BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1379_g1_i1 len=484 path=[1:0-483]

Length=484
                                                                      Score     E

ref|XP_009120170.1|  PREDICTED: profilin-5                              156   7e-45   
ref|XP_002304225.1|  Profilin 3 family protein                          155   8e-45   Populus trichocarpa [western balsam poplar]
emb|CDY64971.1|  BnaAnng19920D                                          154   3e-44   
emb|CDY32870.1|  BnaC09g33170D                                          153   3e-44   
gb|EMS66850.1|  Profilin-2/4                                            154   6e-44   
ref|XP_011000942.1|  PREDICTED: profilin-3                              152   1e-43   
ref|XP_002299743.1|  Profilin 3 family protein                          151   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010526418.1|  PREDICTED: profilin                                151   2e-43   
ref|XP_010033829.1|  PREDICTED: profilin                                151   2e-43   
ref|NP_001234138.1|  profilin                                           151   2e-43   
gb|AEW90957.1|  pollen profilin 3R4-2                                   151   2e-43   
gb|AFK40156.1|  unknown                                                 151   3e-43   
sp|Q941H7.1|PROF_LITCN  RecName: Full=Profilin; AltName: Full=Min...    150   4e-43   Litchi chinensis [litchi]
ref|XP_003630698.1|  Profilin                                           150   4e-43   
gb|AFG16926.1|  profilin                                                150   4e-43   
gb|EMT25354.1|  Profilin-2/4                                            150   4e-43   
gb|AFG16923.1|  profilin                                                150   4e-43   
gb|ABB76134.1|  profilin 1                                              150   4e-43   Mangifera indica
sp|Q5EF31.1|PROF_CROSA  RecName: Full=Profilin; AltName: Full=Pol...    150   5e-43   Crocus sativus [saffron crocus]
gb|KDP40849.1|  hypothetical protein JCGZ_24848                         150   5e-43   
sp|A4GFC2.1|PROCF_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    150   6e-43   Olea europaea
ref|XP_004287490.1|  PREDICTED: profilin-like                           149   1e-42   
dbj|BAJ34266.1|  unnamed protein product                                149   1e-42   
gb|ABU95412.1|  Sin a 4 allergen                                        149   1e-42   
sp|A4KA41.1|PROF5_CORAV  RecName: Full=Profilin-5; AltName: Full=...    149   1e-42   Corylus avellana [European hazelnut]
gb|ABC02750.1|  profilin                                                149   2e-42   Litchi chinensis [litchi]
sp|P35079.1|PROF1_PHLPR  RecName: Full=Profilin-1; AltName: Full=...    149   2e-42   Phleum pratense [timothy]
gb|AFG16925.1|  profilin                                                149   2e-42   
sp|A4GFC4.1|PROCH_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    149   2e-42   Olea europaea
sp|O24650.1|PROF2_PHLPR  RecName: Full=Profilin-2; AltName: Full=...    149   2e-42   Phleum pratense [timothy]
sp|P0C0Y3.1|PROF_FRAAN  RecName: Full=Profilin; AltName: Allergen...    149   2e-42   Fragaria x ananassa
gb|AFG16922.1|  profilin                                                149   2e-42   
ref|XP_010267106.1|  PREDICTED: profilin-1                              149   2e-42   
gb|ABW37745.1|  Ama v 1.02 allergen                                     149   2e-42   Amaranthus viridis [bledo]
ref|XP_006353502.1|  PREDICTED: profilin-1-like                         148   3e-42   
ref|XP_006426857.1|  hypothetical protein CICLE_v10026756mg             148   3e-42   
gb|ADB93072.1|  profilin-1                                              148   4e-42   
sp|Q9XF38.1|PROF_PYRCO  RecName: Full=Profilin; AltName: Full=All...    148   4e-42   Pyrus communis
sp|O65812.1|PROF1_HEVBR  RecName: Full=Profilin-1; AltName: Full=...    148   5e-42   Hevea brasiliensis [jebe]
gb|KHG15153.1|  Profilin                                                148   5e-42   
gb|AIV43661.1|  profilin                                                147   6e-42   
ref|XP_004302848.1|  PREDICTED: profilin-like                           147   6e-42   
ref|XP_004291152.1|  PREDICTED: profilin-like                           147   7e-42   
ref|XP_009344483.1|  PREDICTED: profilin                                147   8e-42   
sp|Q9M7N0.1|PROF3_HEVBR  RecName: Full=Profilin-3; AltName: Full=...    147   8e-42   Hevea brasiliensis [jebe]
gb|ACV66156.2|  profilin                                                147   9e-42   Akebia trifoliata
gb|EPS59245.1|  profilin                                                147   1e-41   
dbj|BAK07752.1|  predicted protein                                      147   1e-41   
ref|XP_007223916.1|  hypothetical protein PRUPE_ppa013278mg             147   1e-41   
ref|XP_010541006.1|  PREDICTED: profilin-4                              147   1e-41   
gb|AFK38257.1|  unknown                                                 147   1e-41   
ref|XP_007202751.1|  hypothetical protein PRUPE_ppa013285mg             147   1e-41   
emb|CCP19647.1|  profilin allergen                                      147   1e-41   
gb|AFK47485.1|  unknown                                                 147   1e-41   
ref|XP_010495947.1|  PREDICTED: profilin-1-like                         147   1e-41   
ref|XP_006340251.1|  PREDICTED: profilin-like                           146   2e-41   
ref|XP_006284576.1|  hypothetical protein CARUB_v10005801mg             148   2e-41   
sp|A4KA33.1|PROF6_PHLPR  RecName: Full=Profilin-6; AltName: Full=...    146   2e-41   Phleum pratense [timothy]
ref|XP_010489132.1|  PREDICTED: profilin-1-like                         146   2e-41   
ref|XP_008337609.1|  PREDICTED: profilin-2                              146   2e-41   
gb|AAK01235.1|AF327622_1  minor allergen hazelnut profilin              146   2e-41   Corylus avellana [European hazelnut]
emb|CAK93713.1|  profilin                                               146   2e-41   Malus domestica [apple tree]
sp|A4GFB9.1|PROCD_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    146   2e-41   Olea europaea
gb|KCW79179.1|  hypothetical protein EUGRSUZ_C00615                     148   2e-41   
ref|XP_010541007.1|  PREDICTED: profilin-2                              146   2e-41   
ref|NP_001235595.1|  profilin                                           146   2e-41   
sp|Q84V37.1|PROF_CHEAL  RecName: Full=Profilin; AltName: Full=Min...    146   2e-41   Chenopodium album [lamb's-quarters]
ref|XP_007217879.1|  hypothetical protein PRUPE_ppa013277mg             146   2e-41   
ref|XP_004251645.1|  PREDICTED: profilin-1                              146   3e-41   
gb|AAX19855.1|  profilin 1                                              146   3e-41   Malus domestica [apple tree]
ref|XP_010483134.1|  PREDICTED: profilin-5                              146   3e-41   
ref|XP_002514199.1|  profilin, putative                                 146   3e-41   Ricinus communis
gb|AGA84056.1|  profilin                                                146   3e-41   
gb|KHF97992.1|  Profilin                                                145   3e-41   
gb|AAU81921.1|  profilin                                                145   3e-41   Arachis hypogaea [goober]
sp|Q93YI9.1|PROF_CAPAN  RecName: Full=Profilin; AltName: Full=Min...    145   3e-41   Capsicum annuum
emb|CAD46559.1|  profilin                                               145   3e-41   Malus domestica [apple tree]
sp|A4KA34.1|PROF7_PHLPR  RecName: Full=Profilin-7; AltName: Full=...    145   4e-41   Phleum pratense [timothy]
ref|XP_008233911.1|  PREDICTED: profilin-like                           145   4e-41   
ref|XP_006281613.1|  hypothetical protein CARUB_v10027731mg             146   4e-41   
gb|ADB96066.1|  profilin                                                145   4e-41   Arachis hypogaea [goober]
ref|XP_010047296.1|  PREDICTED: profilin                                145   4e-41   
ref|XP_006298806.1|  hypothetical protein CARUB_v10014910mg             145   5e-41   
ref|XP_009350242.1|  PREDICTED: profilin                                145   5e-41   
ref|XP_004503498.1|  PREDICTED: profilin-1-like                         145   6e-41   
sp|A4KA37.1|PROF9_PHLPR  RecName: Full=Profilin-9; AltName: Full=...    145   6e-41   Phleum pratense [timothy]
ref|XP_010536839.1|  PREDICTED: profilin-4                              145   7e-41   
sp|A4KA32.1|PROF5_PHLPR  RecName: Full=Profilin-5; AltName: Full=...    145   7e-41   Phleum pratense [timothy]
sp|Q8GT39.1|PROF_PRUPE  RecName: Full=Profilin; AltName: Allergen...    145   7e-41   Prunus persica
ref|XP_009628677.1|  PREDICTED: profilin-1                              145   8e-41   
ref|XP_008365251.1|  PREDICTED: profilin                                145   8e-41   
ref|XP_010447864.1|  PREDICTED: profilin-2-like                         145   8e-41   
sp|A4KA36.1|PROF8_PHLPR  RecName: Full=Profilin-8; AltName: Full=...    144   9e-41   Phleum pratense [timothy]
ref|XP_010668774.1|  PREDICTED: profilin-3                              144   9e-41   
gb|ACS34771.1|  Sal k 4 pollen allergen                                 144   9e-41   Kali turgidum [common saltwort]
gb|KHG29269.1|  Profilin-1                                              144   9e-41   
ref|XP_006655796.1|  PREDICTED: profilin LP04-like                      144   9e-41   
ref|XP_010688354.1|  PREDICTED: profilin                                144   1e-40   
ref|XP_010451283.1|  PREDICTED: profilin-5-like                         145   1e-40   
gb|AAX19857.1|  profilin 2                                              144   1e-40   Malus domestica [apple tree]
sp|A4KA43.1|PROF6_CORAV  RecName: Full=Profilin-6; AltName: Full=...    144   1e-40   Corylus avellana [European hazelnut]
gb|AAK01236.1|AF327623_1  minor allergen hazelnut profilin              144   1e-40   Corylus avellana [European hazelnut]
ref|XP_009796122.1|  PREDICTED: profilin-2                              144   1e-40   
ref|XP_008380843.1|  PREDICTED: profilin                                144   1e-40   
ref|XP_007012986.1|  Profilin 1 isoform 1                               144   1e-40   
gb|AFK47285.1|  unknown                                                 144   1e-40   
sp|A4KA38.1|PRO10_PHLPR  RecName: Full=Profilin-10; AltName: Full...    144   1e-40   Phleum pratense [timothy]
gb|ABA81885.1|  profilin-like                                           144   2e-40   Solanum tuberosum [potatoes]
gb|ABO43717.1|  profilin                                                144   2e-40   Gossypium hirsutum [American cotton]
gb|KFK27226.1|  hypothetical protein AALP_AA8G353900                    144   2e-40   
gb|AAX19859.1|  profilin 2                                              144   2e-40   Malus domestica [apple tree]
sp|A4KA50.1|PROCJ_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    144   2e-40   Olea europaea
sp|A4KA53.1|PROCM_OLEEU  RecName: Full=Profilin-8; AltName: Full=...    144   2e-40   Olea europaea
sp|A4KA52.1|PROCL_OLEEU  RecName: Full=Profilin-7; AltName: Full=...    144   2e-40   Olea europaea
ref|XP_004503499.1|  PREDICTED: profilin-like                           144   2e-40   
sp|A4KA49.1|PROCI_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    144   2e-40   Olea europaea
pdb|1G5U|A  Chain A, Latex Profilin Hevb8                               144   2e-40   
ref|XP_010416676.1|  PREDICTED: profilin-1-like                         144   2e-40   
pdb|4ESP|A  Chain A, Crystal Structure Of Peanut Allergen Ara H 5       144   2e-40   
ref|XP_003630696.1|  Profilin                                           144   2e-40   
sp|Q9STB6.1|PROF2_HEVBR  RecName: Full=Profilin-2; AltName: Full=...    144   2e-40   Hevea brasiliensis [jebe]
gb|AFK47224.1|  unknown                                                 144   2e-40   
sp|Q9LEI8.1|PROF6_HEVBR  RecName: Full=Profilin-6; AltName: Full=...    144   2e-40   Hevea brasiliensis [jebe]
sp|Q9M7M8.1|PROF5_HEVBR  RecName: Full=Profilin-5; AltName: Full=...    144   2e-40   Hevea brasiliensis [jebe]
ref|XP_002866157.1|  profilin-5                                         143   3e-40   
sp|A4KA45.1|PROF4_CORAV  RecName: Full=Profilin-4; AltName: Full=...    143   3e-40   Corylus avellana [European hazelnut]
sp|Q9XF42.1|PROF3_MALDO  RecName: Full=Profilin-3; AltName: Full=...    143   3e-40   Malus domestica [apple tree]
ref|XP_006853719.1|  hypothetical protein AMTR_s00056p00159630          143   3e-40   
ref|XP_002515952.1|  profilin, putative                                 143   3e-40   Ricinus communis
gb|ADL18409.1|  profilin                                                143   3e-40   
ref|XP_002274966.2|  PREDICTED: profilin-1                              145   3e-40   Vitis vinifera
ref|XP_010249472.1|  PREDICTED: profilin-1-like                         143   3e-40   
gb|AAP15200.1|  profilin-like protein                                   143   3e-40   Humulus scandens
emb|CDY68825.1|  BnaA01g34880D                                          143   3e-40   
emb|CAD37201.1|  profilin                                               143   3e-40   Prunus persica
ref|XP_010668781.1|  PREDICTED: profilin-3-like                         143   3e-40   
ref|XP_009367418.1|  PREDICTED: profilin-3-like                         143   3e-40   
sp|Q64LH1.1|PROF1_AMBAR  RecName: Full=Profilin-1; AltName: Full=...    143   3e-40   Ambrosia artemisiifolia [annual ragweed]
emb|CAK93753.1|  profilin                                               143   3e-40   Malus domestica [apple tree]
ref|XP_009128837.1|  PREDICTED: profilin-1                              143   3e-40   
ref|XP_008220131.1|  PREDICTED: profilin                                143   4e-40   
emb|CAN67015.1|  hypothetical protein VITISV_041272                     143   4e-40   Vitis vinifera
ref|XP_003525290.1|  PREDICTED: profilin-like                           143   4e-40   
sp|Q9XF41.1|PROF2_MALDO  RecName: Full=Profilin-2; AltName: Full=...    143   4e-40   Malus domestica [apple tree]
ref|XP_008447563.1|  PREDICTED: profilin-like                           143   4e-40   
ref|XP_010536838.1|  PREDICTED: profilin-like                           143   4e-40   
ref|XP_007012985.1|  Profilin 5                                         143   4e-40   
ref|NP_001275370.1|  profilin-like protein                              143   4e-40   
gb|AHL24658.1|  Sal k 4.03 allergen                                     143   4e-40   
emb|CAT99617.1|  profilin                                               143   4e-40   Malus domestica [apple tree]
sp|O24282.1|PROF3_PHLPR  RecName: Full=Profilin-3; AltName: Full=...    143   5e-40   Phleum pratense [timothy]
gb|AAX19853.1|  profilin 1                                              142   5e-40   Malus domestica [apple tree]
sp|Q9XF40.1|PROF1_MALDO  RecName: Full=Profilin-1; AltName: Full=...    142   5e-40   Malus domestica [apple tree]
ref|XP_004290829.1|  PREDICTED: profilin-3-like                         142   5e-40   
ref|XP_003564327.1|  PREDICTED: profilin-1                              142   5e-40   
emb|CDM84005.1|  unnamed protein product                                142   5e-40   
dbj|BAJ86041.1|  predicted protein                                      142   6e-40   
gb|EMS49855.1|  Profilin-2/4                                            142   6e-40   
sp|A4KA51.1|PROCK_OLEEU  RecName: Full=Profilin-6; AltName: Full=...    142   6e-40   Olea europaea
ref|XP_009352571.1|  PREDICTED: profilin-2                              142   6e-40   
ref|NP_179566.1|  profilin 1                                            142   6e-40   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M7M9.1|PROF4_HEVBR  RecName: Full=Profilin-4; AltName: Full=...    142   6e-40   Hevea brasiliensis [jebe]
ref|XP_003569765.1|  PREDICTED: profilin-2                              142   7e-40   
ref|XP_009415731.1|  PREDICTED: profilin-3                              142   7e-40   
ref|XP_007024334.1|  Profilin 5                                         142   7e-40   
ref|XP_004149180.1|  PREDICTED: profilin-like                           142   8e-40   
gb|KDP33777.1|  hypothetical protein JCGZ_07348                         142   8e-40   
ref|XP_002308591.1|  profilin 2 family protein                          142   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007204757.1|  hypothetical protein PRUPE_ppa013242mg             142   8e-40   
ref|XP_007204758.1|  hypothetical protein PRUPE_ppa013242mg             142   8e-40   
ref|XP_006451338.1|  hypothetical protein CICLE_v10009877mg             142   9e-40   
gb|EPS66446.1|  profilin                                                142   9e-40   
gb|AET05174.2|  profilin                                                142   9e-40   
sp|A4KA40.1|PROF2_CORAV  RecName: Full=Profilin-2; AltName: Full=...    142   1e-39   Corylus avellana [European hazelnut]
ref|XP_009102139.1|  PREDICTED: profilin-1                              142   1e-39   
gb|EMT00312.1|  Profilin-2/4                                            142   1e-39   
gb|KFK29496.1|  hypothetical protein AALP_AA7G141900                    142   1e-39   
sp|A4KA44.1|PROF3_CORAV  RecName: Full=Profilin-3; AltName: Full=...    142   1e-39   Corylus avellana [European hazelnut]
emb|CAD46560.1|  profilin                                               142   1e-39   Malus domestica [apple tree]
sp|A4KA39.1|PROF1_CORAV  RecName: Full=Profilin-1; AltName: Full=...    142   1e-39   Corylus avellana [European hazelnut]
gb|AHY24177.1|  profilin                                                142   1e-39   
sp|Q64LH2.1|PROF2_AMBAR  RecName: Full=Profilin-2; AltName: Full=...    142   1e-39   Ambrosia artemisiifolia [annual ragweed]
emb|CDP03236.1|  unnamed protein product                                142   1e-39   
ref|XP_010489131.1|  PREDICTED: profilin-4                              142   1e-39   
ref|XP_010915373.1|  PREDICTED: profilin isoform X2                     142   1e-39   
ref|XP_010548681.1|  PREDICTED: profilin                                142   1e-39   
ref|XP_009405220.1|  PREDICTED: profilin-1                              142   1e-39   
ref|XP_010267105.1|  PREDICTED: profilin-2                              141   1e-39   
gb|AAK59494.2|  putative profilin protein                               142   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21444.1|  hypothetical protein MIMGU_mgv1a016199mg                141   1e-39   
ref|XP_009112626.1|  PREDICTED: profilin-1-like                         141   1e-39   
gb|AAU43733.1|  profilin                                                141   2e-39   Citrullus lanatus [wild melon]
ref|XP_010416663.1|  PREDICTED: profilin-4-like                         141   2e-39   
ref|XP_006356135.1|  PREDICTED: profilin-1-like                         141   2e-39   
ref|XP_009602785.1|  PREDICTED: profilin-2                              141   2e-39   
ref|XP_009102137.1|  PREDICTED: profilin-4                              141   2e-39   
ref|XP_006853720.1|  hypothetical protein AMTR_s00056p00160320          141   2e-39   
sp|Q9FE63.1|PROF5_ARATH  RecName: Full=Profilin-5                       141   2e-39   Arabidopsis thaliana [mouse-ear cress]
sp|Q9XF39.1|PROF_PRUAV  RecName: Full=Profilin; AltName: Full=All...    141   2e-39   Prunus avium [gean]
ref|NP_200471.2|  profilin 3                                            142   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799778.1|  PREDICTED: profilin-1                              141   2e-39   
sp|Q9XF37.1|PROF_APIGR  RecName: Full=Profilin; AltName: Full=Min...    141   2e-39   Apium graveolens
ref|XP_011005518.1|  PREDICTED: profilin-6-like                         141   2e-39   
sp|Q9SNW7.1|PROF1_LILLO  RecName: Full=Profilin-1                       141   2e-39   Lilium longiflorum [Easter lily]
ref|NP_179567.1|  profilin 5                                            141   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451339.1|  hypothetical protein CICLE_v10009871mg             141   3e-39   
ref|XP_007223783.1|  hypothetical protein PRUPE_ppa010614mg             144   3e-39   
sp|A4K9Z8.1|PROF2_BETPN  RecName: Full=Profilin-2; AltName: Full=...    141   3e-39   Betula pendula [white birch]
gb|ABK28500.1|  unknown                                                 141   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ABP58623.1|  pollen allergen Ole e 2                                 140   3e-39   Olea europaea
ref|XP_002514198.1|  profilin, putative                                 140   3e-39   Ricinus communis
ref|XP_011081736.1|  PREDICTED: profilin                                140   3e-39   
sp|O49894.1|PROF_MERAN  RecName: Full=Profilin; AltName: Full=Pol...    140   3e-39   Mercurialis annua [annual mercury]
ref|XP_008795502.1|  PREDICTED: profilin-1-like                         140   3e-39   
ref|XP_010098156.1|  hypothetical protein L484_026290                   140   3e-39   
gb|ACA49387.1|  putative actin- and phospholipid-binding protein        140   3e-39   Gerbera hybrid cultivar
gb|ACP43298.1|  Ama r 2 pollen allergen                                 140   3e-39   Amaranthus retroflexus [common amaranth]
ref|XP_010047663.1|  PREDICTED: profilin-1-like                         140   3e-39   
ref|XP_008242467.1|  PREDICTED: profilin-4                              140   3e-39   
ref|NP_001056833.1|  Os06g0152100                                       140   4e-39   Oryza sativa Japonica Group [Japonica rice]
emb|CAK93757.1|  profilin                                               140   4e-39   Malus domestica [apple tree]
ref|XP_003620753.1|  Profilin                                           140   4e-39   
ref|XP_003568071.1|  PREDICTED: profilin-2-like                         140   4e-39   
gb|AIV43662.1|  profilin                                                140   4e-39   
pdb|1CQA|A  Chain A, Birch Pollen Profilin                              140   4e-39   
gb|AFK33983.1|  unknown                                                 140   4e-39   
ref|XP_010925517.1|  PREDICTED: profilin-1-like                         142   4e-39   
ref|XP_007152957.1|  hypothetical protein PHAVU_004G174400g             140   4e-39   
ref|XP_011019559.1|  PREDICTED: profilin                                140   4e-39   
ref|XP_002283490.1|  PREDICTED: profilin-1                              140   4e-39   Vitis vinifera
ref|XP_003564682.1|  PREDICTED: profilin-2                              140   5e-39   
emb|CAD46561.1|  profilin                                               140   5e-39   Malus domestica [apple tree]
ref|XP_010914952.1|  PREDICTED: profilin-1                              140   5e-39   
gb|KFK40342.1|  hypothetical protein AALP_AA3G361600                    140   5e-39   
ref|XP_010433105.1|  PREDICTED: profilin-2                              140   5e-39   
ref|XP_008798583.1|  PREDICTED: profilin-1                              140   6e-39   
gb|KFK40340.1|  hypothetical protein AALP_AA3G361400                    140   6e-39   
emb|CDY35886.1|  BnaA07g01010D                                          140   6e-39   
