BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13748_g1_i2 len=773 path=[679:0-578 1258:579-705 678:706-772]

Length=773
                                                                      Score     E

ref|XP_009789728.1|  PREDICTED: uncharacterized protein LOC104237307    235   2e-73   
ref|XP_009598743.1|  PREDICTED: uncharacterized protein LOC104094498    234   6e-73   
ref|XP_004249092.1|  PREDICTED: uncharacterized protein LOC101254251    226   1e-69   
ref|XP_006364749.1|  PREDICTED: uncharacterized protein LOC102598362    219   9e-67   
ref|XP_011079137.1|  PREDICTED: uncharacterized protein LOC105162730    201   3e-60   
ref|XP_007204727.1|  hypothetical protein PRUPE_ppa011317mg             183   3e-53   
ref|XP_008386556.1|  PREDICTED: uncharacterized protein LOC103449060    182   6e-53   
ref|XP_011040677.1|  PREDICTED: uncharacterized protein LOC105136874    181   2e-52   
ref|XP_010673230.1|  PREDICTED: uncharacterized protein LOC104889657    181   2e-52   
ref|XP_009345370.1|  PREDICTED: uncharacterized protein LOC103937...    180   4e-52   
ref|XP_008240597.1|  PREDICTED: uncharacterized protein LOC103339098    180   9e-52   
ref|XP_002307933.1|  hypothetical protein POPTR_0006s02720g             178   2e-51   Populus trichocarpa [western balsam poplar]
emb|CDP11654.1|  unnamed protein product                                179   3e-51   
ref|XP_008455777.1|  PREDICTED: uncharacterized protein LOC103495876    178   4e-51   
ref|XP_004144302.1|  PREDICTED: uncharacterized protein LOC101212...    177   1e-50   
ref|XP_004144303.1|  PREDICTED: uncharacterized protein LOC101212...    177   1e-50   
ref|XP_002527378.1|  conserved hypothetical protein                     176   3e-50   Ricinus communis
ref|XP_010251719.1|  PREDICTED: uncharacterized protein LOC104593525    172   1e-48   
ref|XP_006481974.1|  PREDICTED: uncharacterized protein LOC102609...    171   2e-48   
ref|XP_009345371.1|  PREDICTED: uncharacterized protein LOC103937...    170   4e-48   
gb|EYU20857.1|  hypothetical protein MIMGU_mgv1a026586mg                168   1e-47   
gb|KDO57352.1|  hypothetical protein CISIN_1g026815mg                   169   2e-47   
ref|XP_004287211.1|  PREDICTED: uncharacterized protein LOC101312662    168   3e-47   
ref|XP_006430430.1|  hypothetical protein CICLE_v10012641mg             168   3e-47   
ref|XP_010111293.1|  hypothetical protein L484_027946                   166   2e-46   
ref|XP_010525463.1|  PREDICTED: uncharacterized protein LOC104803253    164   6e-46   
emb|CDX72111.1|  BnaC08g27630D                                          162   4e-45   
gb|KDP30139.1|  hypothetical protein JCGZ_18134                         160   2e-44   
ref|XP_006291817.1|  hypothetical protein CARUB_v10017993mg             160   2e-44   
ref|XP_009116379.1|  PREDICTED: uncharacterized protein LOC103841...    160   2e-44   
emb|CDY27192.1|  BnaA09g36100D                                          160   2e-44   
ref|XP_010516283.1|  PREDICTED: uncharacterized protein LOC104791971    160   2e-44   
ref|XP_006402946.1|  hypothetical protein EUTSA_v10006232mg             160   2e-44   
gb|EYU20860.1|  hypothetical protein MIMGU_mgv1a019264mg                159   4e-44   
ref|XP_010504587.1|  PREDICTED: uncharacterized protein LOC104781575    159   6e-44   
ref|XP_009116378.1|  PREDICTED: uncharacterized protein LOC103841...    160   6e-44   
ref|XP_010427519.1|  PREDICTED: uncharacterized protein LOC104712341    159   6e-44   
ref|XP_007028181.1|  Uncharacterized protein isoform 1                  159   1e-43   
ref|XP_002878111.1|  hypothetical protein ARALYDRAFT_486120             158   1e-43   
ref|XP_002456510.1|  hypothetical protein SORBIDRAFT_03g037620          158   2e-43   Sorghum bicolor [broomcorn]
ref|NP_001152497.1|  LOC100286137                                       158   2e-43   Zea mays [maize]
gb|KFK34919.1|  hypothetical protein AALP_AA5G210600                    157   3e-43   
ref|XP_010922109.1|  PREDICTED: uncharacterized protein LOC105045504    155   4e-42   
ref|NP_567041.1|  uncharacterized protein                               154   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644878.1|  PREDICTED: uncharacterized protein LOC102719437    154   9e-42   
ref|XP_008811947.1|  PREDICTED: uncharacterized protein LOC103722963    152   3e-41   
gb|KHG09920.1|  hypothetical protein F383_13295                         150   2e-40   
ref|XP_004493283.1|  PREDICTED: uncharacterized protein LOC101489167    150   4e-40   
ref|XP_004970310.1|  PREDICTED: uncharacterized protein LOC101774892    149   4e-40   
ref|XP_003520355.1|  PREDICTED: uncharacterized protein LOC100807512    147   1e-39   
emb|CBI32851.3|  unnamed protein product                                147   2e-39   
ref|XP_002283750.1|  PREDICTED: uncharacterized protein LOC100249...    147   3e-39   Vitis vinifera
ref|XP_007161828.1|  hypothetical protein PHAVU_001G101300g             146   6e-39   
ref|XP_003564446.1|  PREDICTED: uncharacterized protein LOC100824167    145   2e-38   
ref|XP_010036422.1|  PREDICTED: uncharacterized protein LOC104425419    144   6e-38   
ref|XP_003554079.1|  PREDICTED: uncharacterized protein LOC100782059    143   9e-38   
ref|XP_010653667.1|  PREDICTED: uncharacterized protein LOC100249...    142   2e-37   
ref|NP_001044582.1|  Os01g0810200                                       142   2e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CAC00745.1|  hypothetical protein                                   142   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ABN05965.1|  Cupin, RmlC-type                                        142   3e-37   Medicago truncatula
gb|KHN34590.1|  hypothetical protein glysoja_011143                     138   9e-37   
ref|XP_003624824.1|  hypothetical protein MTR_7g088040                  142   3e-36   
ref|XP_006430429.1|  hypothetical protein CICLE_v10012641mg             137   4e-36   
tpg|DAA57181.1|  TPA: hypothetical protein ZEAMMB73_212841              137   6e-36   
emb|CDM84637.1|  unnamed protein product                                137   2e-35   
ref|XP_009410442.1|  PREDICTED: uncharacterized protein LOC103992466    135   2e-34   
ref|XP_007028182.1|  Uncharacterized protein isoform 2                  130   1e-33   
ref|XP_006832889.1|  hypothetical protein AMTR_s00095p00110450          124   2e-30   
gb|ADE77103.1|  unknown                                                 122   2e-30   
emb|CAN63125.1|  hypothetical protein VITISV_010768                     105   7e-24   Vitis vinifera
gb|KHN24203.1|  Aspartic proteinase                                   91.3    2e-18   
ref|XP_010463013.1|  PREDICTED: uncharacterized protein LOC104743658  77.4    1e-14   
ref|XP_006589103.1|  PREDICTED: uncharacterized protein LOC102659...  65.9    5e-10   
ref|XP_002509315.1|  predicted protein                                64.3    6e-09   Micromonas commoda



