264  AFETRWKQLSR  232
              E   K++SR
Sbjct  81   KLEYEVKRMSR  91



>gb|EHA28533.1| hypothetical protein ASPNIDRAFT_189208 [Aspergillus niger ATCC 
1015]
Length=424

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T + +RRL +HNGE KGGA+  A    RPW    L+ GF  R  
Sbjct  19   YLLRSTKQRTSLYIGSTPHPARRLAQHNGESKGGARKTAKDDKRPWEMVLLVEGFTSRVG  78

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKLEETKSV  172
            A  FE  W+  + K+  +   N  Q   ET  V
Sbjct  79   ALQFEWAWQ--NPKMSSQHPANRHQFDLETGDV  109



>gb|EHK20008.1| hypothetical protein TRIVIDRAFT_77206 [Trichoderma virens Gv29-8]
Length=305

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            + VY++ ST  P   Y+G T N  RRLK+HNGE KGGA + SR   RPW    L+ GF  
Sbjct  12   YVVYVLRSTVRPASIYIGSTPNPPRRLKQHNGEAKGGAVRTSRDSLRPWEMIMLVSGFPS  71

Query  279  RSEACAFE  256
             + A  FE
Sbjct  72   STAALKFE  79



>ref|XP_002147721.1| GIY-YIG catalytic domain containing protein [Talaromyces marneffei 
ATCC 18224]
 sp|B6QFH5.1|SLX1_PENMQ RecName: Full=Structure-specific endonuclease subunit slx1 [Talaromyces 
marneffei ATCC 18224]
 gb|EEA24210.1| GIY-YIG catalytic domain containing protein [Talaromyces marneffei 
ATCC 18224]
Length=389

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMDRSE  271
            YL+ S   P   Y+G T + +RRL++HNG  KGGAK +     RPW    +I GF  R+ 
Sbjct  22   YLLRSVKKPSSLYIGSTPDPARRLEQHNGFTKGGAKRTERDTLRPWEMITIIEGFTSRTG  81

Query  270  ACAFETRWKQL  238
            A  FE  W+ +
Sbjct  82   ALQFEWSWQHV  92



>emb|CAX69857.1| Structure-specific endonuclease SLX1 [Schistosoma japonicum]
Length=278

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  Y++LS NP  +  TY+G T N  RR+++HN G LKGGAK++    PW    ++ GF 
Sbjct  21   YGCYILLSLNPNFRGRTYIGFTVNPKRRIRQHNAGFLKGGAKSTAGKGPWEMVLIVHGFP  80

Query  282  DRSEACAFETRWKQ  241
            +   A  FE  W+ 
Sbjct  81   NAISALRFEWAWQN  94



>ref|XP_002840567.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84758.1| unnamed protein product [Tuber melanosporum]
Length=431

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            + VYL+ ST  P   Y+G T +  RRL +HNG+ KGGA + SR   RPW   C++ GF  
Sbjct  50   YCVYLLRSTVRPKSFYIGSTPDPRRRLAQHNGQTKGGAERTSRENLRPWEMTCIVSGFTS  109

Query  279  RSEACAFETRWKQ  241
               A  FE  W+ 
Sbjct  110  SVAALQFEWAWQN  122



>emb|CCW70937.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=605

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = -3

Query  408  YVGVTTNFSRRLKEHNGELKGGAKAS-RAGRPWICACLIRGFMDRSEACAFETRWKQ  241
            Y+G T N  RRL++HNGEL  GAK + R GRPW   C + GF D   A  FE  W+ 
Sbjct  23   YIGYTLNPLRRLRQHNGELVNGAKRTRRRGRPWALVCCLSGFPDDHAALKFEWGWQH  79



>emb|CAX69856.1| Structure-specific endonuclease SLX1 [Schistosoma japonicum]
Length=279

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  Y++LS NP  +  TY+G T N  RR+++HN G LKGGAK++    PW    ++ GF 
Sbjct  22   YGCYILLSLNPNFRGRTYIGFTVNPKRRIRQHNAGFLKGGAKSTAGKGPWEMVLIVHGFP  81

Query  282  DRSEACAFETRW------KQLSRKLPCK  217
            +   A  FE  W      ++L   LP K
Sbjct  82   NAISALRFEWAWQNPKSSRRLKDSLPVK  109



>ref|XP_001276188.1| GIY-YIG catalytic domain protein [Aspergillus clavatus NRRL 1]
 sp|A1C4Z4.1|SLX1_ASPCL RecName: Full=Structure-specific endonuclease subunit slx1 [Aspergillus 
clavatus NRRL 1]
 gb|EAW14762.1| GIY-YIG catalytic domain protein [Aspergillus clavatus NRRL 1]
Length=434

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMD  280
            +  YL+ ST      Y+G T N +RRL +HNG +KGGA+  A+   RPW    ++ GFM 
Sbjct  16   YCCYLLRSTVRHASLYIGSTPNPARRLTQHNGVVKGGARRTAAEKLRPWEMVMIVEGFMS  75