emb|CAD92666.1|  profilin                                               140   7e-39   Cucumis melo [Oriental melon]
emb|CDX81945.1|  BnaC08g36560D                                          140   7e-39   
gb|ABD62998.1|  profilin 2                                              139   8e-39   Mangifera indica
ref|XP_010249471.1|  PREDICTED: profilin-like                           139   8e-39   
ref|XP_007160275.1|  hypothetical protein PHAVU_002G307600g             139   8e-39   
ref|XP_009112628.1|  PREDICTED: profilin-4-like                         140   8e-39   
ref|XP_009387128.1|  PREDICTED: profilin-A-like                         139   8e-39   
sp|P84177.2|PROF1_CITSI  RecName: Full=Profilin; AltName: Allerge...    139   8e-39   Citrus sinensis [apfelsine]
ref|XP_009591293.1|  PREDICTED: profilin-2                              139   9e-39   
ref|XP_002883972.1|  hypothetical protein ARALYDRAFT_480492             139   9e-39   
ref|XP_006584806.1|  PREDICTED: profilin-like                           139   9e-39   
ref|XP_010254422.1|  PREDICTED: profilin-like                           139   9e-39   
gb|AFK47381.1|  unknown                                                 139   9e-39   
ref|XP_002436493.1|  hypothetical protein SORBIDRAFT_10g003670          139   9e-39   Sorghum bicolor [broomcorn]
sp|A4GDU0.1|PROBJ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    139   1e-38   Olea europaea
sp|A4GFC3.1|PROCG_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    139   1e-38   Olea europaea
sp|A4GDU5.1|PROBM_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    139   1e-38   Olea europaea
ref|XP_009405712.1|  PREDICTED: profilin-1-like                         139   1e-38   
sp|Q9ST99.1|PROF2_TOBAC  RecName: Full=Profilin-2; AltName: Full=...    139   1e-38   Nicotiana tabacum [American tobacco]
sp|A4GDQ6.1|PROAK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    139   1e-38   Olea europaea
sp|A4GDR4.1|PROAU_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    139   1e-38   Olea europaea
sp|A4GDU2.1|PROBK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    139   1e-38   Olea europaea
gb|EPS71087.1|  profilin                                                139   1e-38   
ref|XP_004241753.1|  PREDICTED: profilin-1-like                         139   1e-38   
sp|A4GFC0.1|PROCE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    139   1e-38   Olea europaea
ref|XP_006583560.1|  PREDICTED: profilin-like                           139   1e-38   
sp|A4GD54.1|PROFY_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    139   1e-38   Olea europaea
ref|XP_010095450.1|  hypothetical protein L484_005874                   139   1e-38   
gb|KHM99817.1|  Profilin-1                                              139   1e-38   
ref|XP_002283450.1|  PREDICTED: profilin-1                              139   1e-38   Vitis vinifera
sp|A4GE47.1|PROBT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    139   2e-38   Olea europaea
ref|XP_004513067.1|  PREDICTED: profilin-like                           139   2e-38   
ref|NP_001288607.1|  uncharacterized protein LOC103711216               139   2e-38   
sp|P0DKE3.1|PROFV_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    139   2e-38   
ref|XP_010924449.1|  PREDICTED: profilin-1-like                         139   2e-38   
ref|NP_001233973.1|  profilin-2                                         139   2e-38   
sp|O65809.1|PROF1_SOYBN  RecName: Full=Profilin-1; AltName: Full=...    139   2e-38   Glycine max [soybeans]
emb|CAB61833.1|  profilin                                               139   2e-38   Nicotiana tabacum [American tobacco]
emb|CDY11912.1|  BnaC03g13380D                                          139   2e-38   
ref|NP_001237519.1|  profilin                                           139   2e-38   
emb|CDY03342.1|  BnaC09g10060D                                          139   2e-38   
ref|XP_009389901.1|  PREDICTED: profilin-like isoform X2                139   2e-38   
ref|XP_008799779.1|  PREDICTED: profilin-2                              139   2e-38   
ref|XP_009389900.1|  PREDICTED: profilin-like isoform X1                139   2e-38   
ref|XP_009117522.1|  PREDICTED: profilin-1-like                         138   2e-38   
ref|XP_002869438.1|  PFN2/PRF2/PRO2                                     138   2e-38   
ref|XP_003516387.1|  PREDICTED: profilin-like                           139   2e-38   
ref|XP_007012197.1|  Profilin 5 isoform 2                               139   2e-38   
ref|NP_001104885.1|  profilin-4                                         138   2e-38   
ref|XP_002883973.1|  PFN1/PRF1                                          138   2e-38   
ref|NP_001105622.1|  profilin-5                                         138   3e-38   
sp|Q8SAE6.1|PROF_DAUCA  RecName: Full=Profilin; AltName: Full=Min...    138   3e-38   
ref|XP_011072445.1|  PREDICTED: profilin                                138   3e-38   
ref|XP_009400573.1|  PREDICTED: profilin-A                              138   3e-38   
ref|XP_006299812.1|  hypothetical protein CARUB_v10016013mg             138   3e-38   
ref|NP_001233869.1|  profilin-1                                         138   3e-38   
sp|A4GE42.1|PROBQ_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    138   3e-38   
sp|P0DKG1.1|PROCC_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    138   3e-38   
ref|XP_007160274.1|  hypothetical protein PHAVU_002G307500g             138   3e-38   
gb|KHG22026.1|  Profilin                                                138   3e-38   
ref|XP_009389903.1|  PREDICTED: profilin-like isoform X4                138   3e-38   
sp|P41372.1|PROF1_TOBAC  RecName: Full=Profilin-1                       138   3e-38   
ref|XP_009395053.1|  PREDICTED: profilin-1-like                         138   4e-38   
sp|A4GFB7.1|PROCA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    138   4e-38   
ref|XP_010914972.1|  PREDICTED: profilin-2                              138   4e-38   
ref|XP_006661691.1|  PREDICTED: profilin-A-like                         138   4e-38   
ref|XP_009789538.1|  PREDICTED: profilin-1                              138   4e-38   
ref|XP_002324161.1|  profilin 2 family protein                          138   4e-38   
ref|XP_008458981.1|  PREDICTED: profilin-4                              138   4e-38   
gb|AEC10960.1|  profilin 2                                              137   4e-38   
ref|XP_009389902.1|  PREDICTED: profilin-like isoform X3                138   4e-38   
ref|NP_001064348.1|  Os10g0323600                                       137   5e-38   
sp|A4GE45.1|PROBS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    137   5e-38   
ref|XP_008337608.1|  PREDICTED: profilin-4                              137   5e-38   
ref|XP_009352573.1|  PREDICTED: profilin-4                              137   6e-38   
sp|A4GD58.1|PROAJ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    137   6e-38   
ref|NP_001284474.1|  profilin                                           137   6e-38   
sp|P0DKE1.1|PROFS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    137   6e-38   
sp|A4GD56.1|PROAA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    137   6e-38   
sp|A4GCR7.1|PROFP_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    137   6e-38   
ref|XP_008458990.1|  PREDICTED: profilin                                137   6e-38   
sp|O24171.1|PROFC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    137   6e-38   
gb|AHL24660.1|  Fra e 2.01 allergen                                     137   7e-38   
ref|XP_004141027.1|  PREDICTED: profilin-like                           137   7e-38   
sp|A4GE44.1|PROBR_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    137   7e-38   
sp|O24170.1|PROFB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    137   7e-38   
sp|A4GCR8.1|PROFQ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    137   8e-38   
sp|Q9SQI9.1|PROF_ARAHY  RecName: Full=Profilin; AltName: Allergen...    137   8e-38   
sp|P25816.1|PROF1_BETPN  RecName: Full=Profilin-1; AltName: Full=...    137   8e-38   
ref|XP_009137845.1|  PREDICTED: profilin-3-like                         137   8e-38   
sp|O24169.1|PROFA_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    137   8e-38   
gb|ABW17183.1|  profilin                                                137   8e-38   
ref|XP_009117521.1|  PREDICTED: profilin-4-like                         137   9e-38   
sp|A4GE38.1|PROBO_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    137   9e-38   
sp|A4GDR7.1|PROAW_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    137   9e-38   
sp|P0DKE4.1|PROFW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    137   9e-38   
ref|XP_009128846.1|  PREDICTED: profilin-3                              137   9e-38   
sp|A4GDR6.1|PROAV_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    137   9e-38   
gb|ABC61055.1|  profilin-like protein                                   137   9e-38   
gb|AAQ63003.1|  oil palm profilin-like allergen PF3                     137   9e-38   
sp|A4GCR6.1|PROFF_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    137   1e-37   
ref|NP_194664.1|  profilin 2                                            137   1e-37   
ref|XP_003546590.1|  PREDICTED: profilin-4-like                         137   1e-37   
sp|A4GDR8.1|PROAX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    137   1e-37   
ref|XP_004157894.1|  PREDICTED: profilin-like                           137   1e-37   
gb|ACG33212.1|  profilin-2                                              137   1e-37   
ref|XP_004961445.1|  PREDICTED: profilin-A-like                         137   1e-37   
gb|AAQ63001.1|  oil palm profilin-like allergen PF1                     137   1e-37   
ref|XP_002441408.1|  hypothetical protein SORBIDRAFT_09g026120          136   1e-37   
gb|ABP35953.1|  profillin                                               137   1e-37   
gb|AAM63638.1|  profilin 2                                              136   1e-37   
gb|AAQ63002.1|  oil palm profilin-like allergen PF2                     136   1e-37   
ref|XP_002456332.1|  hypothetical protein SORBIDRAFT_03g034110          136   1e-37   
gb|ABK22288.1|  unknown                                                 136   2e-37   
gb|ABW17184.1|  profilin                                                136   2e-37   
gb|KFK29491.1|  hypothetical protein AALP_AA7G141400                    136   2e-37   
sp|A4GDQ8.1|PROAL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    136   2e-37   
emb|CDY62034.1|  BnaC03g77670D                                          136   2e-37   
ref|XP_009404548.1|  PREDICTED: profilin-like                           136   2e-37   
ref|XP_006661690.1|  PREDICTED: profilin-A-like                         136   2e-37   
gb|EYU27249.1|  hypothetical protein MIMGU_mgv1a016111mg                136   2e-37   
gb|EYU20403.1|  hypothetical protein MIMGU_mgv1a016186mg                135   2e-37   
ref|XP_007160276.1|  hypothetical protein PHAVU_002G307700g             135   3e-37   
sp|A4GE39.1|PROBP_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    135   3e-37   
ref|XP_004287491.1|  PREDICTED: profilin-like                           135   3e-37   
gb|AAW84279.1|  profilin 5                                              135   3e-37   
ref|XP_004964829.1|  PREDICTED: profilin LP04-like                      135   3e-37   
gb|AAW84276.1|  profilin 2                                              135   3e-37   
ref|XP_003630699.1|  Profilin                                           134   3e-37   
sp|A4GDR1.1|PROAS_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    135   3e-37   
sp|A4GDT5.1|PROBH_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    135   3e-37   
dbj|BAK02673.1|  predicted protein                                      135   3e-37   
ref|XP_008794098.1|  PREDICTED: profilin-like                           135   4e-37   
sp|A4GDR9.1|PROAY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    135   4e-37   
sp|P0DKF4.1|PROAM_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    135   4e-37   
gb|EMT03530.1|  Profilin                                                135   4e-37   
gb|AAP15198.1|  profilin-like protein                                   135   4e-37   
gb|ACV50427.1|  profilin-like protein                                   135   4e-37   
gb|AAP42151.3|  profilin                                                135   4e-37   
emb|CDM81724.1|  unnamed protein product                                135   4e-37   
sp|A4GDT1.1|PROBE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    135   4e-37   
sp|A4GDS0.1|PROAZ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    135   4e-37   
ref|XP_009409369.1|  PREDICTED: profilin-like                           135   4e-37   
ref|XP_006284736.1|  hypothetical protein CARUB_v10005999mg             135   4e-37   
dbj|BAK06398.1|  predicted protein                                      135   5e-37   
sp|Q9FUB8.1|PROF_BRANA  RecName: Full=Profilin                          135   5e-37   
gb|AAG10088.1|U43591_1  profilin                                        135   5e-37   
gb|ABU97473.1|  profilin                                                135   5e-37   
ref|XP_010438310.1|  PREDICTED: profilin-3-like                         135   5e-37   
sp|A4GE48.1|PROBU_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    135   5e-37   
ref|XP_009392682.1|  PREDICTED: profilin                                135   5e-37   
emb|CDX88579.1|  BnaA03g10700D                                          135   5e-37   
gb|AAW84278.1|  profilin 4                                              135   5e-37   
gb|AAO41991.1|  putative profilin 3                                     135   5e-37   
gb|AGN33441.1|  profilin                                                135   5e-37   
ref|XP_004141028.1|  PREDICTED: profilin-like                           135   5e-37   
sp|A4KA55.1|PROF6_MAIZE  RecName: Full=Profilin-6; AltName: Full=...    135   5e-37   
ref|NP_001105452.1|  profilin-3                                         135   6e-37   
gb|AEW90958.1|  profilin R2-2                                           135   6e-37   
gb|ABK27012.1|  unknown                                                 135   6e-37   
ref|NP_001105450.1|  profilin-1                                         135   6e-37   
ref|NP_194663.1|  profilin 4                                            135   6e-37   
ref|XP_007012196.1|  Profilin 5 isoform 1                               135   6e-37   
ref|XP_008795503.1|  PREDICTED: profilin-2-like                         135   6e-37   
sp|A4GCR5.1|PROFE_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    135   7e-37   
ref|XP_006645591.1|  PREDICTED: LOW QUALITY PROTEIN: profilin-like      134   7e-37   
sp|A4GE50.1|PROBW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    135   7e-37   
gb|EYU30692.1|  hypothetical protein MIMGU_mgv1a016198mg                134   7e-37   
gb|AFW85126.1|  profilin 3, mRNA                                        135   7e-37   
ref|XP_009109044.1|  PREDICTED: profilin                                134   7e-37   
sp|A4GDT3.1|PROBF_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    134   9e-37   
ref|XP_011078237.1|  PREDICTED: profilin-3                              134   9e-37   
sp|A4GD50.1|PROFT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    134   1e-36   
ref|XP_009399807.1|  PREDICTED: profilin-like                           134   1e-36   
ref|NP_001236192.1|  profilin-2                                         134   1e-36   
ref|XP_004969894.1|  PREDICTED: profilin-A-like                         134   1e-36   
ref|XP_011093655.1|  PREDICTED: profilin-3-like                         134   1e-36   
sp|A4GE49.1|PROBV_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    134   1e-36   
gb|KHM99818.1|  Profilin                                                134   1e-36   
gb|ABM53028.1|  profilin                                                134   1e-36   
ref|XP_002869439.1|  hypothetical protein ARALYDRAFT_328774             134   1e-36   
ref|XP_009757178.1|  PREDICTED: profilin-3-like                         134   1e-36   
gb|AFW85125.1|  profilin-3                                              134   1e-36   
gb|ABW17185.1|  profilin                                                134   1e-36   
gb|ABW37744.1|  Ama v 1.01 allergen                                     134   1e-36   
sp|A4GDU6.1|PROBN_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    134   1e-36   
gb|ADK35122.1|  profilin                                                134   1e-36   
sp|Q9ST98.1|PROF3_TOBAC  RecName: Full=Profilin-3                       134   1e-36   
sp|A4GDS6.1|PROBA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    134   2e-36   
sp|Q94JN3.1|PROF_MUSAC  RecName: Full=Profilin; AltName: Full=Min...    134   2e-36   
sp|A4GDS7.1|PROBB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    134   2e-36   
sp|O81982.1|PROF_HELAN  RecName: Full=Profilin; AltName: Full=Pol...    134   2e-36   
gb|ABP58621.1|  pollen allergen Ole e 2                                 134   2e-36   
sp|A4GDU3.1|PROBL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    134   2e-36   
sp|A4GE53.1|PROBX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    134   2e-36   
sp|P0DKE6.1|PROAB_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    134   2e-36   
sp|A4GE55.1|PROBZ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    134   2e-36   
ref|XP_010924448.1|  PREDICTED: profilin-2-like                         133   2e-36   
pdb|3NUL|A  Chain A, Profilin I From Arabidopsis Thaliana               133   2e-36   
gb|ABM53030.1|  profilin                                                133   2e-36   
sp|A4GD55.1|PROFZ_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    133   2e-36   
gb|ABW17190.1|  profilin                                                133   2e-36   
gb|ABW17187.1|  profilin                                                133   2e-36   
gb|KHN16653.1|  Profilin-1                                              133   3e-36   
ref|NP_001235025.1|  uncharacterized protein LOC100499717               133   3e-36   
gb|AAW84277.1|  profilin 3                                              133   3e-36   
sp|Q94JN2.1|PROF_ANACO  RecName: Full=Profilin; AltName: Full=Min...    132   4e-36   
ref|XP_011078238.1|  PREDICTED: profilin-3-like                         132   4e-36   
sp|A4GDT0.1|PROBD_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    132   4e-36   
gb|AAW84275.1|  profilin 1                                              132   4e-36   
ref|XP_009777310.1|  PREDICTED: profilin-3                              132   4e-36   
ref|XP_010033714.1|  PREDICTED: profilin-like                           132   4e-36   
sp|A4GDT9.1|PROBI_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    132   5e-36   
gb|ADK22841.1|  Sal k 4.02                                              132   5e-36   
sp|A4GE54.1|PROBY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    132   7e-36   
ref|NP_001288512.1|  profilin-7                                         132   7e-36   
sp|A4GDR3.1|PROAT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    132   7e-36   
gb|ACN36779.1|  unknown                                                 132   7e-36   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                143   7e-36   
ref|XP_009413861.1|  PREDICTED: profilin-like                           132   8e-36   
ref|XP_009132193.1|  PREDICTED: LOW QUALITY PROTEIN: profilin-5-like    133   8e-36   
gb|ABM53029.1|  profilin                                                131   1e-35   
sp|P52184.1|PROF1_HORVU  RecName: Full=Profilin-1                       131   1e-35   
sp|Q9XG85.1|PROF1_PARJU  RecName: Full=Profilin-1; AltName: Full=...    131   1e-35   
emb|CDP08197.1|  unnamed protein product                                131   1e-35   
ref|XP_010915371.1|  PREDICTED: profilin-like                           131   2e-35   
sp|A4KA59.1|PRO10_MAIZE  RecName: Full=Profilin-10; AltName: Full...    131   2e-35   
ref|NP_001106002.1|  profilin-9                                         131   2e-35   
gb|ACE82291.1|  profilin                                                131   2e-35   
emb|CDP03238.1|  unnamed protein product                                131   2e-35   
ref|XP_009586833.1|  PREDICTED: profilin-like                           130   2e-35   
gb|ABQ23999.1|  pollen-specific profilin3                               130   3e-35   
sp|O04725.1|PROF_CYNDA  RecName: Full=Profilin; AltName: Full=Pol...    130   3e-35   
gb|KDO51830.1|  hypothetical protein CISIN_1g032890mg                   129   3e-35   
emb|CAQ57979.1|  profilin                                               130   3e-35   
sp|A4KA61.1|PRO12_MAIZE  RecName: Full=Profilin-12; AltName: Full...    130   3e-35   
ref|XP_008794097.1|  PREDICTED: profilin-like                           130   4e-35   
ref|NP_001105987.1|  profilin-7                                         130   4e-35   
ref|XP_009622655.1|  PREDICTED: profilin-3                              130   5e-35   
sp|A4GDT4.1|PROBG_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    130   5e-35   
sp|Q64LH0.1|PROF3_AMBAR  RecName: Full=Profilin-3; AltName: Full=...    130   5e-35   
sp|Q9T0M8.1|PROF2_PARJU  RecName: Full=Profilin-2; AltName: Full=...    130   5e-35   
gb|EYU30693.1|  hypothetical protein MIMGU_mgv1a016198mg                129   5e-35   
sp|A4GDS9.1|PROBC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    130   6e-35   
ref|XP_006426856.1|  hypothetical protein CICLE_v10026756mg             129   6e-35   
sp|Q9SNW6.1|PROF2_LILLO  RecName: Full=Profilin-2                       129   6e-35   
ref|XP_010526419.1|  PREDICTED: profilin-4-like                         130   6e-35   
ref|XP_010049601.1|  PREDICTED: profilin-2                              129   8e-35   
sp|P49232.2|PROF1_WHEAT  RecName: Full=Profilin-1                       129   8e-35   
gb|AAX77687.1|  profilin isoallergen 1                                  129   8e-35   
gb|AAD21619.1|  putative profilin                                       129   9e-35   
sp|A4KA60.1|PRO11_MAIZE  RecName: Full=Profilin-11; AltName: Full...    129   9e-35   
ref|NP_001105451.1|  profilin-2                                         129   1e-34   
sp|P49233.2|PROF2_WHEAT  RecName: Full=Profilin-2                       129   1e-34   
gb|KHG23640.1|  Profilin-3                                              129   1e-34   
gb|AAO92742.1|  profilin                                                129   2e-34   
gb|ABF60824.1|  leaf profilin                                           127   2e-34   
sp|Q8H2C9.3|PROF1_ARTVU  RecName: Full=Profilin-1; AltName: Full=...    128   2e-34   
sp|Q9SNW5.1|PROF3_LILLO  RecName: Full=Profilin-3                       128   2e-34   
sp|P49234.2|PROF3_WHEAT  RecName: Full=Profilin-3                       128   3e-34   
ref|XP_010925516.1|  PREDICTED: profilin-1-like                         128   3e-34   
ref|XP_010688357.1|  PREDICTED: profilin-like                           127   4e-34   