>ref|XP_009789728.1| PREDICTED: uncharacterized protein LOC104237307 [Nicotiana sylvestris]
Length=233

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 149/199 (75%), Gaps = 18/199 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSP-ATVVSSLKSFLKKPHAfpfllsfflllTWV  374
            MANPRR  F  SG HHQLP+S   G Q+  +T +SSL SFLKKPHAFPFLLS FL LTWV
Sbjct  1    MANPRRISFSPSGNHHQLPISAAAGFQNQTSTQMSSLISFLKKPHAFPFLLSLFLFLTWV  60

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHW------SSNEDNSANLVRFPASSPLVAKDKRG  536
            + RFQRPS+            +  R  W      SS  D  ANL+RFPASS  +AKDKRG
Sbjct  61   SLRFQRPSD-----------SSHQREEWHPAKFYSSGSDQMANLLRFPASSSSIAKDKRG  109

Query  537  WLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLEN  716
            WLLNPISLALDS++SGG   CAS+H+GEI+PGGVRGNHRHHTCNETFVIWGA T+FRLEN
Sbjct  110  WLLNPISLALDSALSGGAADCASVHLGEIRPGGVRGNHRHHTCNETFVIWGAKTVFRLEN  169

Query  717  NAIQKGYAEVKLGADEVAV  773
            +A++KGYAEV + ADEVAV
Sbjct  170  DAVKKGYAEVIIDADEVAV  188



>ref|XP_009598743.1| PREDICTED: uncharacterized protein LOC104094498 [Nicotiana tomentosiformis]
Length=232

 Score =   234 bits (597),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 145/198 (73%), Gaps = 17/198 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR  F  SG HHQLP+S  G     +T +SSL SFLKKPHAFPFLLS FL LTWV+
Sbjct  1    MANPRRISFSPSGNHHQLPISAAGFQNQTSTRMSSLISFLKKPHAFPFLLSLFLFLTWVS  60

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHW------SSNEDNSANLVRFPASSPLVAKDKRGW  539
             RFQRPS+            +  R  W      SS  D  ANLVRFPASS  +AKDKRGW
Sbjct  61   LRFQRPSD-----------SSHQREEWHPAKIHSSGSDQMANLVRFPASSSSIAKDKRGW  109

Query  540  LLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENN  719
            LLNPISLALDS++SGG   C S+H+GEIK GGVRGNHRHHTCNETFVIWGA T+FRLEN+
Sbjct  110  LLNPISLALDSALSGGAAVCTSVHLGEIKSGGVRGNHRHHTCNETFVIWGAKTVFRLEND  169

Query  720  AIQKGYAEVKLGADEVAV  773
            A++ GYAEV +GADEVAV
Sbjct  170  AVKNGYAEVIIGADEVAV  187



>ref|XP_004249092.1| PREDICTED: uncharacterized protein LOC101254251 [Solanum lycopersicum]
Length=236

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 150/202 (74%), Gaps = 22/202 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGT--HHQLPVSTG----GGDQSPATVVSSLKSFLKKPHAfpfllsffl  359
            MANPRRT F +SG   HHQLP+ST      G Q  +++++SLKSFLKKPHAFPFLLS FL
Sbjct  2    MANPRRTTFSSSGNQNHHQLPISTAPFQNQGTQ-ISSLMNSLKSFLKKPHAFPFLLSLFL  60

Query  360  llTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHW----SSNEDNSANLVRFPASSPLVAKD  527
             LTWV+ RFQ PS   P            R  W     S  D +ANLVRF ASS  +AKD
Sbjct  61   FLTWVSLRFQHPSTSNPQ-----------REEWHAKVQSGSDQNANLVRFSASSSSIAKD  109

Query  528  KRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFR  707
            KRGWL+NPISLALDS+ISGG   CAS+H+GEI+ GG+RGNHRHHTCNETFVIWGA T+FR
Sbjct  110  KRGWLINPISLALDSAISGGAAVCASVHLGEIRSGGLRGNHRHHTCNETFVIWGAKTVFR  169

Query  708  LENNAIQKGYAEVKLGADEVAV  773
            +EN+A++KGYAEV +GADEVAV
Sbjct  170  VENDAVEKGYAEVIIGADEVAV  191



>ref|XP_006364749.1| PREDICTED: uncharacterized protein LOC102598362 [Solanum tuberosum]
Length=239

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 148/206 (72%), Gaps = 26/206 (13%)
 Frame = +3

Query  198  MANPRRTLFPASGT--HHQLPVSTG--------GGDQSPATVVSSLKSFLKKPHAfpfll  347
            MANPRRT F  SG   H QLP+ST          G Q  +++++SLKSFLKKPHAFPFLL
Sbjct  1    MANPRRTSFSPSGNQNHQQLPISTSPFQNQNQNQGTQ-ISSLMNSLKSFLKKPHAFPFLL  59

Query  348  sfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHW----SSNEDNSANLVRFPASSPL  515
            S FL LTWV+ RFQRPS   P            R  W     S  D +ANLVRF  SS  
Sbjct  60   SLFLFLTWVSLRFQRPSTSTPH-----------REEWHAKVQSGSDQNANLVRFLDSSSS  108