Query  279  RSEACAFETRWKQ--LSRKLPCKGKGNE  202
            R  A  FE  W+    SR L  + +G E
Sbjct  76   RLGALQFEWAWQNPGYSRHLRSEEEGLE  103



>ref|XP_004364864.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
Length=376

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  YL+ S NP  K  TY+G T N  RR K+HN G+ KGGA  +   +PW     + GFM
Sbjct  87   YGCYLLRSLNPKYKNITYIGFTVNPGRRYKQHNSGKEKGGAVFTDRRKPWQLVLCVYGFM  146

Query  282  DRSEACAFETRWKQLSR  232
            D+  A  FE  W+   R
Sbjct  147  DKYSALRFEWAWQHPER  163



>gb|EEZ79597.1| endonuclease [uncultured SUP05 cluster bacterium]
Length=87

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIR-GFMDR  277
            W+VYL+   +  +  Y G+T +  RR+++HNGELKGGAK +RA  P  C  + +    DR
Sbjct  7    WTVYLLRCRDNNL--YCGITNHLDRRIRQHNGELKGGAKYTRANGP--CELVYQEKSKDR  62

Query  276  SEACAFETRWKQLSR  232
            S A   E   K +SR
Sbjct  63   SSASKREHEIKTMSR  77



>ref|WP_036228302.1| hypothetical protein [Marinobacterium jannaschii]
Length=94

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDR  277
            +W VY++   +  +  Y GV+T+  RRL+EHNGE+KGGA+ +RA RP +         DR
Sbjct  3    QWYVYMLRCADGTL--YTGVSTDPCRRLREHNGEIKGGARYTRARRP-VALVWQEPQPDR  59

Query  276  SEACAFETRWKQLSR  232
            S AC  E   K L R
Sbjct  60   SAACRREVAVKALRR  74



>gb|KFH62914.1| hypothetical protein MVEG_11438 [Mortierella verticillata NRRL 
6337]
Length=440

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  444  YLILSTNPPIKT--YVGVTTNFSRRLKEHNGELK-GGAKASRAGRPWICACLIRGFMDRS  274
            YL+ ST P  K   YVG T +  +RL++HNG+LK GGAK +   RPW    L+ GF  + 
Sbjct  117  YLLASTVPRYKAHAYVGSTPDPVKRLRQHNGDLKKGGAKKTSKKRPWKMMMLVHGFPTKV  176

Query  273  EACAFETRWKQLSR  232
             A  FE  W+   R
Sbjct  177  AALQFEWAWQYPDR  190



>ref|WP_039228460.1| endonuclease [Alteromonas macleodii]
 gb|KHT49783.1| endonuclease [Alteromonas macleodii]
Length=115

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL L  N   + Y G+TTN  RRL +H GELKGGAKA +   P     +     D+S A 
Sbjct  22   YLYLVENKLGQLYTGITTNPKRRLAQHRGELKGGAKALKGKAPLTFKAIFE-MTDKSHAS  80

Query  264  AFETRWKQLSR  232
              E   K++SR
Sbjct  81   RLEYEVKRMSR  91



>ref|XP_007876048.1| hypothetical protein PFL1_00361 [Pseudozyma flocculosa PF-1]
 gb|EPQ32164.1| hypothetical protein PFL1_00361 [Pseudozyma flocculosa PF-1]
Length=694

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            ++ Y + S + P  TY+G T +  RR ++HNGEL  GA  +   RPW   C++ GF  + 
Sbjct  14   YACYFLRSLSVPGSTYIGSTPSPPRRKRQHNGELTQGASRTIRSRPWEMECIVYGFSSKI  73

Query  273  EACAFETRW--KQLSRKL  226
             A  FE  W    LSR L
Sbjct  74   AALQFEWAWAKPHLSRHL  91



>gb|EIT79846.1| GIY-YIG type nuclease [Aspergillus oryzae 3.042]
 gb|KDE85716.1| GIY-YIG type nuclease [Aspergillus oryzae 100-8]
Length=403

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAGRPWICACLIRGFMDR  277
            +  YL+ ST      Y+G T + SRRL +HNG  +GGA K +   RPW    ++ GFM+R
Sbjct  16   YCCYLLRSTVRQTSLYIGSTPHPSRRLAQHNGVSRGGARKTANDKRPWEMVLIVEGFMNR  75

Query  276  SEACAFETRW  247
            + A  FE  W
Sbjct  76   TAALQFEYVW  85



>ref|WP_020888065.1| Excinuclease ABC C subunit domain protein [Desulfovibrio alkalitolerans]
 gb|EPR30646.1| Excinuclease ABC C subunit domain protein [Desulfovibrio alkalitolerans 
DSM 16529]
Length=89

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 9/80 (11%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRP--WICACLIRGFMD  280
            W VYL+  ++  +  Y GVT +  RRL EHNG   GGA+ + + RP   + A   R   D
Sbjct  3    WHVYLLECSDKTL--YCGVTKDLDRRLAEHNGLSPGGARYTFSRRPVRLLAAACCR---D  57