>ref|XP_009120170.1| PREDICTED: profilin-5 [Brassica rapa]
Length=155

 Score =   156 bits (394),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  SKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
             KMSWQTYVD+HLMCD+EGN+L+AAAILG DGSVWAQSANFPQ+ P EI+ I KDF+EPG
Sbjct  23   RKMSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFNEPG  82

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+ I G KYMVIQGEP  V+RGKKG GG+ IKKTTQ ++FG+Y+EPMTP
Sbjct  83   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTP  136



>ref|XP_002304225.1| Profilin 3 family protein [Populus trichocarpa]
 ref|XP_011011002.1| PREDICTED: profilin-4 [Populus euphratica]
 ref|XP_011015508.1| PREDICTED: profilin-4 [Populus euphratica]
 gb|ABK93735.1| unknown [Populus trichocarpa]
 gb|EEE79204.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   155 bits (391),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN L+AAAI+G DGSVWAQSA FPQ  P EI++I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTAAAIIGQDGSVWAQSATFPQYKPEEISAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+HI G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHIGGTKYMVIQGEPGAVIRGKKGSGGITVKKTAQALIFGIYDEPLTP  112



>emb|CDY64971.1| BnaAnng19920D [Brassica napus]
Length=131

 Score =   154 bits (388),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L+AAAILG DGSVWAQSANFPQ+ P EI+ I KDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ I G KYMVIQGEP  V+RGKKG GG+ IKKTTQ ++FG+Y+EPMTP
Sbjct  61   APTGLFIGGTKYMVIQGEPNTVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTP  112



>emb|CDY32870.1| BnaC09g33170D [Brassica napus]
Length=131

 Score =   153 bits (387),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L+AAAILG DGSVWAQSANFPQ+ P EI  I KDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEINGINKDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ I G KYMVIQGEP  V+RGKKG GG+ IKKTTQ ++FG+Y+EPMTP
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTP  112



>gb|EMS66850.1| Profilin-2/4 [Triticum urartu]
Length=167

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  349  KISKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDE  170
            + +KMSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FPQ +PAEIT+I+KDFDE
Sbjct  33   RPAKMSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITAIMKDFDE  92

Query  169  PGSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            PG LAPTGM ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G Y+EPMTP
Sbjct  93   PGHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGAYEEPMTP  148



>ref|XP_011000942.1| PREDICTED: profilin-3 [Populus euphratica]
Length=131

 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L+AAAI+G DGSVWAQSA FPQ  P EI++I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTAAAIIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GG+ +KKT+Q L+ GLYDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTSQALVIGLYDEPLTP  112



>ref|XP_002299743.1| Profilin 3 family protein [Populus trichocarpa]
 gb|ABK95977.1| unknown [Populus trichocarpa]
 gb|EEE84548.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L+AAAI+G DGSVWAQSA FPQ  P EI++I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTAAAIIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GG+ +KKT+Q L+ GLYDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTSQALVIGLYDEPLTP  112



>ref|XP_010526418.1| PREDICTED: profilin [Tarenaya hassleriana]
Length=131

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN LSAAAILG DGSVWAQS+NFPQ  P EIT+I+KDFDEPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNCLSAAAILGQDGSVWAQSSNFPQFKPEEITAIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKGPGG+ IKKTTQ L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTQALVIGIYDEPMTP  112



>ref|XP_010033829.1| PREDICTED: profilin [Eucalyptus grandis]
 gb|KCW53663.1| hypothetical protein EUGRSUZ_J02930 [Eucalyptus grandis]
Length=131

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G+ L+AAAI+G DGSVWAQS+ FPQ  P EI +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHHLAAAAIVGHDGSVWAQSSAFPQFKPQEIAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H++GAKYMVIQGE G V+RGKKG GG+ +KKTTQ L+FG+Y+EP+TP
Sbjct  61   APTGLHLAGAKYMVIQGEDGAVIRGKKGAGGVTVKKTTQALIFGIYEEPLTP  112



>ref|NP_001234138.1| profilin [Solanum lycopersicum]
 ref|XP_010313200.1| PREDICTED: profilin isoform X1 [Solanum lycopersicum]
 gb|AAL29690.1| profilin [Solanum lycopersicum]
Length=131

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN L++AAI+G DGSVWAQSANFPQ  P EIT+I+ DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTP  112



>gb|AEW90957.1| pollen profilin 3R4-2 [Secale cereale x Triticum turgidum subsp. 
durum]
Length=131

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FPQ +PAEIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+Y+EPMTP
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGVYEEPMTP  112



>gb|AFK40156.1| unknown [Medicago truncatula]
Length=131

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+CDIEGN L+ AAILG+DGSVWAQSANFPQ  P EI++I KDFDEPG+L
Sbjct  1    MSWQTYVDDHLLCDIEGNHLTHAAILGVDGSVWAQSANFPQFKPEEISAINKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+HI G KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLHIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTP  112



>sp|Q941H7.1|PROF_LITCN RecName: Full=Profilin; AltName: Full=Minor allergen Lit c 1; 
AltName: Allergen=Lit c 1 [Litchi chinensis]
 gb|AAL07320.1| profilin [Litchi chinensis]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+ +G  L+AAAI+G DGSVWAQSANFPQ  PAEI +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGGI +KKTTQ L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTP  112



>ref|XP_003630698.1| Profilin [Medicago truncatula]
 gb|ACJ83967.1| unknown [Medicago truncatula]
 gb|ACJ86124.1| unknown [Medicago truncatula]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+CDIEGN L+ AAILG+DGSVWAQSANFPQ  P EI +I KDFDEPG+L
Sbjct  1    MSWQTYVDDHLLCDIEGNHLTHAAILGVDGSVWAQSANFPQFKPEEINAINKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+HI G KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLHIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTP  112



>gb|AFG16926.1| profilin [Quercus suber]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>gb|EMT25354.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FPQ +PAEIT+I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITAIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G Y+EPMTP
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGAYEEPMTP  112



>gb|AFG16923.1| profilin [Quercus suber]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>gb|ABB76134.1| profilin 1 [Mangifera indica]
Length=131

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMCDIEG+ L+AAAI+GLDGSVWAQSANFP+++P EIT+I KDFDEPGSL
Sbjct  1    MSWQAYVDEHLMCDIEGHHLTAAAIVGLDGSVWAQSANFPKLNPEEITAINKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGG+ +KKT    + G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMAFVIGIYDEPMTP  112



>sp|Q5EF31.1|PROF_CROSA RecName: Full=Profilin; AltName: Full=Pollen allergen Cro s 1; 
AltName: Allergen=Cro s 1 [Crocus sativus]
 gb|AAW81034.1| profilin [Crocus sativus]
Length=131

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCD++G+ L++AAILG DGSVWAQSA FP++ PAEIT+IL DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM+I+GAKYMVIQGEPGVV+RGKKG GG+ IKK+   L+FGLYDEPMTP
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTP  112