Query  516  VAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAH  695
            +AKDKRGWL+NPISLALDS+ISGG   CAS+H+GEI+ GG+RGNHRHHTCNETFVIWGA 
Sbjct  109  IAKDKRGWLINPISLALDSAISGGAAVCASVHLGEIRSGGLRGNHRHHTCNETFVIWGAK  168

Query  696  TLFRLENNAIQKGYAEVKLGADEVAV  773
            T+FR+EN+A++KGYAEV +GADEVAV
Sbjct  169  TVFRVENDAVKKGYAEVIIGADEVAV  194



>ref|XP_011079137.1| PREDICTED: uncharacterized protein LOC105162730 [Sesamum indicum]
Length=237

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 144/200 (72%), Gaps = 15/200 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVST--------GGGDQSPATVVSSLKSFLKKPHAfpfllsf  353
            MANPRRT    S + + LP+S             Q+ AT+++SLK FLKKPHAFPFLLS 
Sbjct  1    MANPRRT----SYSSNPLPISDPTPQFQSPSQNPQTAATLLTSLKVFLKKPHAFPFLLSI  56

Query  354  flllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKR  533
            FLLLTWV+ RFQ     + +         +  ++    +D +AN+V+F A S LV KDKR
Sbjct  57   FLLLTWVSLRFQ---HRYANPAFHQSSYTVNEKNGGYVKDPNANVVKFSAFSSLVMKDKR  113

Query  534  GWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLE  713
            GWL+NP+SLALD+ + GG +SCAS+H+GEI+PG VRGNHRHHTCNETFVIWGA T+FRLE
Sbjct  114  GWLINPVSLALDADVPGGAVSCASVHLGEIRPGTVRGNHRHHTCNETFVIWGAKTVFRLE  173

Query  714  NNAIQKGYAEVKLGADEVAV  773
            NNA+++GY+EV +GADEVAV
Sbjct  174  NNAVKRGYSEVTIGADEVAV  193



>ref|XP_007204727.1| hypothetical protein PRUPE_ppa011317mg [Prunus persica]
 gb|EMJ05926.1| hypothetical protein PRUPE_ppa011317mg [Prunus persica]
Length=215

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 129/196 (66%), Gaps = 14/196 (7%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +    H   +             SSL  FLKKPHAFPFLLS  LLLTWV+
Sbjct  1    MANPRRNSQSSENQFHSQSIQ----------FSSSLVHFLKKPHAFPFLLSILLLLTWVS  50

Query  378  FRFQRPS--EHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSP-LVAKDKRGWLLN  548
             R Q  S     PS         +  + WS   D+SAN++RF +  P  +AKDKRGWLL+
Sbjct  51   LRLQHSSYLSSAPSHISKDKDKPLTHKKWSQLSDSSANVIRFSSGFPSRIAKDKRGWLLD  110

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            PISLALDS ISGG + C SIH+GEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ + 
Sbjct  111  PISLALDSGISGGAVGCVSIHLGEIQPGGLRGNHRHHTCNETFVIWGAETKFRLENHQVD  170

Query  729  -KGYAEVKLGADEVAV  773
             KGYAEV +GADEVAV
Sbjct  171  GKGYAEVTIGADEVAV  186



>ref|XP_008386556.1| PREDICTED: uncharacterized protein LOC103449060 [Malus domestica]
Length=228

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 130/193 (67%), Gaps = 16/193 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +    H   +++           SS+  FLKKPHAFPFLLS FL LTWV+
Sbjct  1    MANPRRNTQSSENPFHAQTLTS-----------SSVTHFLKKPHAFPFLLSIFLFLTWVS  49

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWLLNPI  554
             R Q    H  S    S   +   + WS + D+ ANLVRF +  P  +AKDKRGW L+PI
Sbjct  50   LRLQ----HSSSPSRFSINRDDAHKKWSQSSDSRANLVRFGSGFPSPIAKDKRGWFLDPI  105

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
            SLA DS ISGG +SC S+H+GEI+PGG+RGNHRHH+CNETFVIWGA T FRLEN+ + +G
Sbjct  106  SLAKDSRISGGALSCVSLHLGEIRPGGLRGNHRHHSCNETFVIWGAETRFRLENDQVDEG  165

Query  735  YAEVKLGADEVAV  773
            YAEV +GADEVAV
Sbjct  166  YAEVTIGADEVAV  178



>ref|XP_011040677.1| PREDICTED: uncharacterized protein LOC105136874 [Populus euphratica]
Length=222

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 130/193 (67%), Gaps = 17/193 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR  + ++ T +   +          + +SS+K FLKKP AFPFLLS FLLL W++
Sbjct  1    MANPRRNSY-SNNTENSFQLQN-------LSRLSSIKHFLKKPLAFPFLLSIFLLLAWIS  52

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLNPIS  557
             R Q  S             N+  R WS  ED  ANL+RF  S  L +KDKRGWLL+P+S
Sbjct  53   LRLQHSSS-------SFSSTNLHERKWSQEEDEKANLIRFK-SGFLSSKDKRGWLLDPVS  104

Query  558  LALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-QKG  734
            +AL+  I GG +SC SIHVGEI+PGGVRGNHRHHTCNETFVIWGA TLFRLENN I  KG
Sbjct  105  IALEYGIKGGAVSCFSIHVGEIRPGGVRGNHRHHTCNETFVIWGAKTLFRLENNQIVDKG  164

Query  735  YAEVKLGADEVAV  773
            YAEV +G DEVAV
Sbjct  165  YAEVIVGVDEVAV  177



>ref|XP_010673230.1| PREDICTED: uncharacterized protein LOC104889657 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 135/193 (70%), Gaps = 16/193 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            M NPRR+ + +SG   + P       Q+ +  +SS+ + LKKP AFPFLLS F+LLTWV+
Sbjct  1    MVNPRRSSYVSSGQSSENPF------QTQSFSLSSILNLLKKPQAFPFLLSIFILLTWVS  54

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLNPIS  557
             +FQ  S   P        +    + WS +ED  ANL+RF   S L  KDKRGWLLNP++
Sbjct  55   LKFQHSSHFSP--------LYQNPKKWSKDEDLKANLIRF-LPSKLAKKDKRGWLLNPVA  105

Query  558  LALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENN-AIQKG  734
             ALD+ ISGG +SCAS+HVGEI+PGG+RGNHRH+TCNETF+IWGA   FRLEN+  + KG
Sbjct  106  AALDAGISGGAVSCASVHVGEIRPGGIRGNHRHYTCNETFIIWGARIKFRLENSQVVDKG  165