Query  279  RSEACAFETRWKQL--SRKL  226
            RS ACA E R K+L  SRKL
Sbjct  58   RSSACALEARIKRLPRSRKL  77



>emb|CDI52725.1| giy-yig type nuclease catalytic domain containing protein [Melanopsichium 
pennsylvanicum 4]
Length=664

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            ++ Y + S + P  TY+G T    RR ++HNG+L  GA  +   RPW   C++ GF  + 
Sbjct  14   YACYFLRSLSSPGSTYIGSTPAPPRRKRQHNGDLTQGAHKTARARPWEMECIVYGFPSKI  73

Query  273  EACAFETRW--KQLSRKL  226
             A  FE  W    LSR L
Sbjct  74   AALQFEWAWAKPHLSRHL  91



>ref|XP_565552.4| AGAP002259-PA [Anopheles gambiae str. PEST]
 gb|EAL42010.4| AGAP002259-PA [Anopheles gambiae str. PEST]
Length=375

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 7/83 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIK----TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRG  289
            + VYL++S +P  K    TY+G T + +RR+K+HN GE  GGA+ +    PW    ++ G
Sbjct  11   YGVYLLVSKSPNPKFAGRTYIGYTVDPNRRIKQHNRGEDAGGARRTSNRGPWTMVLIVHG  70

Query  288  FMDRSEACAFETRWKQ--LSRKL  226
            F +   A  FE  W+Q  +SR+L
Sbjct  71   FPNNISALRFEWAWQQPRVSRRL  93



>ref|XP_007756829.1| hypothetical protein A1O7_04629 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ60476.1| hypothetical protein A1O7_04629 [Cladophialophora yegresii CBS 
114405]
Length=419

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMDRSE  271
            YL+ ST     TY+G T + +RRL +HNG++KGGA + SRA  RPW   C++ GF     
Sbjct  13   YLLRSTVRHASTYIGSTPDPARRLGQHNGKVKGGAVRTSRASLRPWEMGCIVAGFPSNIA  72

Query  270  ACAFETRW--KQLSRKL  226
            A  FE  W    L+R +
Sbjct  73   ALQFEWAWTNAHLTRHI  89



>ref|XP_008810572.1| PREDICTED: structure-specific endonuclease subunit slx1 [Phoenix 
dactylifera]
Length=421

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S +P  K  TY+G T N  RR+++HNGE++ GA  ++ GRPW     I GF  
Sbjct  36   FACYLLCSLSPRHKRRTYIGFTVNPRRRIRQHNGEIRCGAWRTKQGRPWEMILCIYGFPS  95

Query  279  RSEACAFETRWKQLSRKLPCKGKGNEEQKLEETKSVLLLKHRYAAL  142
               A  FE  W+     L  +   +  + L    + + L +   +L
Sbjct  96   NVSALQFEWAWQHPKESLAVRKAASNFKSLSGVANKIKLAYTMLSL  141



>ref|XP_008223476.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
[Prunus mume]
Length=117

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S +P  K  TY+G T N  RRL++HNGE+  GA  ++  RPW     I GF     
Sbjct  26   YLLSSRSPRYKCHTYIGFTVNPRRRLRQHNGEIAQGAWRTKRKRPWEMVLCIYGFPTNVS  85

Query  270  ACAFETRWKQ  241
            A  FE  W+ 
Sbjct  86   ALQFEWAWQH  95



>ref|XP_002420332.1| DNA replication structure-specific endonuclease subunit, putative 
[Candida dubliniensis CD36]
 sp|B9WGW9.1|SLX1_CANDC RecName: Full=Structure-specific endonuclease subunit SLX1 [Candida 
dubliniensis CD36]
 emb|CAX41407.1| DNA replication structure-specific endonuclease subunit, putative 
[Candida dubliniensis CD36]
Length=286

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELK-GGAKASR--AGRPWICACLIRGFM  283
            + VY++ S   P +TY+G T +  RRL++HNG+LK GGA  ++    RPW    L+ GF 
Sbjct  17   YGVYILKSIPKPRRTYIGSTPDPKRRLRQHNGDLKVGGAYRTKKDGSRPWTMVVLVHGFP  76

Query  282  DRSEACAFE  256
             R  A  FE
Sbjct  77   SRIAALQFE  85



>emb|CCA36410.1| hypothetical protein PP7435_Chr1-0249 [Komagataella pastoris 
CBS 7435]
Length=209

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 13/99 (13%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA--KASRAG-RPWICACLIRGFM  283
            + VYL+ S   P   Y+G T N  RRL +HNG+L  G   +  R G RPW    L  GF 
Sbjct  2    YYVYLLQSQEKPQSFYIGSTNNPQRRLAQHNGDLAAGGAFRTKREGYRPWKMVLLCLGFH  61

Query  282  DRSEACAFETRWK--QLSRKLPCKGKGNEEQKLEETKSV  172
             +  A  FE  W+   L+R +        E KL  + S+
Sbjct  62   SKIAALQFEHAWQHSHLTRHI--------EDKLSHSNSI  92