>gb|KDP40849.1| hypothetical protein JCGZ_24848 [Jatropha curcas]
Length=131

 Score =   150 bits (379),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDI+G +L+AAAI+G DGSVWAQS +FPQ  P EI +I+KDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGQRLTAAAIIGHDGSVWAQSTSFPQFKPEEIAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GGI +KKT+Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGESGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTP  112



>sp|A4GFC2.1|PROCF_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33904.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   150 bits (379),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEG  L+AAA++G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGQHLTAAAVIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>ref|XP_004287490.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+KDFDEPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSATFPQLKPEEVTGIVKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKTT  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTP  112



>dbj|BAJ34266.1| unnamed protein product [Thellungiella halophila]
Length=131

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN L+AAAILG DGSVWAQSANFPQ+ P EI+ I KDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ I G KYMVIQGEP  V+RGKKG GG+ IKKTTQ L+FG+Y+EPM P
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAP  112



>gb|ABU95412.1| Sin a 4 allergen [Sinapis alba]
Length=131

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L+AAAILG DGSVWAQSANFPQ+ P EI  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ I G KYMVIQGEP  V+RGKKG GG+ IKKTTQ  +FG+Y+EPMTP
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTP  112



>sp|A4KA41.1|PROF5_CORAV RecName: Full=Profilin-5; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81298.1| pollen profilin variant 3 [Corylus avellana]
Length=131

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+I+G+ LSAAAI+G DGSVWAQS+ FPQ  P EI +I+KDFDEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLSAAAIIGHDGSVWAQSSTFPQFKPEEIAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GGI +KKT+Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGIKYMVIQGESGAVIRGKKGAGGITVKKTSQALIFGIYDEPLTP  112



>gb|ABC02750.1| profilin [Litchi chinensis]
Length=131

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+ +G  L+AAAI+G DGSVWAQSANFPQ  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPVEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGGI +KKTTQ L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTP  112



>sp|P35079.1|PROF1_PHLPR RecName: Full=Profilin-1; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 emb|CAA54686.1| profilin [Phleum pratense]
Length=131

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>gb|AFG16925.1| profilin [Quercus suber]
Length=131

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVVAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>sp|A4GFC4.1|PROCH_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33906.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>sp|O24650.1|PROF2_PHLPR RecName: Full=Profilin-2; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Full=Profilin 
4; AltName: Allergen=Phl p 12 [Phleum pratense]
 emb|CAA70608.1| profilin 2 [Phleum pratense]
 emb|CAA70610.1| profilin 4 [Phleum pratense]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>sp|P0C0Y3.1|PROF_FRAAN RecName: Full=Profilin; AltName: Allergen=Fra a 4 [Fragaria x 
ananassa]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I++DFDEPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSATFPQLKPEEVTGIVRDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKTT  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTP  112



>gb|AFG16922.1| profilin [Quercus suber]
 gb|AFG16924.1| profilin [Quercus suber]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>ref|XP_010267106.1| PREDICTED: profilin-1 [Nelumbo nucifera]
 ref|XP_010267107.1| PREDICTED: profilin-1 [Nelumbo nucifera]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L+AAAI+G DGSVWAQSA FPQ  P E+T+I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTAAAIIGQDGSVWAQSATFPQFKPEEVTAIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEP+ P
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTNQALIFGVYDEPLAP  112



>gb|ABW37745.1| Ama v 1.02 allergen [Amaranthus viridis]
Length=131

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+LSAAAILG DGSVWAQSA+FPQ  P EI +I+KDFDEPG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLSAAAILGTDGSVWAQSASFPQFRPEEIEAIVKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGGIC+KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGIYDEPVTP  112



>ref|XP_006353502.1| PREDICTED: profilin-1-like [Solanum tuberosum]
Length=131

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHL+CDIEGN LSAAAI+GLDG+VWA+S+ FPQ  P+EI +IL DF+EPGSL
Sbjct  1    MSWQVYVDEHLLCDIEGNHLSAAAIIGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G+KYMVIQGE GVV+RGKKGPGGI IKKT Q +L G+YDEPMTP
Sbjct  61   APTGLHLGGSKYMVIQGESGVVIRGKKGPGGITIKKTGQAILIGIYDEPMTP  112



>ref|XP_006426857.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 ref|XP_006465706.1| PREDICTED: profilin-3-like [Citrus sinensis]
 gb|ESR40097.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 gb|KDO51829.1| hypothetical protein CISIN_1g032890mg [Citrus sinensis]
Length=131

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G+ L++AAI+G DGSVWAQS+NFPQ  P EI +I+KDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHHLTSAAIVGHDGSVWAQSSNFPQFKPEEIAAIMKDFEEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GG+ +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALIFGIYDEPLTP  112



>gb|ADB93072.1| profilin-1 [Jatropha curcas]
 gb|KDP33778.1| hypothetical protein JCGZ_07349 [Jatropha curcas]
Length=131

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEGN LSAAAI+G DGSVWAQS+ FPQ  P EIT+I+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIEGNHLSAAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTP  112



>sp|Q9XF38.1|PROF_PYRCO RecName: Full=Profilin; AltName: Full=Allergen Pyr c 3; AltName: 
Allergen=Pyr c 4 [Pyrus communis]
 gb|AAD29410.1| profilin [Pyrus communis]
Length=131

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWAQS+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT+Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTP  112



>sp|O65812.1|PROF1_HEVBR RecName: Full=Profilin-1; AltName: Full=Pollen allergen Hev b 
8.0101; AltName: Allergen=Hev b 8.0101 [Hevea brasiliensis]
 emb|CAA75312.1| profilin [Hevea brasiliensis]
Length=131

 Score =   148 bits (373),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDE LMC+IEGN L+AAAI+G DGSVWAQS+NFPQ    EIT+I+ DFDEPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKGPGG+ ++KT Q L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTP  112



>gb|KHG15153.1| Profilin [Gossypium arboreum]
Length=132

 Score =   148 bits (373),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIE-GNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            MSWQTYVD+HLMC+IE G+ LS+AAILGLDGSVWAQS+ FP   P EIT+I+KDFDEPGS
Sbjct  1    MSWQTYVDDHLMCEIENGHHLSSAAILGLDGSVWAQSSAFPTFKPEEITAIMKDFDEPGS  60

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            LAPTG+H+ GAKYMVIQGEPG VVRGKKG GG+ +KKT Q L+FG+YDEP+TP
Sbjct  61   LAPTGLHLGGAKYMVIQGEPGAVVRGKKGTGGVTVKKTGQALIFGIYDEPVTP  113



>gb|AIV43661.1| profilin, partial [Bassia scoparia]
Length=133

 Score =   147 bits (372),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDIEG  N L+ AAILG+DGSVWAQSANFPQ  P EI +I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGE G V+RGKKGPGGIC+KKT Q L+FG+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTP  114



>ref|XP_004302848.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   147 bits (372),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HL+CDI+GN L++AAI+G DGSVWAQS+NFP+  P EIT+I+KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIDGNHLASAAIVGHDGSVWAQSSNFPKFKPEEITAIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H++G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLAGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTP  112



>ref|XP_004291152.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   147 bits (372),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMCDI+GN L+AAAILG DGSVW+QS+NFPQ  P EI +I+KDFD+PG+L
Sbjct  1    MSWQQYVDEHLMCDIDGNSLTAAAILGQDGSVWSQSSNFPQFKPEEIAAIMKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGVTVKKTNQALIIGIYDEPMTP  112



>ref|XP_009344483.1| PREDICTED: profilin [Pyrus x bretschneideri]
Length=131

 Score =   147 bits (371),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWAQS+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTP  112



>sp|Q9M7N0.1|PROF3_HEVBR RecName: Full=Profilin-3; AltName: Full=Pollen allergen Hev b 
8.0201; AltName: Allergen=Hev b 8.0201 [Hevea brasiliensis]
 gb|AAF34341.1|AF119365_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   147 bits (371),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDI+G+ L+AAAI+G DGSVWAQS++FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTP  112



>gb|ACV66156.2| profilin [Akebia trifoliata]
Length=131

 Score =   147 bits (371),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMCDIEG +LSAAAI+G DGSVWAQS  FPQ+ PAEIT I+ DF EPGSL
Sbjct  1    MSWQAYVDEHLMCDIEGQRLSAAAIIGHDGSVWAQSEPFPQLKPAEITGIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+YDEP+TP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGVYDEPLTP  112



>gb|EPS59245.1| profilin [Genlisea aurea]
Length=131

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCDI+GN+L+AAAI+GLDG VWAQS+NFPQ  P EI +IL+DF+EPG L
Sbjct  1    MSWQSYVDDHLMCDIDGNQLTAAAIVGLDGFVWAQSSNFPQFKPEEIAAILEDFEEPGKL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            AP G+++ G KYMVIQGEPG V+RGKKG GGI +KKT Q LLFG+YDEPMTP
Sbjct  61   APLGLYLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALLFGIYDEPMTP  112



>dbj|BAK07752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFGPNEITGIMKDFDEPGYL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM I+ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFIATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_007223916.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
 gb|EMJ25115.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
Length=131

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEG  L+AAAI+G DGSVWAQS++FP+  P EI +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGQHLTAAAIVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H++G KYMVIQGE G V+RGKKG GGI +KKT Q ++FG+Y+EP+TP
Sbjct  61   APTGLHLAGTKYMVIQGEGGAVIRGKKGSGGITVKKTGQAMIFGIYEEPLTP  112



>ref|XP_010541006.1| PREDICTED: profilin-4 [Tarenaya hassleriana]
Length=134

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ+ P EIT I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCDVGDGQGHHLTAAAIVGHDGSVWAQSANFPQLKPDEITGIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+H+ GAKYMVIQGEPG V+RGKKG GG+ IKKT Q L+FG+Y+EP+TP
Sbjct  61   GYLAPTGLHLGGAKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALVFGIYEEPVTP  115



>gb|AFK38257.1| unknown [Lotus japonicus]
 gb|AFK44821.1| unknown [Lotus japonicus]
Length=131

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN LS+AAILG DGSVWAQSANFPQ  P EIT I+ DF EPGSL
Sbjct  1    MSWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSANFPQFKPEEITGIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTP  112



>ref|XP_007202751.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 ref|XP_007202752.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 ref|XP_008242468.1| PREDICTED: profilin [Prunus mume]
 gb|ACE80972.1| putative allergen Pru du 4.02 [Prunus dulcis x Prunus persica]
 gb|ACE80973.1| putative allergen Pru p 4.02 [Prunus dulcis x Prunus persica]
 gb|EMJ03950.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 gb|EMJ03951.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
Length=131

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T IL DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTP  112



>emb|CCP19647.1| profilin allergen [Parietaria judaica]
Length=131

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L+AAAILG DGSVWAQSA+FPQ  P EI +I+KDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSASFPQFKPEEIAAIVKDFEEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + GAKYMVIQGE GVV+RGKKG GG+ +KKT Q L+ G+YDEPM P
Sbjct  61   APTGLFLGGAKYMVIQGEAGVVIRGKKGSGGVTVKKTGQALVIGIYDEPMAP  112



>gb|AFK47485.1| unknown [Medicago truncatula]
Length=131

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+CDIEG+ L+ AAILG+DGSVWAQSANFPQ  P EI +I KDFDEPG+L
Sbjct  1    MSWQTYVDDHLLCDIEGDHLTHAAILGVDGSVWAQSANFPQFKPEEINAINKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+HI G KYMVIQGEPG V+RGKKG GG+ +KKT   L  G+YDEPMTP
Sbjct  61   APTGLHIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALDIGIYDEPMTP  112



>ref|XP_010495947.1| PREDICTED: profilin-1-like [Camelina sativa]
Length=131

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L++AAILG DGSVWAQS  FPQ+ PAE+T I+KDF+EPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNQLTSAAILGQDGSVWAQSTKFPQLKPAEVTGIMKDFEEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGEP  V+RGKKGPGG+ IKKT Q L+FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEPEAVIRGKKGPGGVTIKKTKQALVFGIYDEPMT  111



>ref|XP_006340251.1| PREDICTED: profilin-like [Solanum tuberosum]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L++AAI+G DGSVWAQSANFPQ  P EIT+I+ DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGHDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGE G V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGAGGITIKKTNQALIIGIYDEPMTP  112



>ref|XP_006284576.1| hypothetical protein CARUB_v10005801mg, partial [Capsella rubella]
 gb|EOA17474.1| hypothetical protein CARUB_v10005801mg, partial [Capsella rubella]
Length=193

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  340  KMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            KMSWQ+YVD+HLMCD+EGN+L+ AAILG DGSVWAQSANFPQ+ PAEI  I KDFDE G 
Sbjct  62   KMSWQSYVDDHLMCDVEGNQLTHAAILGQDGSVWAQSANFPQLKPAEIAGINKDFDEAGH  121

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            LAPTG+ + G KYMV+QGE G V+RGKKGPGG+ IKKTTQ L+FG+YDEPMT
Sbjct  122  LAPTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMT  173



>sp|A4KA33.1|PROF6_PHLPR RecName: Full=Profilin-6; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 3; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81290.1| pollen profilin variant 3 [Phleum pratense]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_010489132.1| PREDICTED: profilin-1-like [Camelina sativa]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L++AAILG DGSVWAQS  FPQ+ P E+T I+KDFDEPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNQLTSAAILGQDGSVWAQSTKFPQLKPEEVTGIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGEP  V+RGKKGPGG+ IKKT Q L+FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEPEAVIRGKKGPGGVTIKKTKQALVFGIYDEPMT  111



>ref|XP_008337609.1| PREDICTED: profilin-2 [Malus domestica]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTP  112



>gb|AAK01235.1|AF327622_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTY DEHLMC+IEGN+L+AAAI+G DGSVWAQS+ FPQ+ P EIT ++ DF+EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+R KKGPGG+ +KKT+Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTP  112



>emb|CAK93713.1| profilin [Malus domestica]
 emb|CAK93718.1| profilin [Malus domestica]
 emb|CAK93723.1| profilin [Malus domestica]
 emb|CAK93731.1| profilin [Malus domestica]
 emb|CAK93736.1| profilin [Malus domestica]
 emb|CAK93739.1| profilin [Malus domestica]
Length=131

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTP  112



>sp|A4GFB9.1|PROCD_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33901.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSW TYVD+HLMCDIEG  L+AAAI+G DGSVWAQSA FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWPTYVDDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVI+GEPG V+RGKKG GGI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIRGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTP  112



>gb|KCW79179.1| hypothetical protein EUGRSUZ_C00615, partial [Eucalyptus grandis]
Length=193

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  SKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            +KMSWQ YVDEHLMC+IEGN L+AAAI+G DGSVWAQS++FPQ  P EIT I++DFDEPG
Sbjct  61   AKMSWQQYVDEHLMCEIEGNHLAAAAIIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPG  120

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+++ G KYMVIQGEP  V+RGKKGPGG+ IKKTT  L+ G+YDEPMTP
Sbjct  121  TLAPTGLYLGGTKYMVIQGEPNAVIRGKKGPGGVTIKKTTMALIIGIYDEPMTP  174



>ref|XP_010541007.1| PREDICTED: profilin-2 [Tarenaya hassleriana]
Length=131

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L+AAAILG DGSVWAQS+ FPQ    EIT+I+KDFDEPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNRLAAAAILGQDGSVWAQSSGFPQFKSEEITAIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALVIGIYDEPMTP  112



>ref|NP_001235595.1| profilin [Glycine max]
 gb|ABG88188.1| profilin [Glycine max]
Length=131

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+ +G  L+AAAI+G DGS WAQSANFPQ  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCETDGQHLTAAAIIGHDGSAWAQSANFPQFKPVEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPGVV+RGKKGPGGI +KKTT+ L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGVVIRGKKGPGGITVKKTTRALIIGIYDEPMTP  112



>sp|Q84V37.1|PROF_CHEAL RecName: Full=Profilin; AltName: Full=Minor pollen allergen Che 
a 2; AltName: Allergen=Che a 2 [Chenopodium album]
 gb|AAL92870.1| pollen allergen Che a 2 [Chenopodium album]
Length=131

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN LS+AAILG DG+VWAQS +FPQ+ P E+++I+KDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+Y EPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTP  112



>ref|XP_007217879.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
 ref|XP_008228405.1| PREDICTED: profilin [Prunus mume]
 gb|EMJ19078.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
Length=131

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L++AAI+G DGSVWAQS+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQVYVDDHLMCDIDGHHLASAAIVGHDGSVWAQSSAFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG  GI +KKT Q L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSSGITVKKTGQALVFGIYDEPLTP  112



>ref|XP_004251645.1| PREDICTED: profilin-1 [Solanum lycopersicum]
Length=131

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HL+C+IEGN LSAAAI+GLDG+VWA+S+ FPQ  P+EI +IL DF+EPGSL
Sbjct  1    MSWQVYVDDHLLCEIEGNHLSAAAIVGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G+KYMVIQGEPGVV+RGKKGPGGI IKKT Q LL G+YDEPMTP
Sbjct  61   APTGLHLGGSKYMVIQGEPGVVIRGKKGPGGITIKKTNQALLIGIYDEPMTP  112



>gb|AAX19855.1| profilin 1 [Malus domestica]
 gb|AAX19856.1| profilin 1 [Malus domestica]
Length=131

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWAQS+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQDLVFGIYEEPLTP  112



>ref|XP_010483134.1| PREDICTED: profilin-5 [Camelina sativa]
Length=131

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L AAAILG DGSVWAQS +FPQ+ P EI  I KDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLIAAAILGQDGSVWAQSTSFPQLKPEEIEGINKDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTTQ ++FG+YDEPMTP
Sbjct  61   APTGLFLGGNKYMVIQGEPNAVIRGKKGTGGVTIKKTTQAMVFGIYDEPMTP  112