Query  735  YAEVKLGADEVAV  773
            YAEV++GADEVAV
Sbjct  166  YAEVEIGADEVAV  178



>ref|XP_009345370.1| PREDICTED: uncharacterized protein LOC103937178 isoform X1 [Pyrus 
x bretschneideri]
Length=223

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 130/193 (67%), Gaps = 16/193 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +    H   +++           SS+  FLKKPHAFPFLLS FL LTWV+
Sbjct  1    MANPRRNTQSSENPFHTQTLTS-----------SSVTHFLKKPHAFPFLLSIFLFLTWVS  49

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWLLNPI  554
             R Q    H  S    S   +   + WS + D+ ANLVRF +  P  +AKDKRGWLL+PI
Sbjct  50   LRLQ----HSSSPSRFSINKDDAHKKWSQSSDSRANLVRFGSGFPSPIAKDKRGWLLDPI  105

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
            SLA DS ISGG +SC S+H+GEI+PGG+RGNHRH++CNETFVIWGA T FRLE + + +G
Sbjct  106  SLAKDSRISGGALSCVSLHLGEIRPGGLRGNHRHYSCNETFVIWGAETRFRLETDQVDEG  165

Query  735  YAEVKLGADEVAV  773
            YAEV +GADEVAV
Sbjct  166  YAEVTIGADEVAV  178



>ref|XP_008240597.1| PREDICTED: uncharacterized protein LOC103339098 [Prunus mume]
Length=231

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 129/196 (66%), Gaps = 14/196 (7%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +    H   +             SSL  FLKKPHAFPFLLS FLLLTWV+
Sbjct  1    MANPRRNSQSSENPFHTQSIQFS----------SSLVHFLKKPHAFPFLLSIFLLLTWVS  50

Query  378  FRFQRPS--EHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSP-LVAKDKRGWLLN  548
             R Q  S     PS         +  + WS   D+SANL+RF +  P  +AKDKRGWLL+
Sbjct  51   LRLQHSSYLSSAPSHISKDKDKPLTHKKWSQLSDSSANLIRFSSGFPSRIAKDKRGWLLD  110

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            PISLAL S ISGG +SC SIH+GEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ + 
Sbjct  111  PISLALASGISGGAVSCVSIHLGEIQPGGLRGNHRHHTCNETFVIWGAETKFRLENHQVD  170

Query  729  -KGYAEVKLGADEVAV  773
              GYAEV +GADEVAV
Sbjct  171  GNGYAEVTIGADEVAV  186



>ref|XP_002307933.1| hypothetical protein POPTR_0006s02720g [Populus trichocarpa]
 gb|EEE91456.1| hypothetical protein POPTR_0006s02720g [Populus trichocarpa]
Length=222

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 129/193 (67%), Gaps = 17/193 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR  + ++ T +   +          + +SS+K FLKKP AFPFLLS FLLL W++
Sbjct  1    MANPRRNSY-SNNTENSFQLQN-------HSRLSSIKHFLKKPLAFPFLLSIFLLLAWIS  52

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLNPIS  557
             R Q  S             N+  R WS  ED  ANL+RF  S  L +KDKRGWLL+P+S
Sbjct  53   LRLQHSSS-------SFSSSNLHERKWSQEEDEKANLIRFK-SGFLSSKDKRGWLLDPVS  104

Query  558  LALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-QKG  734
            +AL+  I GG +SC SIH+GEI+PGG RGNHRHHTCNETFVIWGA TLFRLENN I  KG
Sbjct  105  IALEYGIKGGAVSCFSIHIGEIRPGGARGNHRHHTCNETFVIWGAKTLFRLENNQIVDKG  164

Query  735  YAEVKLGADEVAV  773
            YAEV +G DEVAV
Sbjct  165  YAEVIVGVDEVAV  177



>emb|CDP11654.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 128/190 (67%), Gaps = 14/190 (7%)
 Frame = +3

Query  219  LFPASGTHHQLPVSTGGGDQSPATV--VSSLKSFLKKPHAfpfllsfflllTWVTFRFQR  392
            L P S T++           + AT+  V+S+K FL+KPHAFPFLLS FL LTWV+ R Q 
Sbjct  25   LLPISDTNNNNNQFQSQATAATATIRLVNSIKIFLRKPHAFPFLLSIFLFLTWVSLRIQH  84

Query  393  ---PSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLNPISLA  563
               P   F +  L  G  N G+       D  ANLVRF + S  + KDKRGW ++P+SL 
Sbjct  85   HQHPRSDFNTWALKLG--NKGK-------DEDANLVRFHSMSSSIVKDKRGWFVDPVSLG  135

Query  564  LDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKGYAE  743
            L + ISGG  +CAS+H+GEI+ GGVRGNHRHH+CNETFVIWGA TLFRLENN + KGYAE
Sbjct  136  LQAGISGGATNCASVHIGEIRAGGVRGNHRHHSCNETFVIWGAKTLFRLENNLVDKGYAE  195

Query  744  VKLGADEVAV  773
            V +GADEVAV
Sbjct  196  VIVGADEVAV  205



>ref|XP_008455777.1| PREDICTED: uncharacterized protein LOC103495876 [Cucumis melo]
Length=241

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 134/202 (66%), Gaps = 16/202 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPA--------TVVSSLKSFLKKPHAfpfllsf  353
            MANPRR     S + +   + +    QS A           S LK+FLKKPHAFPFLLS 
Sbjct  1    MANPRRNSISFSSSTNPQSLESPFHSQSQARSLSLSLALSFSHLKNFLKKPHAFPFLLSI  60

Query  354  flllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDK  530
            FLLLTWV+ R Q  S  F S        +     WS ++D  ANLVRF +  P  +AKD 
Sbjct  61   FLLLTWVSLRIQHSSSQFSSR------YHQAPDSWSRDDDLKANLVRFKSGFPSPIAKDN  114

Query  531  RGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            RGWLL+PISLAL S I+GG ++CAS+H+GEI+PG +RGNHRHHTCNETFV+WGA T FRL
Sbjct  115  RGWLLDPISLALGSGITGGAVTCASVHIGEIQPGAMRGNHRHHTCNETFVLWGARTKFRL  174