>gb|ETO22224.1| hypothetical protein RFI_14976 [Reticulomyxa filosa]
Length=606

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = -3

Query  408  YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEACAFETRWK--QLS  235
            Y+G T N  RR+K+HNG L+ GAK +R  RPW     + GF  +  A  FE  W+    S
Sbjct  84   YIGFTNNPVRRIKQHNGLLENGAKKTRWKRPWEMVVFVYGFPTKHSALQFEWHWQNPNSS  143

Query  234  RKLPCKGKGNE  202
            R L  K K N+
Sbjct  144  RILKHKFKKNQ  154



>ref|XP_001624938.1| predicted protein [Nematostella vectensis]
 sp|A7STV9.1|SLX1_NEMVE RecName: Full=Structure-specific endonuclease subunit SLX1 homolog 
[Nematostella vectensis]
 gb|EDO32838.1| predicted protein [Nematostella vectensis]
Length=270

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = -3

Query  447  VYLILSTNPPIK--TYVGVTTNFSRRLKEHNGEL-KGGAKASRAGRPWICACLIRGFMDR  277
            VYL+   NP  K  TY+G T N +RR+K+HNG + KGGA  +   +PW    ++ GF + 
Sbjct  13   VYLLYCVNPKFKGHTYIGYTVNPNRRIKQHNGGVDKGGAYKTSRKKPWNMILIVHGFPND  72

Query  276  SEACAFETRWKQ--LSRKL  226
              A  FE  W++  +SR+L
Sbjct  73   IIALQFEWAWQKPTVSRRL  91



>ref|WP_028880503.1| hypothetical protein [Terasakiella pusilla]
Length=86

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 5/84 (6%)
 Frame = -3

Query  456  RWSVYLILSTNPPIKTYVGVTTNFS--RRLKEHNGELKGGAKASRAGRPWICACLIRGFM  283
            RW VY++L  N   + Y GVT + +  RRL+EHNG   GGAK +RA RPW       GF 
Sbjct  4    RWFVYVLL--NERGEAYTGVTYDETPDRRLEEHNGLKPGGAKYTRARRPWQLIYAETGFD  61

Query  282  DRSEACAFETRWKQLSRKLPCKGK  211
             RS+A   E + K+  RK   K K
Sbjct  62   GRSDAQVRELQIKK-DRKFKAKLK  84



>ref|XP_003707232.1| PREDICTED: structure-specific endonuclease subunit slx1-like 
[Megachile rotundata]
Length=261

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 7/96 (7%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNG--ELKGGAKASRAGRPWICACLIRGF  286
            + VYL+   NP  K  TY+G T +  RRLK+HN   E +G  K S  G PW    +I GF
Sbjct  11   YGVYLLYCMNPKYKGRTYIGYTVDPRRRLKQHNAGKEHRGAWKTSNKG-PWNMVLIIHGF  69

Query  285  MDRSEACAFETRWK--QLSRKLPCKGKGNEEQKLEE  184
             +R+ A  FE  W+   +SR+L    K    QK+ E
Sbjct  70   PNRTAALRFEWAWQHPHVSRRLKHVPKKKARQKVFE  105



>gb|EMG45412.1| Structure-specific endonuclease subunit SLX1, partial [Candida 
maltosa Xu316]
Length=203

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELK-GGA-KASRAG-RPWICACLIRGFM  283
            + VY++ S   P   YVG T +  RRL++HNG+LK GGA +  R G RPW    LI GF 
Sbjct  17   YGVYILQSEPKPRSFYVGSTPDPKRRLRQHNGDLKTGGAYRTKRNGSRPWKMIVLIHGFP  76

Query  282  DRSEACAFE  256
             R  A  FE
Sbjct  77   SRVSALQFE  85



>ref|XP_003235498.1| hypothetical protein TERG_04552 [Trichophyton rubrum CBS 118892]
Length=389

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMD  280
            + VYL+ ST      Y+G T N +RRL +HNG +KGGA  +     RPW    ++ GF  
Sbjct  25   YCVYLLRSTVRHASLYIGSTPNPARRLAQHNGRIKGGAHRTHREKLRPWEMVMIVSGFTS  84

Query  279  RSEACAFETRWKQ  241
            R+ A  FE  W+ 
Sbjct  85   RTAALQFEWAWQN  97



>gb|EFW43952.2| hypothetical protein CAOG_01996 [Capsaspora owczarzaki ATCC 30864]
Length=458

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFM  283
            +  YL+ S NP  K  TY+G T N  RR K+HN G+ KGGA  +   +PW     + GFM
Sbjct  87   YGCYLLRSLNPKYKNITYIGFTVNPGRRYKQHNSGKEKGGAVFTDRRKPWQLVLCVYGFM  146

Query  282  DRSEACAFETRWKQLSR  232
            D+  A  FE  W+   R
Sbjct  147  DKYSALRFEWAWQHPER  163



>ref|WP_039231427.1| endonuclease [Alteromonas macleodii]
 gb|KHT60304.1| endonuclease [Alteromonas macleodii]
Length=115