>ref|XP_002514199.1| profilin, putative [Ricinus communis]
 sp|O82572.1|PROF1_RICCO RecName: Full=Profilin-1 [Ricinus communis]
 gb|AAC62482.1| profilin [Ricinus communis]
 gb|EEF48153.1| profilin, putative [Ricinus communis]
Length=131

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L++AAI+G DGSVWAQS+ FPQ  P EIT+I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTSAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++SG KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLSGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTP  112



>gb|AGA84056.1| profilin [Arachis hypogaea]
Length=131

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN LS+AAILG DGSVWAQS+NFPQ  P EIT+I+ DF EPGSL
Sbjct  1    MSWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTP  112



>gb|KHF97992.1| Profilin [Gossypium arboreum]
Length=131

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSA+FPQ+ P EI++I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSASFPQLKPEEISAIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMALIIGIYDEPMTP  112



>gb|AAU81921.1| profilin [Arachis hypogaea]
Length=128

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHL+CDIEGN+L++AAILG DGSVWAQS+NFPQ  P EIT+I+ DF EPG+L
Sbjct  1    MSWQAYVDEHLICDIEGNQLTSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V++  KGPGG+ IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIQXXKGPGGVTIKKTNQALIIGIYDEPMTP  112



>sp|Q93YI9.1|PROF_CAPAN RecName: Full=Profilin; AltName: Full=Minor food allergen Cap 
a 2; AltName: Allergen=Cap a 2 [Capsicum annuum]
 emb|CAD10376.1| profilin [Capsicum annuum]
Length=131

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN+L++AAI+G DGSVWAQSA FPQ  P EIT+I+ DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGE G V+RGKKGPGGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTP  112



>emb|CAD46559.1| profilin [Malus domestica]
 gb|AAX19852.1| profilin 1 [Malus domestica]
Length=131

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTP  112



>sp|A4KA34.1|PROF7_PHLPR RecName: Full=Profilin-7; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 4; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81291.1| pollen profilin variant 4 [Phleum pratense]
Length=131

 Score =   145 bits (367),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_008233911.1| PREDICTED: profilin-like [Prunus mume]
Length=131

 Score =   145 bits (367),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G  L+AAAI+G DGSVWAQS++FP+  P EI +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGQHLTAAAIVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H++G KYMVIQGE G V+RGKKG GGI +KKT Q ++FG+Y+EP+TP
Sbjct  61   APTGLHLAGTKYMVIQGEGGAVIRGKKGSGGITVKKTGQAMIFGIYEEPLTP  112



>ref|XP_006281613.1| hypothetical protein CARUB_v10027731mg [Capsella rubella]
 gb|EOA14511.1| hypothetical protein CARUB_v10027731mg [Capsella rubella]
Length=146

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  352  QKISKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFD  173
            +K  KMSWQTYVD+HLM D+EGN+L+AAAILG DGSVWAQS++FPQ+ P EI  I KDF 
Sbjct  11   RKTKKMSWQTYVDDHLMYDVEGNRLTAAAILGQDGSVWAQSSSFPQLKPEEIEGINKDFA  70

Query  172  EPGSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            EPG+LAPTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTTQ L+FG+Y+EPM P
Sbjct  71   EPGTLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAP  127



>gb|ADB96066.1| profilin [Arachis hypogaea]
Length=131

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD HL+C+IEGN LS+AAILG DGSVWAQS+NFPQ  P EIT+I+ DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALIIGIYDEPMTP  112



>ref|XP_010047296.1| PREDICTED: profilin [Eucalyptus grandis]
Length=131

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEGN L+AAAI+G DGSVWAQS++FPQ  P EIT I++DFDEPG+L
Sbjct  1    MSWQQYVDEHLMCEIEGNHLAAAAIIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEP  V+RGKKGPGG+ IKKTT  L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPNAVIRGKKGPGGVTIKKTTMALIIGIYDEPMTP  112



>ref|XP_006298806.1| hypothetical protein CARUB_v10014910mg [Capsella rubella]
 gb|EOA31704.1| hypothetical protein CARUB_v10014910mg [Capsella rubella]
Length=131

 Score =   145 bits (366),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L++AAILG DGSVWAQS  FPQ+ P EIT I+KDFDEPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNQLTSAAILGQDGSVWAQSTKFPQLKPQEITGIMKDFDEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALVFGIYDEPMT  111



>ref|XP_009350242.1| PREDICTED: profilin [Pyrus x bretschneideri]
 ref|XP_009350243.1| PREDICTED: profilin [Pyrus x bretschneideri]
Length=131

 Score =   145 bits (366),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVWAQSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTP  112



>ref|XP_004503498.1| PREDICTED: profilin-1-like [Cicer arietinum]
Length=131

 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHL+CDIEGN L++AAILG DGSVWAQS NFPQ  P EIT I+ DF EPG+L
Sbjct  1    MSWQVYVDEHLLCDIEGNHLTSAAILGQDGSVWAQSHNFPQFKPEEITGIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTP  112



>sp|A4KA37.1|PROF9_PHLPR RecName: Full=Profilin-9; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 7; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81294.1| pollen profilin variant 7 [Phleum pratense]
Length=131

 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVTRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_010536839.1| PREDICTED: profilin-4 [Tarenaya hassleriana]
Length=133

 Score =   145 bits (365),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGN--KLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI+G+   L+AAAI+G DGSVWAQS+NFPQ+ P EIT I+KDFD+PG
Sbjct  1    MSWQTYVDDHLMCDIDGHGQHLAAAAIVGHDGSVWAQSSNFPQVKPQEITDIMKDFDDPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ GAKYMVIQGEPG V+RGKKG GG  IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGAKYMVIQGEPGAVIRGKKGSGGATIKKTGQALVFGIYEEPVTP  114



>sp|A4KA32.1|PROF5_PHLPR RecName: Full=Profilin-5; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 2; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81289.1| pollen profilin variant 2 [Phleum pratense]
Length=131

 Score =   145 bits (365),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>sp|Q8GT39.1|PROF_PRUPE RecName: Full=Profilin; AltName: Allergen=Pru p 4.02 [Prunus 
persica]
 emb|CAD37202.1| profilin [Prunus persica]
Length=131

 Score =   145 bits (365),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T IL DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTP  112



>ref|XP_009628677.1| PREDICTED: profilin-1 [Nicotiana tomentosiformis]
 ref|XP_009776401.1| PREDICTED: profilin-1-like [Nicotiana sylvestris]
Length=131

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHL+CDIEGN L+AAAI+G DG+VWAQS+NFPQ  P EI +I+ DF+EPG+L
Sbjct  1    MSWQTYVDEHLLCDIEGNHLTAAAIVGHDGAVWAQSSNFPQFKPEEIKAIMNDFEEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMV+QGE GVV+RGKKGPGGI IKKT   +L G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVLQGEAGVVIRGKKGPGGITIKKTNMAILIGIYDEPMTP  112



>ref|XP_008365251.1| PREDICTED: profilin [Malus domestica]
Length=131

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAXSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTP  112



>ref|XP_010447864.1| PREDICTED: profilin-2-like [Camelina sativa]
Length=131

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+ AAI G DGSVWAQSANFPQ+ PAEI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTHAAIYGQDGSVWAQSANFPQLKPAEIEGINKDFEEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGE G V+RGKKGPGG+ IKKTTQ L+FG YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEAGAVIRGKKGPGGVTIKKTTQALVFGFYDEPMT  111



>sp|A4KA36.1|PROF8_PHLPR RecName: Full=Profilin-8; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 6; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81293.1| pollen profilin variant 6 [Phleum pratense]
Length=131

 Score =   144 bits (364),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_010668774.1| PREDICTED: profilin-3 [Beta vulgaris subsp. vulgaris]
Length=133

 Score =   144 bits (364),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMC+IEG  N LSAAAILGLDGSVWAQS++FPQ  P EI +I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGTANHLSAAAILGLDGSVWAQSSSFPQFKPEEIAAIVKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            SLAPTG+ + G KYMVIQGEPG V+RGKKGPGGIC+KKT Q L+ GLYDEP+TP
Sbjct  61   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGLYDEPVTP  114



>gb|ACS34771.1| Sal k 4 pollen allergen [Salsola kali]
Length=133

 Score =   144 bits (364),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMC+IEG  N L+AAAILG+DGSVWAQSANFPQ  P EI++++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGE G V+RGKKGPGGIC+KKT Q L+FG+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTP  114



>gb|KHG29269.1| Profilin-1 [Gossypium arboreum]
Length=131

 Score =   144 bits (364),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEGN LSAAAI+G DGSVWAQS+NFPQ  P EIT I+ DF EPGSL
Sbjct  1    MSWQAYVDDHLMCDIEGNHLSAAAIIGQDGSVWAQSSNFPQFKPEEITGIMNDFSEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMTP  112



>ref|XP_006655796.1| PREDICTED: profilin LP04-like [Oryza brachyantha]
Length=131

 Score =   144 bits (364),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+I+GN L+AAAILG DG+VWAQS NFPQ  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCEIDGNHLTAAAILGHDGTVWAQSPNFPQYKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPGVV+RGKKG GGIC+KKTT  L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGICVKKTTLSLVMGIYDEPMTP  112



>ref|XP_010688354.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
 ref|XP_010688355.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEGN L++AAI+G DG+VWAQS +FPQ+ P E+ +I+KDF+EPG+L
Sbjct  1    MSWQAYVDDHLMCDIEGNHLTSAAIVGHDGNVWAQSPSFPQLKPGEVAAIMKDFEEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGG+ + KT Q L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGSVIRGKKGPGGVTVNKTNQALIIGIYDEPMTP  112



>ref|XP_010451283.1| PREDICTED: profilin-5-like [Camelina sativa]
Length=174

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  SKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
             KMSWQTYVD+HLMC++EGN+L+AAAILG DGSVWAQS +FPQ+ P EI  I KDF EPG
Sbjct  42   KKMSWQTYVDDHLMCEVEGNRLTAAAILGQDGSVWAQSTSFPQLKPEEIEGINKDFAEPG  101

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+ ++G KYMVIQGEP  V+RGKKG GG+ IKKTTQ L+FG+Y+EPM P
Sbjct  102  TLAPTGLFLNGIKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAP  155



>gb|AAX19857.1| profilin 2 [Malus domestica]
 gb|AAX19858.1| profilin 2 [Malus domestica]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTP  112



>sp|A4KA43.1|PROF6_CORAV RecName: Full=Profilin-6; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81300.1| pollen profilin variant 5 [Corylus avellana]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPGVV+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGVVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>gb|AAK01236.1|AF327623_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ Y DEHLMC+IEGN+L+AAAI+G DGSVWAQS+ FPQ+ P EIT ++ DF+EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT+Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTP  112



>ref|XP_009796122.1| PREDICTED: profilin-2 [Nicotiana sylvestris]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN L++AAI+G DG+VWAQSANFPQ  P EIT I+KDF EPG+L
Sbjct  1    MSWQTYVDDHLLCEIEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMKDFVEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTP  112



>ref|XP_008380843.1| PREDICTED: profilin [Malus domestica]
Length=131

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAXSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQXLVFGIYEEPLTP  112



>ref|XP_007012986.1| Profilin 1 isoform 1 [Theobroma cacao]
 ref|XP_007012987.1| Profilin 1 isoform 1 [Theobroma cacao]
 gb|EOY30605.1| Profilin 1 isoform 1 [Theobroma cacao]
 gb|EOY30606.1| Profilin 1 isoform 1 [Theobroma cacao]
Length=131

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN LSAAAI+G +GSVWAQS+NFPQ  P EI  I+ DF EPGSL
Sbjct  1    MSWQTYVDDHLMCEIEGNHLSAAAIIGQEGSVWAQSSNFPQFKPEEINGIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTP  112



>gb|AFK47285.1| unknown [Lotus japonicus]
Length=131

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HL+CDIEGN L++AAILG DGSVWAQS NFPQ  P EIT I+ DF EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTSAAILGQDGSVWAQSTNFPQFKPEEITGIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTP  112



>sp|A4KA38.1|PRO10_PHLPR RecName: Full=Profilin-10; AltName: Full=Pollen allergen Phl 
p 12; AltName: Full=pollen profilin variant 8; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81295.1| pollen profilin variant 8 [Phleum pratense]
Length=131

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>gb|ABA81885.1| profilin-like [Solanum tuberosum]
Length=131

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHL+C+IEGN L++AAI+G DG+VWAQSANFPQ  P EIT ++ DF EPG+L
Sbjct  1    MSWQTYVDEHLLCEIEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGVMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTP  112



>gb|ABO43717.1| profilin [Gossypium hirsutum]
 gb|ABO43718.1| profilin [Gossypium hirsutum]
 gb|ABO43719.1| profilin [Gossypium hirsutum]
 gb|ACX53268.1| profilin [Gossypium raimondii]
 gb|ACX53269.1| profilin [Gossypium arboreum]
Length=133

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI+G  + LSAAAI+G DGS+WAQS+NFP+  P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGTGHHLSAAAIVGHDGSIWAQSSNFPKCQPKEITDIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ GAK+MVIQGEPG V+RGKKG GG+ IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGAKFMVIQGEPGAVIRGKKGSGGVTIKKTAQALVFGIYEEPVTP  114



>gb|KFK27226.1| hypothetical protein AALP_AA8G353900 [Arabis alpina]
Length=131

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L++AAILG DGSVWAQS  FPQ+ P EI  I KDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTSAAILGQDGSVWAQSTGFPQLKPEEIEGINKDFTEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTTQ L+FG+Y+EPM P
Sbjct  61   APTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAP  112



>gb|AAX19859.1| profilin 2 [Malus domestica]
 gb|AAX19860.1| profilin 2 [Malus domestica]
Length=131

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T ++ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGVMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTP  112



>sp|A4KA50.1|PROCJ_OLEEU RecName: Full=Profilin-5; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81307.1| pollen profilin [Olea europaea]
Length=131

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>sp|A4KA53.1|PROCM_OLEEU RecName: Full=Profilin-8; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81310.1| pollen profilin [Olea europaea]
Length=131

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>sp|A4KA52.1|PROCL_OLEEU RecName: Full=Profilin-7; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81309.1| pollen profilin [Olea europaea]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_004503499.1| PREDICTED: profilin-like [Cicer arietinum]
Length=133

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI+G  + LSAAAI+G DGSVWAQS++FPQI   EIT I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSSFPQIKSQEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H++G KYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   TLAPTGLHLAGVKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGVYEEPVTP  114



>sp|A4KA49.1|PROCI_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|A4KA31.1|PROF4_PHLPR RecName: Full=Profilin-4; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 1; AltName: Full=pollen 
profilin variant 5; AltName: Allergen=Phl p 12 [Phleum 
pratense]
 gb|ABG81288.1| pollen profilin variant 1 [Phleum pratense]
 gb|ABG81292.1| pollen profilin variant 5 [Phleum pratense]
 gb|ABG81306.1| pollen profilin [Olea europaea]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG DG+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>pdb|1G5U|A Chain A, Latex Profilin Hevb8
 pdb|1G5U|B Chain B, Latex Profilin Hevb8
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G++L+AAAI+G DGSVWAQS++FPQ    E+ +++KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +K+T Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTP  112



>ref|XP_010416676.1| PREDICTED: profilin-1-like [Camelina sativa]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L++AAILG DGSVWAQS  FPQ+ P E+  ILKDF+EPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNQLTSAAILGQDGSVWAQSTKFPQLKPEEVAGILKDFEEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGEP  V+RGKKGPGG+ IKKT Q L+FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEPEAVIRGKKGPGGVTIKKTKQALVFGIYDEPMT  111



>pdb|4ESP|A Chain A, Crystal Structure Of Peanut Allergen Ara H 5
Length=130

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  334  SWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSLA  155
            SWQTYVD+HL+C+IEGN LS+AAILG DGSVWAQS+NFPQ  P EIT+I+ DF EPGSLA
Sbjct  1    SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLA  60

Query  154  PTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            PTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+YDEPMTP
Sbjct  61   PTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTP  111



>ref|XP_003630696.1| Profilin [Medicago truncatula]
Length=133

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI+G  + LSAAAI+G DGSVWAQS++FPQI P E T I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSSFPQIKPQENTDIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H++G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLAGVKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGVYEEPVTP  114



>sp|Q9STB6.1|PROF2_HEVBR RecName: Full=Profilin-2; AltName: Full=Pollen allergen Hev b 
8.0102; AltName: Allergen=Hev b 8.0102 [Hevea brasiliensis]
 emb|CAB51914.1| profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSANFPQ    EIT I+ DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTP  112



>gb|AFK47224.1| unknown [Lotus japonicus]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HL+CDIEGN L++AAILG DGSVWAQS NFPQ  P EIT I+ DF EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTSAAILGQDGSVWAQSTNFPQFKPEEITGIMDDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTP  112



>sp|Q9LEI8.1|PROF6_HEVBR RecName: Full=Profilin-6; AltName: Full=Pollen allergen Hev b 
8.0204; AltName: Allergen=Hev b 8.0204 [Hevea brasiliensis]
 emb|CAB96215.1| profilin [Hevea brasiliensis]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G++L+AAAI+G DGSVWAQS++FPQ    E+ +++KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTP  112