Query  711  ENNAI-QKGYAEVKLGADEVAV  773
            ENN +  KGYAEV +GADEVA+
Sbjct  175  ENNNVGDKGYAEVIIGADEVAI  196



>ref|XP_004144302.1| PREDICTED: uncharacterized protein LOC101212156 isoform 1 [Cucumis 
sativus]
 ref|XP_004169822.1| PREDICTED: uncharacterized protein LOC101231634 isoform 1 [Cucumis 
sativus]
 gb|KGN54648.1| hypothetical protein Csa_4G416440 [Cucumis sativus]
Length=241

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 133/202 (66%), Gaps = 16/202 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPA--------TVVSSLKSFLKKPHAfpfllsf  353
            MANPRR     S + +   + +    QS A           S LK+FLKKPHAFPFLLS 
Sbjct  1    MANPRRNSISFSSSTNPQSLESPFHSQSQARSLSLSLALSFSHLKNFLKKPHAFPFLLSV  60

Query  354  flllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDK  530
            FLLLTW+  R Q  S  F S        +     WS ++D  ANLVRF +  P  +AKD 
Sbjct  61   FLLLTWIFLRIQHSSSQFSSR------YHQATDSWSRDDDLKANLVRFNSGFPSPIAKDN  114

Query  531  RGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            RGWLL+PISLAL S I+GG ++CAS+H+GEI+PG +RGNHRHHTCNETFV+WGA T FRL
Sbjct  115  RGWLLDPISLALGSGITGGAVTCASVHIGEIQPGAMRGNHRHHTCNETFVLWGARTKFRL  174

Query  711  ENNAI-QKGYAEVKLGADEVAV  773
            ENN +  KGYAEV +GADEVA+
Sbjct  175  ENNNVGDKGYAEVIIGADEVAI  196



>ref|XP_004144303.1| PREDICTED: uncharacterized protein LOC101212156 isoform 2 [Cucumis 
sativus]
 ref|XP_004169823.1| PREDICTED: uncharacterized protein LOC101231634 isoform 2 [Cucumis 
sativus]
Length=240

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 133/202 (66%), Gaps = 16/202 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPA--------TVVSSLKSFLKKPHAfpfllsf  353
            MANPRR     S + +   + +    QS A           S LK+FLKKPHAFPFLLS 
Sbjct  1    MANPRRNSISFSSSTNPQSLESPFHSQSQARSLSLSLALSFSHLKNFLKKPHAFPFLLSV  60

Query  354  flllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDK  530
            FLLLTW+  R Q  S  F S        +     WS ++D  ANLVRF +  P  +AKD 
Sbjct  61   FLLLTWIFLRIQHSSSQFSSR------YHQATDSWSRDDDLKANLVRFNSGFPSPIAKDN  114

Query  531  RGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            RGWLL+PISLAL S I+GG ++CAS+H+GEI+PG +RGNHRHHTCNETFV+WGA T FRL
Sbjct  115  RGWLLDPISLALGSGITGGAVTCASVHIGEIQPGAMRGNHRHHTCNETFVLWGARTKFRL  174

Query  711  ENNAI-QKGYAEVKLGADEVAV  773
            ENN +  KGYAEV +GADEVA+
Sbjct  175  ENNNVGDKGYAEVIIGADEVAI  196



>ref|XP_002527378.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35003.1| conserved hypothetical protein [Ricinus communis]
Length=232

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 13/196 (7%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR+ +  S  +   P       +     +SSLK FLKKPHAFPFLLS FL LTW++
Sbjct  1    MANPRRSSYSNSSEN---PFQVQNLSR-----LSSLKHFLKKPHAFPFLLSIFLFLTWLS  52

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPA---SSPLVAKDKRGWLLN  548
             + Q  +    +    S      +   +  +D +ANL+RF +   +SP++ KDKRGWLL+
Sbjct  53   LKLQHRNASNFASSSSSSFNLHQQTKSTKVDDKNANLIRFKSDFFASPII-KDKRGWLLD  111

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-  725
            P+SLALDS I+GG +SCAS+HVGEI+PG VRGNHRH+TCNETFVIWGA TLFRLEN  I 
Sbjct  112  PVSLALDSGITGGAVSCASLHVGEIRPGTVRGNHRHYTCNETFVIWGAKTLFRLENGQIV  171

Query  726  QKGYAEVKLGADEVAV  773
             KGYAEV +GADEVA+
Sbjct  172  DKGYAEVVIGADEVAI  187



>ref|XP_010251719.1| PREDICTED: uncharacterized protein LOC104593525 [Nelumbo nucifera]
Length=239

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 129/198 (65%), Gaps = 10/198 (5%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATV----VSSLKSFLKKPHAfpfllsfflll  365
            MANPRR+ +  + +  +   S     ++P       +SSL  FLK+PHAFPFLLS F+LL
Sbjct  1    MANPRRSSYSNNPSSERSSYSNNPSSENPLQTHFLSLSSLIYFLKRPHAFPFLLSVFILL  60

Query  366  TWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWL  542
            TWV  R Q    H               + W   +D  ANLVRF +  P  +++D+RGWL
Sbjct  61   TWVFLRLQ----HLQYFSFHQQDQYQENQKWRREDDGKANLVRFSSGFPSPISRDRRGWL  116

Query  543  LNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNA  722
            LNP++ A ++ ISGG ++CAS+HVGEI+PGGVRGNHRHH+CNETF+IWGA T FRLENN 
Sbjct  117  LNPVTAANEAGISGGAITCASVHVGEIRPGGVRGNHRHHSCNETFIIWGAKTKFRLENND  176

Query  723  IQ-KGYAEVKLGADEVAV  773
            I  KGYAEV + A E+A+
Sbjct  177  IVGKGYAEVTISAKELAI  194



>ref|XP_006481974.1| PREDICTED: uncharacterized protein LOC102609306 isoform X1 [Citrus 
sinensis]
Length=232

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 130/198 (66%), Gaps = 17/198 (9%)
 Frame = +3

Query  195  QMANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWV  374
            ++ NPRR  F  +  +   P +         + VS L +FLK+P AFPFLLS F+LLTW+
Sbjct  2    RIPNPRRGSFSNTQQNPDNPFNVQN-----LSTVSILLNFLKRPQAFPFLLSIFVLLTWL  56

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNS--ANLVRFPAS--SPLVAKDKRGWL  542
            + R Q  S HF        +       WSS +D+   ANLVRF +     L+ KD+RGWL
Sbjct  57   SLRLQHSSSHFE-------LNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWL  109