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL L  N   + Y G+TTN  RR+ +H GELKGGAKA +   P     +     D+S A 
Sbjct  22   YLYLVENKLGQLYTGITTNPKRRIAQHRGELKGGAKALKGKAPLTFKAIFE-MTDKSHAS  80

Query  264  AFETRWKQLSR  232
              E   K++SR
Sbjct  81   KLEYEVKRMSR  91



>gb|EPB92971.1| hypothetical protein HMPREF1544_00045 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=289

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLI--LSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +S YLI  L      K YVG T N  RRL++HNGEL  GA  ++  RPW    ++ GF  
Sbjct  8    YSCYLIRSLKEGQQNKVYVGSTPNPIRRLRQHNGELTQGAYRTKRHRPWQYVMIVHGFPT  67

Query  279  RSEACAFETRWKQ  241
            +  A  FE  W++
Sbjct  68   KIHALQFECAWQK  80



>ref|XP_010032939.1| PREDICTED: uncharacterized protein LOC104422335 [Eucalyptus grandis]
 gb|KCW52440.1| hypothetical protein EUGRSUZ_J01841 [Eucalyptus grandis]
Length=348

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL++S +P  K  TY+G T N  RR+++HNGEL  GA  ++  RPW     I GF  
Sbjct  43   FACYLLVSLSPRHKGQTYIGFTVNPRRRIRQHNGELMCGAWRTKRKRPWEMVFCIYGFPS  102

Query  279  RSEACAFETRWKQLSRKLPCKGKGNEEQKL  190
               A  FE  W+     L  +   +E + L
Sbjct  103  HVSALQFEWAWQHPRESLAVRKAASEFKSL  132



>ref|WP_014977101.1| endonuclease [Alteromonas macleodii]
 ref|YP_006799779.1| URI domain endonuclease [Alteromonas macleodii str. 'English 
Channel 673']
 gb|AFT75402.1| URI domain endonuclease [Alteromonas macleodii str. 'English 
Channel 673']
Length=115

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL L  N   + Y G+TTN  RR+ +H GELKGGAKA +   P     +     D+S A 
Sbjct  22   YLYLVENKLGQLYTGITTNPKRRIAQHRGELKGGAKALKGKAPLTFKAIFE-MTDKSHAS  80

Query  264  AFETRWKQLSR  232
              E   K++SR
Sbjct  81   KLEYEVKRMSR  91



>gb|KHJ33271.1| putative giy-yig catalytic domain-containing protein [Erysiphe 
necator]
Length=360

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            +  YL+ S   P   Y+G T N +RRL++HNG +KGGA + SR   RPW   C++ GF  
Sbjct  9    YCCYLLRSIPRPSSVYIGSTPNPTRRLEQHNGLIKGGAVRTSRTRLRPWEMTCVVSGFSS  68

Query  279  RSEACAFETRWKQ  241
               A  FE  W+ 
Sbjct  69   HIAALQFEWAWQN  81



>sp|A2QUJ2.1|SLX1_ASPNC RecName: Full=Structure-specific endonuclease subunit slx1 [Aspergillus 
niger CBS 513.88]
 emb|CAK40390.1| unnamed protein product [Aspergillus niger]
Length=424

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T + +RRL +HNGE KGGA+  A    RPW    L+ GF  R  
Sbjct  19   YLLRSTKQRTSLYIGSTPHPARRLAQHNGESKGGARKTAKDDKRPWEMVLLVEGFTSRVG  78

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKLEETKSV  172
            A  FE  W+  + ++  +   N  Q   ET  V
Sbjct  79   ALQFEWAWQ--NPRMSSQHPANRHQFDLETGDV  109



>dbj|GAC92732.1| hypothetical protein PHSY_000287 [Pseudozyma hubeiensis SY62]
Length=644

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            ++ Y + S + P  TY+G T    RR ++HNG+L  GA  +   RPW   C++ GF  + 
Sbjct  14   YACYFLRSLSSPGTTYIGSTPAPPRRKRQHNGDLTQGAYKTARARPWEMECIVYGFSSKI  73

Query  273  EACAFETRW--KQLSRKL  226
             A  FE  W    LSR L
Sbjct  74   AALQFEWAWAKPHLSRHL  91



>ref|YP_008052740.1| GIY-YIG superfamily protein [Phaeocystis globosa virus]
 gb|AET73274.1| hypothetical protein PGAG_00385 [Phaeocystis globosa virus 12T]
 gb|AET73661.1| hypothetical protein PGBG_00350 [Phaeocystis globosa virus 14T]
 gb|AGM15733.1| GIY-YIG superfamily protein [Phaeocystis globosa virus]
Length=125

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKAS----RAGRPWICACLIRGFMD  280
            VY I +TN   +TY+G T +  +R+++HN  +KGGA  +     AG  W   C +     
Sbjct  5    VYFIEATNG--RTYIGATVDLDKRIRQHNKIIKGGAHQTSMQVDAGHSWNYHCYVENCPT  62