>sp|Q9M7M8.1|PROF5_HEVBR RecName: Full=Profilin-5; AltName: Full=Pollen allergen Hev b 
8.0203; AltName: Allergen=Hev b 8.0203 [Hevea brasiliensis]
 gb|AAF34343.1|AF119367_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G++L+AAAI+G DGSVWAQS+ FPQ    E+ +++KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTP  112



>ref|XP_002866157.1| profilin-5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42416.1| profilin-5 [Arabidopsis lyrata subsp. lyrata]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN+L+AAAILG DGSVWAQS+NFPQ+ P EI  I  DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSSNFPQLKPEEIQGIKDDFTTPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTTQ L+FG+Y+EPM P
Sbjct  61   APTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAP  112



>sp|A4KA45.1|PROF4_CORAV RecName: Full=Profilin-4; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81302.1| pollen profilin variant 7 [Corylus avellana]
 gb|ABG81303.1| pollen profilin variant 8 [Corylus avellana]
 gb|ABG81304.1| pollen profilin variant 9 [Corylus avellana]
 gb|ABG81305.1| pollen profilin variant 10 [Corylus avellana]
Length=133

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>sp|Q9XF42.1|PROF3_MALDO RecName: Full=Profilin-3; AltName: Full=GD4-5; AltName: Full=Pollen 
allergen Mal d 4.0101; AltName: Allergen=Mal d 4.0101 
[Malus domestica]
 gb|AAD29414.1|AF129428_1 profilin [Malus domestica]
 gb|AAX19861.1| profilin 3 [Malus domestica]
 gb|AAX19862.1| profilin 3 [Malus domestica]
 gb|AAX19863.1| profilin 3 [Malus domestica]
 gb|AAX19864.1| profilin 3 [Malus domestica]
 emb|CAK93744.1| profilin [Malus domestica]
 emb|CAK93749.1| profilin [Malus domestica]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA+FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTP  112



>ref|XP_006853719.1| hypothetical protein AMTR_s00056p00159630 [Amborella trichopoda]
 gb|ERN15186.1| hypothetical protein AMTR_s00056p00159630 [Amborella trichopoda]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G++L+AAAILGLDG+VWAQS +FP++ P EI  I+ DFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHRLTAAAILGLDGNVWAQSQSFPELKPDEIKGIINDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++  AKYMVIQGEPG V+RGKKG GG+ IKKTTQ L+ G+YDEP+TP
Sbjct  61   APTGLYLGAAKYMVIQGEPGAVIRGKKGSGGVTIKKTTQALIIGIYDEPLTP  112



>ref|XP_002515952.1| profilin, putative [Ricinus communis]
 gb|EEF46372.1| profilin, putative [Ricinus communis]
Length=132

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI-EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            MSWQTYVD+HLMCD+ +G+ L+AAAI+G DGSVWAQSA FPQ+ P E+T+I+KDFDEPGS
Sbjct  1    MSWQTYVDDHLMCDVGDGHTLTAAAIIGHDGSVWAQSATFPQLKPEEVTAIMKDFDEPGS  60

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            LAPTG+H+ G KYMVIQGEPG V+RGKKG GG  +KKT Q ++ G+YDEP+TP
Sbjct  61   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGATLKKTGQAIVIGIYDEPLTP  113



>gb|ADL18409.1| profilin [Gossypium hirsutum]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+  DGSVWAQSANFPQ  P EI +I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIAHDGSVWAQSANFPQFKPEEINAIMNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMALIIGIYDEPMTP  112



>ref|XP_002274966.2| PREDICTED: profilin-1 [Vitis vinifera]
Length=191

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -1

Query  340  KMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            KMSWQTYVD+HLMC+IEGN L+AAAILG DGSVWAQSA FPQ  P EIT+I+ DF EPG+
Sbjct  60   KMSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSATFPQFKPEEITAIMTDFAEPGT  119

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            LAPTG+++ G KYMVIQGEPG V+RGKKG GG CIKKT Q L+ G+YDEP+TP
Sbjct  120  LAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGACIKKTIQALIIGIYDEPLTP  172



>ref|XP_010249472.1| PREDICTED: profilin-1-like [Nelumbo nucifera]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN L++AAI+G DGSVWAQS+ FPQ  P EIT+I+ DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLASAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFSEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+H  G KYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEP+T
Sbjct  61   APTGLHFGGTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIVGVYDEPLT  111



>gb|AAP15200.1| profilin-like protein [Humulus scandens]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+I+GN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIDGNHLSAAAIIGHDGSVWAQSAAFPQLKPEEVTGIMNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKG GG+ IKKT+Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGAGGVTIKKTSQALIIGVYDEPMTP  112



>emb|CDY68825.1| BnaA01g34880D [Brassica napus]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L++AAILG DGSVWAQS NFPQ+ PAEI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTSAAILGQDGSVWAQSTNFPQLKPAEIEGIKKDFEEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMV+QGE G V+RGKKGPGG+ IKKT Q  +FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTNQAFVFGIYDEPMT  111



>emb|CAD37201.1| profilin [Prunus persica]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTP  112



>ref|XP_010668781.1| PREDICTED: profilin-3-like [Beta vulgaris subsp. vulgaris]
Length=133

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMC+IEG  N L+AAAILG+DGSVWAQS+ FPQ  P EI +++KDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGTNNHLTAAAILGIDGSVWAQSSAFPQFKPDEIAAVVKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGEPG V+RGKKGPGGIC+KKT Q L+ GLYDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGLYDEPVTP  114



>ref|XP_009367418.1| PREDICTED: profilin-3-like [Pyrus x bretschneideri]
Length=131

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN L+AAAILG DGSVWAQSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNSLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPLTP  112



>sp|Q64LH1.1|PROF1_AMBAR RecName: Full=Profilin-1; AltName: Full=Pollen allergen Amb a 
8; AltName: Allergen=Amb a 8 [Ambrosia artemisiifolia]
 gb|AAP15202.1| profilin-like protein [Ambrosia artemisiifolia]
Length=131

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DG VWAQSA FPQ+ P EIT I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKTT  L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMSLIIGIYDEPMTP  112



>emb|CAK93753.1| profilin [Malus domestica]
 emb|CAK93761.1| profilin [Malus domestica]
 emb|CAK93762.1| profilin [Malus domestica]
Length=131

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN L+AAAILG DGSVWAQSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNSLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTP  112



>ref|XP_009128837.1| PREDICTED: profilin-1 [Brassica rapa]
 emb|CDY06819.1| BnaC01g09180D [Brassica napus]
Length=131

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L++AAILG DGSVWAQS NFPQ+ PAEI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTSAAILGQDGSVWAQSTNFPQLKPAEIEGIKKDFEEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMV+QGE G V+RGKKGPGG+ IKKT Q  +FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVVQGEGGAVIRGKKGPGGVTIKKTNQAFVFGIYDEPMT  111



>ref|XP_008220131.1| PREDICTED: profilin [Prunus mume]
 sp|Q8GSL5.1|PROF_PRUDU RecName: Full=Profilin; AltName: Allergen=Pru du 4 [Prunus dulcis]
 gb|AAL91662.1| profilin [Prunus dulcis]
 gb|AAL91664.1| profilin [Prunus dulcis]
 gb|ACE80970.1| putative allergen Pru du 4.01 [Prunus dulcis x Prunus persica]
 gb|ACE80971.1| putative allergen Pru p 4.01 [Prunus dulcis x Prunus persica]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTP  112



>emb|CAN67015.1| hypothetical protein VITISV_041272 [Vitis vinifera]
 emb|CBI20595.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+IEGN L+AAAILG DGSVWAQSA FPQ  P EIT+I+ DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSATFPQFKPEEITAIMTDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKG GG CIKKT Q L+ G+YDEP+TP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGACIKKTIQALIIGIYDEPLTP  112



>ref|XP_003525290.1| PREDICTED: profilin-like [Glycine max]
Length=133

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI+G  + L+AAAI+G DGSVWAQS++FPQI P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGTGHHLTAAAIIGHDGSVWAQSSSFPQIRPQEITDIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H++G KYMVIQGE G V+RGKKGPGGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLAGTKYMVIQGESGAVIRGKKGPGGITIKKTGQALVFGVYEEPVTP  114



>sp|Q9XF41.1|PROF2_MALDO RecName: Full=Profilin-2; AltName: Full=GD4-2; AltName: Full=Pollen 
allergen Mal d 4.0201; AltName: Allergen=Mal d 4.0201 
[Malus domestica]
 gb|AAD29413.1|AF129427_1 profilin [Malus domestica]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G +GSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTP  112



>ref|XP_008447563.1| PREDICTED: profilin-like [Cucumis melo]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+Y+D+ LM +++G  L AAAI+G DGSVWAQS+ FPQ  P EI++I+KDFDEPGSL
Sbjct  1    MSWQSYIDDQLMYEVDGQHLKAAAIIGNDGSVWAQSSGFPQYKPEEISAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G+KYMVIQGE G V+RGKKG  GI +KKTTQ L+FGLYDEPMTP
Sbjct  61   APTGLHLGGSKYMVIQGESGAVIRGKKGTSGITVKKTTQALIFGLYDEPMTP  112



>ref|XP_010536838.1| PREDICTED: profilin-like [Tarenaya hassleriana]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+EGN L+AAAILG DGSVWAQSA+FPQ +P EI  I+ DFDEPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNHLTAAAILGEDGSVWAQSAHFPQFNPDEIAGIISDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKGPGG+ IKKT Q ++ G+YDEPM P
Sbjct  61   APTGLFLGGVKYMVIQGEPGAVIRGKKGPGGVTIKKTNQAMVIGIYDEPMAP  112



>ref|XP_007012985.1| Profilin 5 [Theobroma cacao]
 gb|EOY30604.1| Profilin 5 [Theobroma cacao]
Length=133

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G  L+AAAI+G DGSVWAQS+ FPQ  P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSVWAQSSTFPQFKPNEITDIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FGLY+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVFGLYEEPVTP  114



>ref|NP_001275370.1| profilin-like protein [Solanum tuberosum]
 gb|ABB16985.1| profilin-like protein [Solanum tuberosum]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHL+C+IEGN L++AAI+G DG+VWAQSANFPQ  P EI+ I+ DF EPG+L
Sbjct  1    MSWQTYVDEHLLCEIEGNHLTSAAIVGQDGTVWAQSANFPQFKPEEISGIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTP  112



>gb|AHL24658.1| Sal k 4.03 allergen [Salsola kali]
Length=133

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQ YVD+HLMC+IEG  N L+AAAILG+DGSVWAQSANFPQ  P EI++++K+FDE G
Sbjct  1    MSWQAYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQ E G V+RGKKGPGGIC+KKT Q L+FG+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQSEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTP  114



>emb|CAT99617.1| profilin [Malus domestica]
Length=131

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+E +TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEETLTP  112



>sp|O24282.1|PROF3_PHLPR RecName: Full=Profilin-3; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 emb|CAA70609.1| profilin 3 [Phleum pratense]
Length=131

 Score =   143 bits (360),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAI G DG+VWAQSA+FPQ  P EIT I+KD DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>gb|AAX19853.1| profilin 1 [Malus domestica]
 gb|AAX19854.1| profilin 1 [Malus domestica]
Length=131

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+E +TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEETLTP  112



>sp|Q9XF40.1|PROF1_MALDO RecName: Full=Profilin-1; AltName: Full=GD4-1; AltName: Full=Pollen 
allergen Mal d 4.0301; AltName: Allergen=Mal d 4.0301 
[Malus domestica]
 gb|AAD29412.1|AF129426_1 profilin [Malus domestica]
Length=131

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+ LMCDI+G+ L+AAAILG DGSVWA S+ FP+  P EIT+I+KDFDEPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GG+ +KKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTP  112



>ref|XP_004290829.1| PREDICTED: profilin-3-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEG+ L+AAAI+G D SVWAQS++FPQ  P E+ +I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIEGHHLTAAAIVGHDSSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGE G V+RGKKG GGI +KKT Q ++ G+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGESGAVIRGKKGSGGITVKKTGQAMILGIYDEPITP  112



>ref|XP_003564327.1| PREDICTED: profilin-1 [Brachypodium distachyon]
Length=131

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEGN L+AAAILG DGSVW+QS NFPQ  P +IT+I+KDFDEPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGNHLTAAAILGQDGSVWSQSDNFPQFKPEQITAIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+     KYMVIQGEPGVV+RGKKGPGGI IKKT Q LL G+YDEPMTP
Sbjct  61   APTGLFFGSEKYMVIQGEPGVVIRGKKGPGGITIKKTGQALLVGIYDEPMTP  112



>emb|CDM84005.1| unnamed protein product [Triticum aestivum]
Length=131

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FP   P E+T+I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ +  AKYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLLLGAAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTP  112



>dbj|BAJ86041.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FP   P E+T+I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ +  AKYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLLLGSAKYMVIQGEPGAVIRGKKGSGGITLKKTGQALVIGIYDEPMTP  112



>gb|EMS49855.1| Profilin-2/4 [Triticum urartu]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FP   PAE+ +I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPAEMANIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ ++ AKYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLLLADAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTP  112



>sp|A4KA51.1|PROCK_OLEEU RecName: Full=Profilin-6; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81308.1| pollen profilin [Olea europaea]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+IEG+ L++AAILG  G+VWAQSA+FPQ  P EIT I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLASAAILGHGGTVWAQSADFPQFKPEEITGIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM ++ AKYMVIQGEPG V RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVTRGKKGAGGITIKKTGQALVVGIYDEPMTP  112



>ref|XP_009352571.1| PREDICTED: profilin-2 [Pyrus x bretschneideri]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T  LL G+YDEPMT
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMT  111



>ref|NP_179566.1| profilin 1 [Arabidopsis thaliana]
 sp|Q42449.1|PROF1_ARATH RecName: Full=Profilin-1; AltName: Allergen=Ara t 8 [Arabidopsis 
thaliana]
 pdb|1A0K|A Chain A, Profilin I From Arabidopsis Thaliana
 gb|AAG10090.1|U43593_1 profilin [Arabidopsis thaliana]
 gb|AAB39476.1| profilin 1 [Arabidopsis thaliana]
 gb|AAB39480.1| profilin 1 [Arabidopsis thaliana]
 gb|AAB46750.1| profilin [Arabidopsis thaliana]
 gb|AAC62140.1| profilin 1 [Arabidopsis thaliana]
 gb|AAL62419.1| profilin 1 [Arabidopsis thaliana]
 gb|AAN15583.1| profilin 1 [Arabidopsis thaliana]
 gb|AEC06923.1| profilin 1 [Arabidopsis thaliana]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+AAAILG DGSVWAQSA FPQ+ P EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGE G V+RGKKGPGG+ IKKT Q L+FG YDEPMT
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMT  111



>sp|Q9M7M9.1|PROF4_HEVBR RecName: Full=Profilin-4; AltName: Full=Pollen allergen Hev b 
8.0202; AltName: Allergen=Hev b 8.0202 [Hevea brasiliensis]
 gb|AAF34342.1|AF119366_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+G++L+AAAI+G DGSVWAQS++FPQ    E+ +I+KDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+   KYMVIQGEPG V+RGKKG GGI +KKT+Q L+ G+YDEP+TP
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTP  112



>ref|XP_003569765.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L +AAILG DG+VWAQSA+FP   P E+T+I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLVSAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ ++ AKYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLFLASAKYMVIQGEPGAVIRGKKGSGGITLKKTGQALVVGIYDEPMTP  112



>ref|XP_009415731.1| PREDICTED: profilin-3 [Musa acuminata subsp. malaccensis]
Length=131

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L+AAAI+G DGSVWAQSA+FPQ+ P E+T+I+ DF+EPG+L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTAAAIVGQDGSVWAQSASFPQVKPEEMTNIINDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            AP G+ +   KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEPMTP
Sbjct  61   APIGLFLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIFGIYDEPMTP  112



>ref|XP_007024334.1| Profilin 5 [Theobroma cacao]
 gb|EOY26956.1| Profilin 5 [Theobroma cacao]
Length=132

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIE-GNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            MSWQTYVD+HLMC+I+ G+ LSAAAI+G DGSVWAQS +FPQ  P EI +I+KDFDEPGS
Sbjct  1    MSWQTYVDDHLMCEIDSGHHLSAAAIIGHDGSVWAQSTSFPQFKPEEIIAIMKDFDEPGS  60

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            LAP+G+H+ G KYMVIQGEPG V+RGKKG GGI +KKT Q L+FGLYDEP+TP
Sbjct  61   LAPSGLHLGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGLYDEPVTP  113



>ref|XP_004149180.1| PREDICTED: profilin-like [Cucumis sativus]
 ref|XP_004158480.1| PREDICTED: profilin-like [Cucumis sativus]
 gb|KGN58022.1| hypothetical protein Csa_3G435030 [Cucumis sativus]
Length=131

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+Y+D+ LM +++G  L AAAI+G DGSVWAQS+ FPQ  P EI++I+KDFDEPGSL
Sbjct  1    MSWQSYIDDQLMYEVDGQHLKAAAIIGNDGSVWAQSSAFPQYKPEEISAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G+KYMVIQGE G V+RGKKG  GI +KKTTQ L+FGLYDEPMTP
Sbjct  61   APTGLHLGGSKYMVIQGESGAVIRGKKGTSGITVKKTTQALIFGLYDEPMTP  112