Query  543  LNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNA  722
            LNPISLA+D+ + GG +SC S+HVGEI+PG +RGNHRH+T NETFVIWGA T FRLENN 
Sbjct  110  LNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQ  169

Query  723  I-QKGYAEVKLGADEVAV  773
            I  KGYAEV +GADEVA+
Sbjct  170  IDDKGYAEVIVGADEVAI  187



>ref|XP_009345371.1| PREDICTED: uncharacterized protein LOC103937178 isoform X2 [Pyrus 
x bretschneideri]
Length=218

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 128/193 (66%), Gaps = 21/193 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +    H   +++           SS+  FLKKPHAFPFLLS FL LTWV+
Sbjct  1    MANPRRNTQSSENPFHTQTLTS-----------SSVTHFLKKPHAFPFLLSIFLFLTWVS  49

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWLLNPI  554
             R Q    H  S    S   +   + WS + D+ ANLVRF +  P  +AKDKRGWLL+PI
Sbjct  50   LRLQ----HSSSPSRFSINKDDAHKKWSQSSDSRANLVRFGSGFPSPIAKDKRGWLLDPI  105

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
            SLA DS ISGG +SC S+H+GEI+PGG+RGNHRH++CNETFVIWGA T FR++     +G
Sbjct  106  SLAKDSRISGGALSCVSLHLGEIRPGGLRGNHRHYSCNETFVIWGAETRFRVD-----EG  160

Query  735  YAEVKLGADEVAV  773
            YAEV +GADEVAV
Sbjct  161  YAEVTIGADEVAV  173



>gb|EYU20857.1| hypothetical protein MIMGU_mgv1a026586mg [Erythranthe guttata]
Length=200

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 11/152 (7%)
 Frame = +3

Query  321  KPHAfpfllsfflllTWVTFRFQ----RPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANL  488
            KPHA PFLLSFFL+LTW++ RFQ    +PS H  S      +    +       D++AN+
Sbjct  8    KPHAIPFLLSFFLILTWISLRFQHRYAKPSFHQSSYTANDKLGGFLK-------DSTANV  60

Query  489  VRFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCN  668
            V+F +SS LV KDKRGWL++P+ LALD+ ISGG +SCASIHVGEI+PG +RGNHRHHTCN
Sbjct  61   VKFSSSSSLVMKDKRGWLIDPVLLALDAGISGGAVSCASIHVGEIRPGSMRGNHRHHTCN  120

Query  669  ETFVIWGAHTLFRLENNAIQKGYAEVKLGADE  764
            ETFV+WGA T+ RLENNA+  GY+EV +GADE
Sbjct  121  ETFVVWGAKTVLRLENNAVTSGYSEVTVGADE  152



>gb|KDO57352.1| hypothetical protein CISIN_1g026815mg [Citrus sinensis]
Length=232

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 129/198 (65%), Gaps = 17/198 (9%)
 Frame = +3

Query  195  QMANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWV  374
            ++ NPRR  F  +  +   P +         + VS L +FLK+P AFPFLLS F+LLTW+
Sbjct  2    RIPNPRRGSFSNTQQNPDNPFNVQN-----LSTVSILLNFLKRPQAFPFLLSIFVLLTWL  56

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNS--ANLVRFPAS--SPLVAKDKRGWL  542
            + R Q  S  F        +       WSS +D+   ANLVRF +     L+ KD+RGWL
Sbjct  57   SLRLQHSSSQFE-------LNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWL  109

Query  543  LNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNA  722
            LNPISLA+D+ + GG +SC S+HVGEI+PG +RGNHRH+T NETFVIWGA T FRLENN 
Sbjct  110  LNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQ  169

Query  723  I-QKGYAEVKLGADEVAV  773
            I  KGYAEV +GADEVA+
Sbjct  170  IDDKGYAEVIVGADEVAI  187



>ref|XP_004287211.1| PREDICTED: uncharacterized protein LOC101312662 [Fragaria vesca 
subsp. vesca]
Length=231

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 130/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR    +  + +   + +     + +   SSL  FLKKPHA PFLLS FLLLTWV+
Sbjct  1    MANPRRN---SQSSENPFHIQSRSLSLNLSVSWSSLVLFLKKPHALPFLLSIFLLLTWVS  57

Query  378  FRFQRPSE-HFPSMG--LGSGIMNMGRRHWSSNEDNSANLVRFPASSP-LVAKDKRGWLL  545
             R Q  S  H P++   L   I           +D  ANLVRF +  P  +AKDKRGWLL
Sbjct  58   LRLQHSSSLHSPNLSKPLEKNI----------KDDGKANLVRFGSGFPSQIAKDKRGWLL  107

Query  546  NPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI  725
            +PISLA    ISGG + CAS+H+GE++PGG+RGNHRHH+CNETFVIWGA T FRLEN+ +
Sbjct  108  DPISLAQHYGISGGAVICASVHLGEVRPGGLRGNHRHHSCNETFVIWGAETRFRLENSKV  167

Query  726  -QKGYAEVKLGADEVAV  773
              KGYAEV +GADEVAV
Sbjct  168  DDKGYAEVTIGADEVAV  184



>ref|XP_006430430.1| hypothetical protein CICLE_v10012641mg [Citrus clementina]
 gb|ESR43670.1| hypothetical protein CICLE_v10012641mg [Citrus clementina]
Length=232

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 17/198 (9%)
 Frame = +3

Query  195  QMANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWV  374
            ++ NPRR  F  +  +   P +         + VS + +FLK+P AFPFLLS F+LLTW+
Sbjct  2    RIPNPRRGSFSNTQQNPDNPFNVQN-----LSTVSIILNFLKRPQAFPFLLSIFVLLTWL  56

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNS--ANLVRFPAS--SPLVAKDKRGWL  542
            + R Q  S  F        +       WSS +D+   ANLVRF +     L+ KD+RGWL
Sbjct  57   SLRLQHSSSQFE-------LNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWL  109

Query  543  LNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNA  722
            LNPISLA+D+ + GG +SC S+HVGEI+PG +RGNHRH+T NETFVIWGA T FRLENN 
Sbjct  110  LNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQ  169

Query  723  I-QKGYAEVKLGADEVAV  773
            I  KGYAEV +GADEVA+
Sbjct  170  IDDKGYAEVIVGADEVAI  187



>ref|XP_010111293.1| hypothetical protein L484_027946 [Morus notabilis]
 gb|EXC30771.1| hypothetical protein L484_027946 [Morus notabilis]
Length=241