Query  279  RSEACAFETRWKQLSRKL  226
               A   E RWKQ+SR++
Sbjct  63   WKAALQVEWRWKQISRQI  80



>ref|XP_007728989.1| hypothetical protein A1O3_00649 [Capronia epimyces CBS 606.96]
 gb|EXJ92099.1| hypothetical protein A1O3_00649 [Capronia epimyces CBS 606.96]
Length=412

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMDRSE  271
            YL+ ST      YVG + N +RRL +HNG ++GGA + SRA  RPW  AC++ GF     
Sbjct  13   YLLRSTVRHSSLYVGSSPNPARRLAQHNGRVQGGAVRTSRASLRPWEMACIVAGFPSNIA  72

Query  270  ACAFETRWK--QLSRKL  226
            A  FE  W+   L+R +
Sbjct  73   ALQFEWAWQNAHLTRHI  89



>emb|CDY54009.1| BnaCnng25920D [Brassica napus]
Length=345

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ Y++ S +P  K  TY+G T N  RR+++HNGE+  GA  ++  RPW     I GF  
Sbjct  32   YACYILTSLSPRHKGHTYIGFTVNPKRRIRQHNGEITSGAYRTKKKRPWEMVLCIYGFPS  91

Query  279  RSEACAFETRWKQ  241
            +  A  FE  W+ 
Sbjct  92   KVSALQFEWAWQH  104



>ref|WP_025255993.1| endonuclease [Alteromonas sp. ALT199]
Length=115

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL +  N   + Y G+TT+  RR+ +H G+LKGGAKA +   P I   +     D+++A 
Sbjct  22   YLYMVENKLGQIYTGITTDPKRRIAQHRGQLKGGAKALKGKSPLIFRAVFE-VADKAQAA  80

Query  264  AFETRWKQLSR  232
              E   KQ+SR
Sbjct  81   KLEYAVKQMSR  91



>sp|Q5TXB2.3|SLX1_ANOGA RecName: Full=Structure-specific endonuclease subunit SLX1 homolog 
[Anopheles gambiae]
Length=273

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 7/83 (8%)
 Frame = -3

Query  453  WSVYLILSTNPPIK----TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRG  289
            + VYL++S +P  K    TY+G T + +RR+K+HN GE  GGA+ +    PW    ++ G
Sbjct  11   YGVYLLVSKSPNPKFAGRTYIGYTVDPNRRIKQHNRGEDAGGARRTSNRGPWTMVLIVHG  70

Query  288  FMDRSEACAFETRWKQ--LSRKL  226
            F +   A  FE  W+Q  +SR+L
Sbjct  71   FPNNISALRFEWAWQQPRVSRRL  93



>gb|EXF49663.1| putative endonuclease containing a URI domain [Alteromonas sp. 
ALT199]
Length=118

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSEAC  265
            YL +  N   + Y G+TT+  RR+ +H G+LKGGAKA +   P I   +     D+++A 
Sbjct  25   YLYMVENKLGQIYTGITTDPKRRIAQHRGQLKGGAKALKGKSPLIFRAVFE-VADKAQAA  83

Query  264  AFETRWKQLSR  232
              E   KQ+SR
Sbjct  84   KLEYAVKQMSR  94



>ref|XP_002848911.1| GIY-YIG catalytic domain-containing protein [Arthroderma otae 
CBS 113480]
 gb|EEQ29026.1| GIY-YIG catalytic domain-containing protein [Arthroderma otae 
CBS 113480]
Length=395

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMD  280
            +  YL+ ST      Y+G T N +RRL +HNG +KGGA  +     RPW     + GF  
Sbjct  26   YCAYLLRSTVRHASLYIGSTPNPARRLAQHNGRIKGGAHRTHKEKLRPWEMVMTVSGFTS  85

Query  279  RSEACAFETRW  247
            R+ A  F++RW
Sbjct  86   RTGALQFDSRW  96



>gb|EME43420.1| hypothetical protein DOTSEDRAFT_174260 [Dothistroma septosporum 
NZE10]
Length=405

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMD  280
            ++ YL+ S       Y+G T N  RRLK+HNG+  GGAK  +  + RPW  +CL+ GF  
Sbjct  12   YACYLLRSIARHSSLYIGSTPNPPRRLKQHNGDAGGGAKRTSKDSLRPWEISCLVTGFPS  71

Query  279  RSEACAFETRWKQ  241
            +  A  FE  W+ 
Sbjct  72   KIAALQFEWAWQN  84



>ref|XP_002481886.1| GIY-YIG catalytic domain containing protein [Talaromyces stipitatus 
ATCC 10500]
 sp|B8MDD1.1|SLX1_TALSN RecName: Full=Structure-specific endonuclease subunit slx1 [Talaromyces 
stipitatus ATCC 10500]
 gb|EED17894.1| GIY-YIG catalytic domain containing protein [Talaromyces stipitatus 
ATCC 10500]
Length=389