>gb|KDP33777.1| hypothetical protein JCGZ_07348 [Jatropha curcas]
Length=133

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G  L+AAAI+G DGSVWAQS +FPQ  P E+T I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSVWAQSTSFPQFKPEEVTDIMKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+YDEP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYDEPVTP  114



>ref|XP_002308591.1| profilin 2 family protein [Populus trichocarpa]
 ref|XP_006382037.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
 gb|ABK92737.1| unknown [Populus trichocarpa]
 gb|EEE92114.1| profilin 2 family protein [Populus trichocarpa]
 gb|ERP59834.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
Length=131

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMCDI+GN L++AAI+G DGSVWAQSA FPQ +  E+ +I+KDFDEPGSL
Sbjct  1    MSWQQYVDEHLMCDIDGNTLTSAAIIGHDGSVWAQSATFPQFTAEEVAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + GAKYMVIQGE G V+RGKKG GG+ IKKT Q L+ G+YDEP+ P
Sbjct  61   APTGLFLGGAKYMVIQGEAGAVIRGKKGSGGVTIKKTNQALVIGVYDEPLAP  112



>ref|XP_007204757.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
 gb|EMJ05956.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
Length=133

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI  +G  LSAAAI+GLDGSVWA+SA+FPQ  P E+T I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLSAAAIIGLDGSVWAKSASFPQFKPEEMTGINKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+FGLY+EP+TP
Sbjct  61   HLAPTGLHLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGLYEEPVTP  114



>ref|XP_007204758.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
 gb|EMJ05957.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
Length=132

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI  +G  LSAAAI+GLDGSVWA+SA+FPQ  P E+T I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLSAAAIIGLDGSVWAKSASFPQFKPEEMTGINKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+FGLY+EP+TP
Sbjct  61   HLAPTGLHLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGLYEEPVTP  114



>ref|XP_006451338.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 ref|XP_006475346.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64578.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 gb|KDO55853.1| hypothetical protein CISIN_1g032871mg [Citrus sinensis]
Length=131

 Score =   142 bits (358),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HL+C+IEGN LSAAAI+G DGSVWAQS NFPQ+ P EIT I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKT+  L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTP  112



>gb|EPS66446.1| profilin, partial [Genlisea aurea]
Length=130

 Score =   142 bits (357),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVDEHLMC+I+GN L++AAI+G DG VWAQS+ FP+ +  EI +I++DFDEPG L
Sbjct  1    MSWQSYVDEHLMCEIDGNHLTSAAIIGHDGLVWAQSSTFPEFTADEIAAIVEDFDEPGKL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKTTQ LLFG+YDEPMTP
Sbjct  61   APTGLHLGGIKYMVIQGEPGSVIRGKKGSGGITVKKTTQALLFGIYDEPMTP  112



>gb|AET05174.2| profilin [Medicago truncatula]
Length=133

 Score =   142 bits (358),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI+G  + LSAAAI+G DGSVWAQS++FPQ  P EI +I KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSSFPQFKPEEINAINKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+HI G KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTP
Sbjct  61   TLAPTGLHIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTP  114



>sp|A4KA40.1|PROF2_CORAV RecName: Full=Profilin-2; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81297.1| pollen profilin variant 2 [Corylus avellana]
Length=133

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQ YVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQAYVDEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_009102139.1| PREDICTED: profilin-1 [Brassica rapa]
 emb|CDX82720.1| BnaC07g01460D [Brassica napus]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+AAAILG DGSVWAQSANFPQ+ P EI  I  DF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSANFPQLKPEEIKGITTDFEEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + GAKYMVIQGEPG V+RGKKGPGG+ IKKTTQ L+ G+Y+EPMT
Sbjct  61   APTGLFLGGAKYMVIQGEPGAVIRGKKGPGGVTIKKTTQALVIGIYEEPMT  111



>gb|EMT00312.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCDIEG+ L++AAILG DG+VWAQSA+FP   P E+T+I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ +  AKYMVIQGEPG V+RGKKG GGI +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLLLGDAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTP  112



>gb|KFK29496.1| hypothetical protein AALP_AA7G141900 [Arabis alpina]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN LS+AAILG DG+VWAQS+ FPQ+ P EI  I KDF+E G L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLSSAAILGQDGAVWAQSSTFPQLKPEEIEGIKKDFEEAGYL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + GAKYMV+QGE G V+RGKKGPGG+ IKKTTQ L+FGLYDEPMT
Sbjct  61   APTGLFLGGAKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGLYDEPMT  111



>sp|A4KA44.1|PROF3_CORAV RecName: Full=Profilin-3; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81301.1| pollen profilin variant 6 [Corylus avellana]
Length=133

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQ YVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQAYVDEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>emb|CAD46560.1| profilin [Malus domestica]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQSA FPQ+ P E+T I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPGVV+RGKKGPGG+ +KK+T   L G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMASLIGIYDEPMTP  112



>sp|A4KA39.1|PROF1_CORAV RecName: Full=Profilin-1; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81296.1| pollen profilin variant 1 [Corylus avellana]
 gb|ABG81299.1| pollen profilin variant 4 [Corylus avellana]
Length=133

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQ YVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQAYVDEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>gb|AHY24177.1| profilin, partial [Prosopis juliflora]
Length=133

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMC+IEG  N LSAAAILG+DGSVWAQSA+FPQ  P EI++++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGEPG V+RGKKGPGGIC+KKT Q L+ G+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTP  114



>sp|Q64LH2.1|PROF2_AMBAR RecName: Full=Profilin-2; AltName: Full=Pollen allergen A0418; 
AltName: Allergen=Amb a 8 [Ambrosia artemisiifolia]
 gb|AAP15201.1| profilin-like protein [Ambrosia artemisiifolia]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DG VWAQSA FPQ+ P EIT I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKTT  L+ G+YDEPM P
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMALIIGIYDEPMAP  112



>emb|CDP03236.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDIEG  + L+AAAILG DG+VWAQS+NFPQI P EI  I+ DFDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTGHHLTAAAILGHDGAVWAQSSNFPQIKPDEIKGIMTDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTGQALVFGIYEEPVTP  114



>ref|XP_010489131.1| PREDICTED: profilin-4 [Camelina sativa]
 ref|XP_010495948.1| PREDICTED: profilin-4 [Camelina sativa]
Length=134

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ+ P EIT I+KDFDEP
Sbjct  1    MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQLKPEEITGIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTGM ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_010915373.1| PREDICTED: profilin isoform X2 [Elaeis guineensis]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+I+G  L+AAAI+G DGSVWAQ ANFPQ  P EIT+I+ DFDEPGSL
Sbjct  1    MSWQTYVDDHLMCEIDGQHLTAAAIVGHDGSVWAQMANFPQFKPEEITAIMNDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGSVIRGKKGSGGVTVKKTNLALIIGIYDEPMTP  112



>ref|XP_010548681.1| PREDICTED: profilin [Tarenaya hassleriana]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN+L++AAI+G DGSVWAQS+ FPQ    EIT+I+KDF EPG+L
Sbjct  1    MSWQSYVDDHLMCDVEGNRLTSAAIIGQDGSVWAQSSTFPQFKAEEITAIMKDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEP  V+RGKKGPGG+ IKKT+Q L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPEAVIRGKKGPGGVTIKKTSQALVIGIYDEPMTP  112



>ref|XP_009405220.1| PREDICTED: profilin-1 [Musa acuminata subsp. malaccensis]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L++AAI+G DGSVWAQSA+FPQ  P EIT+I+ DF+EPG+L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIMGQDGSVWAQSASFPQFKPEEITNIINDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            AP G+ ++  KYMVIQGEPG V+RGKKG GGI +KKT Q L+FG+YDEPMTP
Sbjct  61   APIGLFLASTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIFGIYDEPMTP  112



>ref|XP_010267105.1| PREDICTED: profilin-2 [Nelumbo nucifera]
Length=131

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVDEHLMCDIEG++LSAAAI+G DGSVWAQS +FPQ    EI  I++DF EPG L
Sbjct  1    MSWQSYVDEHLMCDIEGHRLSAAAIIGHDGSVWAQSESFPQFKSEEINGIMQDFAEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI IKKT Q L+FGLY+EPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEQGSVIRGKKGTGGITIKKTNQALIFGLYEEPMTP  112



>gb|AAK59494.2| putative profilin protein [Arabidopsis thaliana]
Length=165

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  SKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            + MSWQTYVD+HLMCD+ GN+L+AAAILG DGSVWAQS NFPQ+ P EI  I  DF  PG
Sbjct  33   TNMSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPG  92

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTT  L+FG+YDEPMTP
Sbjct  93   TLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFGIYDEPMTP  146



>gb|EYU21444.1| hypothetical protein MIMGU_mgv1a016199mg [Erythranthe guttata]
Length=131

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC++EG  L+AAAI+GLDGSVWAQS+ FPQ +  E+ +I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCEVEGAHLAAAAIIGLDGSVWAQSSAFPQFNKQEMDNIVKDFDEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ ++GAKYMVIQGEPG V+RGKKG GGI +KKT Q L+FGLY+EPMTP
Sbjct  61   APTGLFLAGAKYMVIQGEPGAVIRGKKGSGGITVKKTAQALVFGLYEEPMTP  112



>ref|XP_009112626.1| PREDICTED: profilin-1-like [Brassica rapa]
 emb|CDY48724.1| BnaA09g09990D [Brassica napus]
 emb|CDY03344.1| BnaC09g10040D [Brassica napus]
Length=131

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+AAAILG DGSVWAQSANFPQ+   EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSANFPQLKTEEINGITKDFEEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + GAKYMVIQGEPG V+RGKKGPGG+ IKKTTQ L+ G+Y+EPMT
Sbjct  61   APTGLFLGGAKYMVIQGEPGAVIRGKKGPGGVTIKKTTQALVIGIYEEPMT  111



>gb|AAU43733.1| profilin, partial [Citrullus lanatus]
Length=131

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN L++AAI+G DGSVWA+S NFPQ+ P EIT IL DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G+KYMVIQGEPG V+RGKKGPGG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTP  112



>ref|XP_010416663.1| PREDICTED: profilin-4-like [Camelina sativa]
Length=134

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ+ P EIT I+KDFDEP
Sbjct  1    MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQLKPEEITGIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTGM ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GYLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_006356135.1| PREDICTED: profilin-1-like [Solanum tuberosum]
Length=131

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD++G++L++AAILG DGSVWAQS  FP+  P EI +I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDLDGHRLASAAILGFDGSVWAQSPAFPKFKPEEIINIMKDFDEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ +SGAKYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLFLSGAKYMVIQGEPGAVIRGKKGSGGITIKKTGQSLIFGIYEEPVTP  112



>ref|XP_009602785.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=131

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN L +AAI+G DG+VWAQSANFPQ  P EIT I+ DF EPG+L
Sbjct  1    MSWQTYVDDHLLCEIEGNHLISAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTP  112



>ref|XP_009102137.1| PREDICTED: profilin-4 [Brassica rapa]
 emb|CDY35887.1| BnaA07g01000D [Brassica napus]
Length=134

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVDEHLMCD+   +G+ L++AAI+GLDGSVWAQSANFPQ  P E+T I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCDVGDGQGHHLTSAAIIGLDGSVWAQSANFPQFKPQEMTDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGLFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_006853720.1| hypothetical protein AMTR_s00056p00160320 [Amborella trichopoda]
 gb|ERN15187.1| hypothetical protein AMTR_s00056p00160320 [Amborella trichopoda]
Length=131

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMC+I+G +LSAAAI+G DGSVWAQS NFPQ  P EI  I+ DF+EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGQRLSAAAIIGQDGSVWAQSDNFPQFKPDEINGIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++   KYMVIQGEPG V+RGKKG GG+ +KKT Q L+ G+YDEPMTP
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALILGIYDEPMTP  112



>sp|Q9FE63.1|PROF5_ARATH RecName: Full=Profilin-5 [Arabidopsis thaliana]
 gb|AAG10089.1|U43592_1 profilin [Arabidopsis thaliana]
 dbj|BAB09877.1| profilin-like protein [Arabidopsis thaliana]
 gb|AAM60876.1| profilin-like protein [Arabidopsis thaliana]
Length=131

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD+ GN+L+AAAILG DGSVWAQS NFPQ+ P EI  I  DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTT  L+FG+YDEPMTP
Sbjct  61   APTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFGIYDEPMTP  112



>sp|Q9XF39.1|PROF_PRUAV RecName: Full=Profilin; AltName: Full=Allergen Pru a 3; AltName: 
Allergen=Pru av 4 [Prunus avium]
 gb|AAD29411.1| profilin [Prunus avium]
Length=131

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP   P EI +ILKD D+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTP  112



>ref|NP_200471.2| profilin 3 [Arabidopsis thaliana]
 gb|AAN41285.1| putative profilin protein [Arabidopsis thaliana]
 gb|AED96785.1| profilin 3 [Arabidopsis thaliana]
Length=168

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  343  SKMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            + MSWQTYVD+HLMCD+ GN+L+AAAILG DGSVWAQS NFPQ+ P EI  I  DF  PG
Sbjct  36   TNMSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPG  95

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+ + G KYMVIQGEP  V+RGKKG GG+ IKKTT  L+FG+YDEPMTP
Sbjct  96   TLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFGIYDEPMTP  149



>ref|XP_008799778.1| PREDICTED: profilin-1 [Phoenix dactylifera]
Length=131

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMCD++G  L+AAAI+G DGSVWAQS++FPQ  P EIT+I+ DF EPGSL
Sbjct  1    MSWQTYVDEHLMCDLDGQHLTAAAIVGHDGSVWAQSSSFPQFKPEEITNIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++   KYMVIQGEPG V+RGKKG GG+ +KKT Q L+FG+Y+EPMTP
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTP  112



>sp|Q9XF37.1|PROF_APIGR RecName: Full=Profilin; AltName: Full=Minor pollen allergen Api 
g 4; AltName: Allergen=Api g 4 [Apium graveolens]
 gb|AAD29409.1| profilin [Apium graveolens]
Length=134

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGN---KLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVD+HLMC++EGN    L+AAAI+G DGSVWAQS+ FPQI P EI  I+KDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+++ GAKYMVIQGEP  V+RGKKG GG+ IKKT Q L+FG+YDEP+TP
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTP  115



>ref|XP_011005518.1| PREDICTED: profilin-6-like [Populus euphratica]
Length=131

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEGN L++AAI+G DGSVWAQSA+FPQ +  E+++I+KDF+EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWAQSASFPQFTQEEVSAIMKDFEEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GG+ +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTP  112



>sp|Q9SNW7.1|PROF1_LILLO RecName: Full=Profilin-1 [Lilium longiflorum]
 gb|AAF08302.1|AF200184_1 profilin 1 [Lilium longiflorum]
Length=131

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCD++G  L+A+AI+G DGS+WAQSA FPQ  P EIT I+ DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDVDGQHLTASAIVGHDGSIWAQSAGFPQFKPEEITGIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++++G KYMVIQGEPG V+RGKKG GG+ IKKT Q L+FG+Y+EPMTP
Sbjct  61   APTGLYLAGMKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPMTP  112



>ref|NP_179567.1| profilin 5 [Arabidopsis thaliana]
 sp|Q38905.1|PROF4_ARATH RecName: Full=Profilin-4 [Arabidopsis thaliana]
 gb|AAB39479.1| profilin 4 [Arabidopsis thaliana]
 gb|AAC62139.1| profilin 4 [Arabidopsis thaliana]
 gb|AAM62866.1| profilin 4 [Arabidopsis thaliana]
 gb|ABE65830.1| profilin 4 [Arabidopsis thaliana]
 gb|AEC06924.1| profilin 5 [Arabidopsis thaliana]
Length=134

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ  P EIT I+KDFDEP
Sbjct  1    MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEITDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTGM ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_006451339.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 ref|XP_006475347.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64579.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 gb|KDO55855.1| hypothetical protein CISIN_1g032811mg [Citrus sinensis]
Length=133

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI  +G  LSA+AI+G DGSVWAQSANFP+  P EI  I+KDFD+PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLSASAIVGHDGSVWAQSANFPKFKPEEIAGIMKDFDQPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GG+ IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTGQALVFGIYEEPVTP  114



>ref|XP_007223783.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 ref|XP_007223784.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 gb|EMJ24982.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 gb|EMJ24983.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
Length=243

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP   P EI +ILKDFD+PG+L
Sbjct  113  MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL  172

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  173  APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTP  224



>sp|A4K9Z8.1|PROF2_BETPN RecName: Full=Profilin-2; AltName: Full=Allergen Bet v II; AltName: 
Full=Pollen allergen Bet v 2; AltName: Allergen=Bet v 
2 [Betula pendula]
 gb|ABG48509.1| pollen profilin [Betula pendula]
Length=133

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ  P EIT I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>gb|ABK28500.1| unknown [Arabidopsis thaliana]
Length=135

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ  P EIT I+KDFDEP
Sbjct  1    MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEITDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTGM ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>gb|ABP58623.1| pollen allergen Ole e 2 [Olea europaea]
Length=134

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGN---KLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVD+HLMCDIEG+   +L+AAAI+G DGSVWAQSA FPQ  P E+  I+ DFDEP
Sbjct  1    MSWQTYVDDHLMCDIEGHEGHRLTAAAIVGQDGSVWAQSATFPQFKPEEMNGIMTDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  115



>ref|XP_002514198.1| profilin, putative [Ricinus communis]
 gb|EEF48152.1| profilin, putative [Ricinus communis]
Length=133