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 115/155 (74%), Gaps = 11/155 (7%)
 Frame = +3

Query  318  KKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGR-RH-WSSNEDNSANLV  491
            KKPHAFPFLLS FLLLTWV+ R QR S         S   N  R RH W+  +D+  NL 
Sbjct  51   KKPHAFPFLLSVFLLLTWVSLRIQRFSR--------SSAENSPRFRHPWTHFDDSQVNLR  102

Query  492  RFPASSPL-VAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCN  668
            RFP+  P  +A DKRGWL+NP+SLALDS +SGG ++C S+HV EI+PG +RGNHRH++CN
Sbjct  103  RFPSGFPSPIANDKRGWLINPVSLALDSGVSGGAVTCVSVHVVEIRPGAIRGNHRHYSCN  162

Query  669  ETFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            ETFVIWGA T FRLEN+ + KGYAEV +GADEVAV
Sbjct  163  ETFVIWGAKTKFRLENSRVDKGYAEVIIGADEVAV  197



>ref|XP_010525463.1| PREDICTED: uncharacterized protein LOC104803253 [Tarenaya hassleriana]
Length=223

 Score =   164 bits (416),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 126/195 (65%), Gaps = 22/195 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR L                 +QS    +SSL   LKKP AFP LL+ F+LLTW++
Sbjct  1    MANPRRGLIE---------------NQS----LSSLIHLLKKPQAFPLLLTLFVLLTWIS  41

Query  378  FRFQRPSEHF-PSMGLGSGIM-NMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWLLN  548
             R Q  S +  PS    S +  N      + +EDN ANLVRF +SS   + KD RGWLLN
Sbjct  42   LRLQHSSHYASPSSHRKSTVQSNSNGGGIAGDEDNKANLVRFASSSTSPIRKDDRGWLLN  101

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            P+SLA +S I GG  SCASIHVGEI+PG +RGNHRH+TCNETFVIWGA T FRLEN+ + 
Sbjct  102  PVSLARNSGIKGGAGSCASIHVGEIRPGEMRGNHRHYTCNETFVIWGAKTKFRLENHKVD  161

Query  729  KGYAEVKLGADEVAV  773
            KG+ EV +G DEVAV
Sbjct  162  KGFGEVIIGEDEVAV  176



>emb|CDX72111.1| BnaC08g27630D [Brassica napus]
Length=213

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 120/201 (60%), Gaps = 41/201 (20%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRRT+      +H+L               S L + LKKP AFP LLSFFL LTW+T
Sbjct  1    MANPRRTV----TENHRL---------------SPLINLLKKPQAFPLLLSFFLFLTWIT  41

Query  378  FRFQR--------PSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFP-ASSPLVAKDK  530
             R Q          S H P   +  G             D+  NL+RF  AS   V KD 
Sbjct  42   LRLQHSSHLSSHAKSHHHPDSEVLDG-------------DDKVNLIRFDLASISPVRKDD  88

Query  531  RGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            RGWLL+P++LA DS + GG   C SIHVGEIKPG +RGNHRHHTCNETFVIWGA T FRL
Sbjct  89   RGWLLDPVTLARDSQLHGGAAMCVSIHVGEIKPGELRGNHRHHTCNETFVIWGAKTRFRL  148

Query  711  ENNAIQKGYAEVKLGADEVAV  773
            EN+ ++KGYAEV +G DEVAV
Sbjct  149  ENHKVEKGYAEVLIGEDEVAV  169



>gb|KDP30139.1| hypothetical protein JCGZ_18134 [Jatropha curcas]
Length=222

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 130/196 (66%), Gaps = 23/196 (12%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR+             S         + +SS+K FLKKP AFPFLL  FLLLTW++
Sbjct  1    MANPRRS-------------SENSFQFQNLSRLSSIKHFLKKPQAFPFLLLIFLLLTWLS  47

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGWLLN  548
             R QR S   P+   G+       + WS+ +D  ANLVRF +    SP++ KDKRGWL N
Sbjct  48   LRLQRSSHFSPANLHGTQA-----KIWSTEDDKKANLVRFKSELFPSPII-KDKRGWLFN  101

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-  725
            P+SLA+ S I G  +SC S+HVGEI+PG VRGNHRH+TCNETFVIWGA TLFRLEN+ I 
Sbjct  102  PVSLAIHSGIRGSAVSCDSLHVGEIRPGSVRGNHRHYTCNETFVIWGAKTLFRLENSQIS  161

Query  726  QKGYAEVKLGADEVAV  773
             KG+A+V +GADEVAV
Sbjct  162  DKGFAQVIVGADEVAV  177



>ref|XP_006291817.1| hypothetical protein CARUB_v10017993mg [Capsella rubella]
 gb|EOA24715.1| hypothetical protein CARUB_v10017993mg [Capsella rubella]
Length=219

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 120/194 (62%), Gaps = 21/194 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +      +H+L               S L + LKKP AFP LLSFFL LTW+T
Sbjct  1    MANPRRVVI----ENHRL---------------SPLINLLKKPQAFPLLLSFFLFLTWIT  41

Query  378  FRFQRPSEHFPSMGLG-SGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLNP  551
             R Q  S    S        +         ++D+  NLVRF  AS   V KD RGWLL+P
Sbjct  42   LRLQHSSHVSSSSSSHPKSTLKSHPDLKIVDDDDKVNLVRFGLASLSPVRKDDRGWLLDP  101

Query  552  ISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQK  731
            I LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ ++K
Sbjct  102  IILARDSQLKGGAASCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTRFRLENHKVEK  161

Query  732  GYAEVKLGADEVAV  773
            GYAEV +G DEVAV
Sbjct  162  GYAEVVIGEDEVAV  175



>ref|XP_009116379.1| PREDICTED: uncharacterized protein LOC103841578 isoform X2 [Brassica 
rapa]
Length=220

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRRT+      +H+                S L + LKKP AFP LLSFFL LTW+T
Sbjct  1    MANPRRTV----TENHRF---------------SPLINLLKKPQAFPLLLSFFLFLTWIT  41

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSS---NEDNSANLVRFP-ASSPLVAKDKRGWLL  545
             R Q  S    S    +        H  S   +ED+  NL+RF  AS   V KD RGWLL
Sbjct  42   LRLQHSSH-LSSSSSDTKSAAKSHHHPDSEVLDEDDKVNLIRFDTASISPVRKDDRGWLL  100