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMDRSE  271
            YL+ S   P   Y+G T + +RRL++HNG  KGGAK +     RPW    ++ GF  R+ 
Sbjct  22   YLLRSAKRPSALYIGSTPDPARRLEQHNGFAKGGAKRTERNTLRPWEMVAIVEGFPSRTG  81

Query  270  ACAFETRWKQL  238
            A  FE  W+ +
Sbjct  82   ALQFEWSWQHV  92



>emb|CDH49839.1| structure-specific endonuclease subunit slx1 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=270

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 3/71 (4%)
 Frame = -3

Query  444  YLILSTNPP---IKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            YL+ S N P    + Y+G T +   RL++HNGE+  GAK +  GRPW     + GF + S
Sbjct  7    YLLRSLNLPRYHNRVYIGTTPDPVHRLRQHNGEIVQGAKKTENGRPWEMVMFVYGFPNDS  66

Query  273  EACAFETRWKQ  241
             A  FE  W+ 
Sbjct  67   FALQFEWAWQN  77



>ref|WP_038126070.1| hypothetical protein [Thiomicrospira pelophila]
Length=83

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 7/62 (11%)
 Frame = -3

Query  408  YVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGF---MDRSEACAFETRWKQL  238
            Y GVT N +RRLK+HNGEL GGAK +   RP      I+ F    +RS+A   E + KQL
Sbjct  10   YCGVTNNLARRLKQHNGELVGGAKYTATRRP----VEIKAFWPHPNRSQASQHEYQIKQL  65

Query  237  SR  232
            SR
Sbjct  66   SR  67



>ref|XP_002461708.1| hypothetical protein SORBIDRAFT_02g006850 [Sorghum bicolor]
 gb|EER98229.1| hypothetical protein SORBIDRAFT_02g006850 [Sorghum bicolor]
Length=386

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 44/87 (51%), Gaps = 2/87 (2%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRSE  271
            YL+ S  P  K  TY+G T N  RR+++HNGE+  GA  +R GRPW     I GF     
Sbjct  60   YLLRSLCPRSKSRTYIGFTVNPRRRIRQHNGEIVSGAWRTRRGRPWEMVLCIYGFPSNVA  119

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKL  190
            A  FE  W+  +  L  +    E + L
Sbjct  120  ALQFEWAWQHPTESLAVRKAAAEFKSL  146



>gb|EGD93010.1| GIY-YIG catalytic domain containing protein, partial [Trichophyton 
tonsurans CBS 112818]
Length=208

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = -3

Query  447  VYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAG--RPWICACLIRGFMDRS  274
            VYL+ S       Y+G T N +RRL +HNG +KGGA  +     RPW    ++ GF  R+
Sbjct  27   VYLLRSAVRHASLYIGSTPNPARRLAQHNGRIKGGAHRTHREKLRPWEMVMIVSGFTSRT  86

Query  273  EACAFETRWK  244
             A  FE  W+
Sbjct  87   AALQFEWAWQ  96



>ref|XP_010922708.1| PREDICTED: structure-specific endonuclease subunit SLX1 homolog 
2 [Elaeis guineensis]
Length=420

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S +P  K  TY+G T N  RR+++HNGE++ GA  ++ GRPW     I GF  
Sbjct  36   FACYLLCSLSPRHKGRTYIGFTVNPRRRIRQHNGEIRCGAWRTKRGRPWEMILCIYGFPS  95

Query  279  RSEACAFETRWKQLSRKL  226
               A  FE  W+     L
Sbjct  96   NVSALQFEWAWQHPKESL  113



>ref|WP_037338634.1| hypothetical protein, partial [Saccharospirillum impatiens]
Length=81

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMDRS  274
            W VYL+   +  +  Y G+TT+ +RRL++HNGEL GGA+ +R  RP +         DRS
Sbjct  4    WWVYLVQCVDGTL--YAGITTDLARRLRQHNGELVGGARYTRPRRP-VVLVYREACRDRS  60

Query  273  EACAFETRWKQLSR  232
             A   E   ++L+R
Sbjct  61   HAGQREAALRKLTR  74



>ref|XP_001393894.2| structure-specific endonuclease subunit slx1 [Aspergillus niger 
CBS 513.88]
Length=407

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T + +RRL +HNGE KGGA+  A    RPW    L+ GF  R  
Sbjct  19   YLLRSTKQRTSLYIGSTPHPARRLAQHNGESKGGARKTAKDDKRPWEMVLLVEGFTSRVG  78

Query  270  ACAFETRWK--QLSRKLPCKGKGNEEQK  193
            A  FE  W+  ++S + P      E  K
Sbjct  79   ALQFEWAWQNPRMSSQHPANRHHTEAGK  106



>gb|ADD38884.1| Structure-specific endonuclease subunit slx1 [Lepeophtheirus 
salmonis]
Length=251