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G  L+AA+I+G DGS+WAQS++FPQ+ P EIT I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAASIVGHDGSIWAQSSSFPQLKPEEITGIMKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+HI G KYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHIGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_011081736.1| PREDICTED: profilin [Sesamum indicum]
Length=131

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMC+I+GN L++AAI+G DG+VWAQSANFPQ    EI +I+ DF+EPG L
Sbjct  1    MSWQSYVDDHLMCEIDGNHLTSAAIIGHDGAVWAQSANFPQFKAEEIAAIMDDFEEPGKL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKGPGGI +KKT Q LL G+YDEPMTP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTNQALLIGIYDEPMTP  112



>sp|O49894.1|PROF_MERAN RecName: Full=Profilin; AltName: Full=Pollen allergen Mer a 1; 
AltName: Allergen=Mer a 1 [Mercurialis annua]
 emb|CAA73720.1| Profilin [Mercurialis annua]
Length=133

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI  +G  L+AA+I+G DGS+WAQSA+FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG++I+G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_008795502.1| PREDICTED: profilin-1-like [Phoenix dactylifera]
Length=131

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+I+G+ L+AAAILG DGSVWAQS++FPQ    EIT+I+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++   KYMVIQGEPG V+RGKKG GG+ +KKT Q L+FG+Y+EPMTP
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTP  112



>ref|XP_010098156.1| hypothetical protein L484_026290 [Morus notabilis]
 gb|EXB74593.1| hypothetical protein L484_026290 [Morus notabilis]
Length=131

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+I+G+ L++AAI+GLDGSVWAQS++FPQ  P EI +I KDF EPGSL
Sbjct  1    MSWQTYVDDHLMCEIDGHHLTSAAIIGLDGSVWAQSSSFPQFKPEEIDAIKKDFGEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+H+ G KYMVIQGEPG V+RGKKG GGI +KKT   L+FG+YDEP+TP
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTDLALVFGIYDEPLTP  112



>gb|ACA49387.1| putative actin- and phospholipid-binding protein [Gerbera hybrid 
cultivar]
Length=131

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+IEGN LSAAAI+G DGSVWAQS  FPQ+ P EIT I+ DF+EPGS 
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSTTFPQVKPEEITGIMNDFNEPGSP  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGE G V+RGKKG GG+ IKKT   L+ G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTAMALIIGIYDEPMTP  112



>gb|ACP43298.1| Ama r 2 pollen allergen, partial [Amaranthus retroflexus]
Length=133

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQ YVD+HLMC+IEG  N L+ AAILGLDGSVWAQSA+FPQ  P EI +I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGEPG V+RGKKG GGIC+KKT Q L+ G+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTP  114



>ref|XP_010047663.1| PREDICTED: profilin-1-like [Eucalyptus grandis]
Length=131

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEGN L++AAI+G DGSVWAQS+ FPQ  P EI +I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCEIEGNHLTSAAIIGCDGSVWAQSSAFPQFKPEEIAAIIKDFDEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMVIQGEPG V+RGKKGPGG+ +KKT+Q L+ G+YDEPM 
Sbjct  61   APTGLFLGGMKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMN  111



>ref|XP_008242467.1| PREDICTED: profilin-4 [Prunus mume]
Length=133

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI  +G  LSAAAI+GLDGSVWA+SA+FPQ  P E+T I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLSAAAIIGLDGSVWAKSASFPQFKPEEMTGINKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGEPG V+RGKKG GGI IKKT Q L+FGLY+EP+TP
Sbjct  61   HLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGLYEEPVTP  114



>ref|NP_001056833.1| Os06g0152100 [Oryza sativa Japonica Group]
 sp|Q5VMJ3.1|PROFX_ORYSJ RecName: Full=Profilin LP04 [Oryza sativa Japonica Group]
 sp|P83647.2|PROFX_ORYSI RecName: Full=Profilin LP04 [Oryza sativa Indica Group]
 dbj|BAD69332.1| putative profilin [Oryza sativa Japonica Group]
 dbj|BAD69068.1| putative profilin [Oryza sativa Japonica Group]
 dbj|BAF18747.1| Os06g0152100 [Oryza sativa Japonica Group]
 gb|EAY99721.1| hypothetical protein OsI_21706 [Oryza sativa Indica Group]
 gb|EAZ35855.1| hypothetical protein OsJ_20153 [Oryza sativa Japonica Group]
 dbj|BAG86802.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00531.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMC+I+GN L+AAAI+G DGSVWAQS NFPQ  P EIT I+KDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCEIDGNHLTAAAIVGHDGSVWAQSPNFPQYKPEEITGIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPGVV+RGKKG GGIC+KKT   L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGICVKKTGLSLILGIYDEPMTP  112



>emb|CAK93757.1| profilin [Malus domestica]
Length=131

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN L+AAAILG  GSVWAQSA FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNSLTAAAILGQGGSVWAQSATFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTP  112



>ref|XP_003620753.1| Profilin [Medicago truncatula]
 gb|AES76971.1| profilin [Medicago truncatula]
Length=133

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI+G  + L+AAAILG DGSVWAQS +FPQ  P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGTGHHLTAAAILGHDGSVWAQSTSFPQFKPDEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTGMH+   KYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGMHLGEIKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_003568071.1| PREDICTED: profilin-2-like [Brachypodium distachyon]
Length=131

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVDEHLMC+IEG+ L +AAILG DG+VWAQSA FP   P E+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLGSAAILGHDGTVWAQSAAFPAFEPKEMTDIMKDFDEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTGM + GAKYMVI GEPG V+RGKKG GGI IKKT Q L+ G+YDEPMTP
Sbjct  61   APTGMFLGGAKYMVIAGEPGAVIRGKKGSGGITIKKTGQALVIGIYDEPMTP  112



>gb|AIV43662.1| profilin, partial [Vachellia farnesiana]
Length=133

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            M WQTYVD+HLMC+IEG  N LS AAILG+DGSVWAQSA+FPQ  P EI +++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            +LAPTG+H+ G KYMVIQGEPG  +RGKKGPGGIC+KKT Q L+FG+YDEP+TP
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTP  114



>pdb|1CQA|A Chain A, Birch Pollen Profilin
Length=133

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI--EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVDEHLMCDI  +G +L+A+AI+G DGSVWAQS++FPQ  P EIT I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGEELAASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>gb|AFK33983.1| unknown [Lotus japonicus]
Length=133

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI+G  + L+A+AI+G DGSVWAQS +FPQ+ P EIT I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGTGHHLTASAIVGHDGSVWAQSTSFPQLKPQEITGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H+ G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   FLAPTGLHLGGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_010925517.1| PREDICTED: profilin-1-like [Elaeis guineensis]
Length=175

 Score =   142 bits (357),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -1

Query  340  KMSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGS  161
            KMSWQ YVD+HLMC+IEGN+LSAAAI+G DG VWAQS  FPQ  P EI +I+ DF+EPGS
Sbjct  44   KMSWQNYVDDHLMCEIEGNRLSAAAIVGHDGFVWAQSDTFPQFKPEEIVAIMNDFNEPGS  103

Query  160  LAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            LAPTG+++ G KYMVIQGEPG V+RGKKGPGG+ IKKT Q L+ G+YDEP+TP
Sbjct  104  LAPTGLYLGGTKYMVIQGEPGFVIRGKKGPGGVTIKKTNQALIIGIYDEPLTP  156



>ref|XP_007152957.1| hypothetical protein PHAVU_004G174400g [Phaseolus vulgaris]
 gb|ESW24951.1| hypothetical protein PHAVU_004G174400g [Phaseolus vulgaris]
Length=133

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI+G  + LSAAAI+G DGSVWAQS+ FPQ+   EI  I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSAFPQVKSDEINGIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H++G KYMVIQGEPG V+RGKKG GGI IKKT Q L+FGLYDEP+TP
Sbjct  61   YLAPTGLHLAGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGLYDEPVTP  114



>ref|XP_011019559.1| PREDICTED: profilin [Populus euphratica]
Length=131

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHLMCDI+GN L++AAI+G DGSVWAQSA FPQ +  E+ +I+KDFDEPGSL
Sbjct  1    MSWQQYVDEHLMCDIDGNTLTSAAIIGHDGSVWAQSATFPQFTTEEVAAIMKDFDEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GG+ IKKT Q L+ G+YDEP+ P
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTNQALVIGVYDEPLAP  112



>ref|XP_002283490.1| PREDICTED: profilin-1 [Vitis vinifera]
 emb|CAN80411.1| hypothetical protein VITISV_018934 [Vitis vinifera]
 emb|CBI36040.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDI+GN L++AAI+G DGSVWAQS  FPQ  P EIT I+ DF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIDGNHLTSAAIIGHDGSVWAQSETFPQFKPEEITGIMNDFNEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKG GG+ IKKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPLTP  112



>ref|XP_003564682.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVDEHL+CDI+G +L+AAAILG DGSVWAQS +FPQ+ P E+T+++ DF+EPGSL
Sbjct  1    MSWQAYVDEHLLCDIDGQRLTAAAILGHDGSVWAQSESFPQVKPEEVTAVMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++++G KYMVIQGEPG V+RGKKGPGG+ IKKTT  ++ G+Y+EPMTP
Sbjct  61   APTGLYLAGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTLAIIIGIYEEPMTP  112



>emb|CAD46561.1| profilin [Malus domestica]
Length=131

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+G +L+AAAILG DGSVW+QSA+FP   P EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGYRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GGI IKKT+Q LL G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTP  112



>ref|XP_010914952.1| PREDICTED: profilin-1 [Elaeis guineensis]
Length=131

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYV+EHLMC+I+G  L+AAAI+G DGSVWAQS++FPQ  P EIT+I+ DF EPGSL
Sbjct  1    MSWQTYVEEHLMCEIDGQHLTAAAIVGHDGSVWAQSSSFPQFKPEEITNIMNDFAEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++   KYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+YDEPMTP
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYDEPMTP  112



>gb|KFK40342.1| hypothetical protein AALP_AA3G361600 [Arabis alpina]
Length=134

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ  P E+T I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGLFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_010433105.1| PREDICTED: profilin-2 [Camelina sativa]
 ref|XP_010438308.1| PREDICTED: profilin-2 [Camelina sativa]
Length=131

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+ AAI G DGSVWAQSA+FPQ+ PAEI  I KDF+E G L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTHAAIFGQDGSVWAQSASFPQLKPAEIEGINKDFEEAGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + G KYMV+QGE G V+RGKKGPGG+ IKKTTQ L+FG+YDEPMT
Sbjct  61   APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMT  111



>ref|XP_008798583.1| PREDICTED: profilin-1 [Phoenix dactylifera]
Length=131

 Score =   140 bits (352),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC+++G  L+AAAI+G DGSVWAQSANFPQ  P EIT+I+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEMDGQHLTAAAIVGHDGSVWAQSANFPQFKPEEITAIMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLFLGGTKYMVIQGEPGSVIRGKKGSGGVTVKKTNLALIIGIYDEPMTP  112



>gb|KFK40340.1| hypothetical protein AALP_AA3G361400 [Arabis alpina]
Length=131

 Score =   140 bits (352),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L++AAILG DGSVWAQSA FPQ+   EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNVLTSAAILGQDGSVWAQSAAFPQLKAEEIAGIKKDFEEPGHL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + GAKYMV+QGE G V+RGKKGPGG+ IKKT Q  +FGLYDEPMT
Sbjct  61   APTGLFLGGAKYMVVQGEAGAVIRGKKGPGGVTIKKTNQAFVFGLYDEPMT  111



>emb|CDY35886.1| BnaA07g01010D [Brassica napus]
Length=131

 Score =   140 bits (352),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ+YVD+HLMCD+EGN L+AAAILG DGSVWAQSA+FPQ+ P EI  I  DF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSADFPQLKPEEIKGITTDFEEPGFL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMT  5
            APTG+ + GAKYMVIQGEPG V+RGKKGPGG+ IKKTTQ L+ G+Y+EPMT
Sbjct  61   APTGLFLGGAKYMVIQGEPGAVIRGKKGPGGVTIKKTTQALVIGIYEEPMT  111



>emb|CAD92666.1| profilin [Cucumis melo]
Length=131

 Score =   140 bits (352),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP     EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTP  112



>emb|CDX81945.1| BnaC08g36560D [Brassica napus]
Length=134

 Score =   140 bits (352),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ  P E+T I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++G KYMVIQGEPG V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGLFLAGLKYMVIQGEPGAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>gb|ABD62998.1| profilin 2 [Mangifera indica]
Length=131

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDIEGN L+AAAILG DGSV AQSANFPQ+ P E+T I  DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCDIEGNHLAAAAILGQDGSVRAQSANFPQLKPEEVTGINNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+++ G KYMVIQGEPG V+RGKKGPGG+ +KKT+   + G+YDEPMTP
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSMAFVIGIYDEPMTP  112



>ref|XP_010249471.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN L+AAAI+G DGSVWAQS++FP+    EI SI+KDF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTAAAIIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEQGAVIRGKKGSGGITIKKTNQALIFGVYEEPVTP  112



>ref|XP_007160275.1| hypothetical protein PHAVU_002G307600g [Phaseolus vulgaris]
 sp|P49231.1|PROF1_PHAVU RecName: Full=Profilin-1 [Phaseolus vulgaris]
 emb|CAA57508.1| profilin [Phaseolus vulgaris]
 gb|ESW32269.1| hypothetical protein PHAVU_002G307600g [Phaseolus vulgaris]
Length=131

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HL+C+IEGN L+ AAILG DGSVWA+SA+FPQ  P EIT I+ DF+EPG+L
Sbjct  1    MSWQTYVDDHLLCEIEGNHLTHAAILGQDGSVWAKSASFPQFKPEEITGIMNDFNEPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG++I G KYMVIQGEPG V+RGKKGPGG+ +KKT   L+ G+YDEPMTP
Sbjct  61   APTGLYIGGTKYMVIQGEPGSVIRGKKGPGGVTVKKTNLALVIGIYDEPMTP  112



>ref|XP_009112628.1| PREDICTED: profilin-4-like [Brassica rapa]
Length=134

 Score =   140 bits (352),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVDEHLMCD+   +G+ LS+AAI+G DGSVWAQSANFPQ  P E+T I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCDVGDGQGHHLSSAAIIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++G KYMVIQGEPG V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGLFLAGLKYMVIQGEPGAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_009387128.1| PREDICTED: profilin-A-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMC++EG++L+AAAI+G DGSVWAQSA+FPQ  P E T+++ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCEVEGHRLTAAAIMGQDGSVWAQSASFPQFKPEEFTNVMNDFNEPGSL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            AP G+ I  +KYMVIQGE GVV+RGKKG GGI IKKT Q ++ GLYDEPMTP
Sbjct  61   APIGLFIGSSKYMVIQGESGVVIRGKKGSGGITIKKTGQAVVIGLYDEPMTP  112



>sp|P84177.2|PROF1_CITSI RecName: Full=Profilin; AltName: Allergen=Cit s 2 [Citrus sinensis]
 emb|CAI23765.1| profilin [Citrus sinensis]
Length=131

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQ YVD+HLMCDI+GN+L+AAAILG DGSVW+QSA FP     EI +ILKDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI +KKT Q L+ G+YDEP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTP  112



>ref|XP_009591293.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=134

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG---NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQTYVD+HLM DIEG   N L+AAAILG DGSVWAQS  FP+  P EIT+I+KDFDEP
Sbjct  1    MSWQTYVDDHLMADIEGQQGNHLAAAAILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++GAKYMVIQGEPG V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   GHLAPTGLFLAGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTP  115



>ref|XP_002883972.1| hypothetical protein ARALYDRAFT_480492 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60231.1| hypothetical protein ARALYDRAFT_480492 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDI---EGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEP  167
            MSWQ YVDEHLMCD+   +G+ L+AAAI+G DGSVWAQSANFPQ  P EIT I+KDFDEP
Sbjct  1    MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEITDIMKDFDEP  60

Query  166  GSLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            G LAPTG+ ++G KYMVIQGEP  V+RGKKG GGI IKKT Q ++FGLY+EP+TP
Sbjct  61   GHLAPTGLFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTP  115



>ref|XP_006584806.1| PREDICTED: profilin-like [Glycine max]
 gb|KHN16655.1| Profilin [Glycine soja]
Length=133

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEG--NKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPG  164
            MSWQTYVD+HLMCDI+G  + LS AAI+G DGSVWAQS++FPQI   EIT I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGTGHHLSDAAIIGHDGSVWAQSSSFPQIKSQEITDIMKDFDEPG  60

Query  163  SLAPTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
             LAPTG+H++G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   YLAPTGLHLAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTP  114



>ref|XP_010254422.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  337  MSWQTYVDEHLMCDIEGNKLSAAAILGLDGSVWAQSANFPQISPAEITSILKDFDEPGSL  158
            MSWQTYVD+HLMCDIEGN L+AAAI+G DGSVWAQS++FP+    EI SI+KDF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTAAAIIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYL  60

Query  157  APTGMHISGAKYMVIQgepgvvvrgkkgpggicikKTTQCLLFGLYDEPMTP  2
            APTG+ + G KYMVIQGE G V+RGKKG GGI IKKT Q L+FG+Y+EP+TP
Sbjct  61   APTGLFLGGTKYMVIQGEHGAVIRGKKGSGGITIKKTNQALIFGVYEEPVTP  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517724476692