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 3/71 (4%)
 Frame = -3

Query  444  YLILSTNPPIK--TYVGVTTNFSRRLKEHN-GELKGGAKASRAGRPWICACLIRGFMDRS  274
            YL++S NP  K   YVG T +  RRLK+HN G   GGA+ + A  PW    L++GF ++ 
Sbjct  14   YLLMSENPKYKGRMYVGFTVDPVRRLKQHNAGSAFGGARRTSAKGPWTMVLLVQGFPNQI  73

Query  273  EACAFETRWKQ  241
             A  FE  W+ 
Sbjct  74   SALRFEWAWQH  84



>ref|XP_457305.2| DEHA2B08030p [Debaryomyces hansenii CBS767]
 sp|Q6BWW4.2|SLX1_DEBHA RecName: Full=Structure-specific endonuclease subunit SLX1 [Debaryomyces 
hansenii CBS767]
 emb|CAG85309.2| DEHA2B08030p [Debaryomyces hansenii CBS767]
Length=346

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA--KASRAG-RPWICACLIRGFM  283
            + VYL+ S   P   Y+G T N  RRL++HNGELK G   +  ++G RPW   CL+  F 
Sbjct  24   YGVYLLRSVPKPKSFYIGSTPNPQRRLRQHNGELKNGGAYRTKKSGFRPWEMICLVYNFP  83

Query  282  DRSEACAFE  256
             ++ A  FE
Sbjct  84   SKNVALQFE  92



>dbj|GAA88241.1| GIY-YIG catalytic domain containing protein [Aspergillus kawachii 
IFO 4308]
Length=424

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T + +RRL +HNG+ KGGA+  A    RPW    L+ GF  R  
Sbjct  19   YLLRSTKQRTSLYIGSTPHPARRLAQHNGDSKGGARKTAKDDKRPWEMVLLVEGFTSRVA  78

Query  270  ACAFETRWKQLSRKLPCKGKGNEEQKLEET  181
            A  FE  W+  + K+  +   N  Q   ET
Sbjct  79   ALQFEWAWQ--NPKMSSQHPANRHQIDLET  106



>gb|KEH34436.1| endo/excinuclease amino terminal domain protein [Medicago truncatula]
Length=413

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            ++ YL+ S NP  K  TY+G T N  RR+++HNGE+  GA  ++  RPW     I GF  
Sbjct  50   FACYLLASLNPRFKGHTYIGFTVNPRRRIRQHNGEIGSGAWRTKKKRPWEMVLCIYGFPT  109

Query  279  RSEACAFETRWKQLSRKL  226
               A  FE  W+     L
Sbjct  110  NVAALQFEWAWQHPVESL  127



>gb|EER41154.1| GIY-YIG catalytic protein [Histoplasma capsulatum H143]
 gb|EGC47043.1| GIY-YIG catalytic domain-containing protein [Histoplasma capsulatum 
H88]
Length=421

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = -3

Query  444  YLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGAK--ASRAGRPWICACLIRGFMDRSE  271
            YL+ ST      Y+G T   SRRL +HNG+  GGA+  +S   RPW    ++ GFM+R+ 
Sbjct  18   YLLRSTVRHASLYIGSTPEPSRRLAQHNGDRTGGARKTSSEKLRPWEMVAIVSGFMNRAG  77

Query  270  ACAFETRWKQ  241
            A  FE  W+ 
Sbjct  78   ALQFEWAWQH  87



>ref|XP_004145233.1| PREDICTED: uncharacterized protein LOC101203492 [Cucumis sativus]
 ref|XP_004153269.1| PREDICTED: uncharacterized protein LOC101204996 [Cucumis sativus]
 ref|XP_004162709.1| PREDICTED: uncharacterized protein LOC101229010 [Cucumis sativus]
 gb|KGN65856.1| hypothetical protein Csa_1G533630 [Cucumis sativus]
Length=395

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIK--TYVGVTTNFSRRLKEHNGELKGGAKASRAGRPWICACLIRGFMD  280
            +S YL+ S  P  K  TY+G T N  RR+++HNGE++ GA  ++  RPW     I GF  
Sbjct  34   FSCYLLASACPRFKGHTYIGFTVNPKRRIRQHNGEIRCGAWRTKRKRPWEMVLCIYGFPT  93

Query  279  RSEACAFETRWKQLSRKL  226
               A  FE  W+  +  L
Sbjct  94   NVSALQFEWAWQHPNESL  111



>gb|EPE08502.1| giy-yig catalytic domain containing protein [Ophiostoma piceae 
UAMH 11346]
Length=465

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -3

Query  453  WSVYLILSTNPPIKTYVGVTTNFSRRLKEHNGELKGGA-KASRAG-RPWICACLIRGFMD  280
            ++VY++ ST      Y+G T +  RRLK+HNGE+KGGA + SRA  RPW     + GF  
Sbjct  39   YTVYVLRSTMRHASLYIGSTPDPPRRLKQHNGEMKGGAVRTSRASLRPWEMVAFVSGFPG  98

Query  279  RSEACAFE  256
               A  FE
Sbjct  99   SVAALKFE  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 972449972052