Query  546  NPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI  725
            +P++LA DS + GG  +C SIHVGEIKPG +RGNHRHHTCNETFVIWGA T FRLEN+ +
Sbjct  101  DPVALARDSQLHGGAATCVSIHVGEIKPGELRGNHRHHTCNETFVIWGAKTRFRLENHKV  160

Query  726  QKGYAEVKLGADEVAV  773
            +KGYAEV +G DEVAV
Sbjct  161  EKGYAEVLIGEDEVAV  176



>emb|CDY27192.1| BnaA09g36100D [Brassica napus]
Length=220

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 121/208 (58%), Gaps = 48/208 (23%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRRT+      +H+L               S L + LKKP AFP LLSFFL LTW+T
Sbjct  1    MANPRRTV----TENHRL---------------SPLINLLKKPQAFPLLLSFFLFLTWIT  41

Query  378  FRFQR---------------PSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFP-ASS  509
             R Q                 S H P   +  G             D+  NL+RF  AS 
Sbjct  42   LRLQHSSHLSSSSSHTKSAAKSHHHPDSEVLDG-------------DDKVNLIRFDTASI  88

Query  510  PLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWG  689
              V KD RGWLL+P++LA DS + GG  +C SIHVGEIKPG +RGNHRHHTCNETFVIWG
Sbjct  89   SPVRKDDRGWLLDPVALARDSQLHGGAATCVSIHVGEIKPGELRGNHRHHTCNETFVIWG  148

Query  690  AHTLFRLENNAIQKGYAEVKLGADEVAV  773
            A T FRLEN+ ++KGYAEV +G DEVAV
Sbjct  149  AKTRFRLENHKVEKGYAEVLIGEDEVAV  176



>ref|XP_010516283.1| PREDICTED: uncharacterized protein LOC104791971 [Camelina sativa]
Length=221

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 121/194 (62%), Gaps = 20/194 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +      +H+L              +S L + LKKP A P LLSFFL LTW+T
Sbjct  1    MANPRRGVI----ENHRL--------------LSPLINLLKKPQAIPLLLSFFLFLTWIT  42

Query  378  FRFQRPSEHFPSMGLG-SGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLNP  551
             R Q  S    S        +       + ++D+  NLVRF  AS   V KD RGWLL+P
Sbjct  43   LRLQHSSHVSSSSSSHPKSTLKSHPDLKTFDDDDKVNLVRFGLASLSRVRKDDRGWLLDP  102

Query  552  ISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQK  731
            + LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ ++K
Sbjct  103  VILARDSQLKGGASSCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTRFRLENHKVEK  162

Query  732  GYAEVKLGADEVAV  773
            GYAEV +G DEVAV
Sbjct  163  GYAEVLIGEDEVAV  176



>ref|XP_006402946.1| hypothetical protein EUTSA_v10006232mg [Eutrema salsugineum]
 gb|ESQ44399.1| hypothetical protein EUTSA_v10006232mg [Eutrema salsugineum]
Length=218

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 118/193 (61%), Gaps = 20/193 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR L                        +S L + LKKP AFP LLSFFL LTW+T
Sbjct  1    MANPRRVLIENQR-------------------LSPLINLLKKPLAFPLLLSFFLFLTWIT  41

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASS-PLVAKDKRGWLLNPI  554
             R Q  S    S  L +  +         ++D   NLVRF A+S   V KD RGWLL+P+
Sbjct  42   LRVQHSSHFSSSSSLPNSALKSHPDLEILDDDEKVNLVRFDAASLSPVRKDDRGWLLDPV  101

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
             LA DS +SGG  SC SIHVGEI+PG +RGNHRHH CNETFVIWGA T FRLEN+ ++KG
Sbjct  102  ILARDSRLSGGAASCLSIHVGEIRPGSLRGNHRHHACNETFVIWGAKTKFRLENHKVEKG  161

Query  735  YAEVKLGADEVAV  773
            YAEV +G DEVAV
Sbjct  162  YAEVLIGDDEVAV  174



>gb|EYU20860.1| hypothetical protein MIMGU_mgv1a019264mg, partial [Erythranthe 
guttata]
Length=191

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 99/137 (72%), Gaps = 11/137 (8%)
 Frame = +3

Query  366  TWVTFRFQ----RPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKR  533
            TW++ RFQ    +PS H         +     +     +D++AN+V+F +SS LV KDKR
Sbjct  14   TWISLRFQHRYAKPSFH-------QSLYTANDKLGGFLKDSTANVVKFSSSSSLVMKDKR  66

Query  534  GWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLE  713
            GWL++P+ LALD+ ISGG +SCASIHVGEI+PG +R NHRHHTCNETFV+WGA T+ RLE
Sbjct  67   GWLIDPVLLALDAGISGGAVSCASIHVGEIRPGSMRRNHRHHTCNETFVVWGAKTVLRLE  126

Query  714  NNAIQKGYAEVKLGADE  764
            NNA+  GY++V +GADE
Sbjct  127  NNAVTSGYSDVTVGADE  143



>ref|XP_010504587.1| PREDICTED: uncharacterized protein LOC104781575 [Camelina sativa]
 ref|XP_010504588.1| PREDICTED: uncharacterized protein LOC104781575 [Camelina sativa]
Length=222

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 122/195 (63%), Gaps = 21/195 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +      +H+L              +S L + LKKP A P LLSFFL LTW+T
Sbjct  1    MANPRRGVI----ENHRL--------------LSPLINLLKKPQAIPLLLSFFLFLTWIT  42

Query  378  FRFQRPSEHFPSMGLG--SGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLN  548
             R Q  S H  S         +       + ++D+  NLVRF  AS   V KD RGWLL+
Sbjct  43   LRLQHSSSHVSSSSSSHPKSTLKSHPDLKTFDDDDKVNLVRFGLASLSPVRKDDRGWLLD  102

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            P+ LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ ++
Sbjct  103  PVILARDSQLKGGASSCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTRFRLENHKVE  162

Query  729  KGYAEVKLGADEVAV  773
            KGYAEV +G DEVAV
Sbjct  163  KGYAEVLIGEDEVAV  177



>ref|XP_009116378.1| PREDICTED: uncharacterized protein LOC103841578 isoform X1 [Brassica 
rapa]
Length=269

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 124/199 (62%), Gaps = 24/199 (12%)
 Frame = +3

Query  189  RKQMANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllT  368
            + +MANPRRT+      +H+                S L + LKKP AFP LLSFFL LT
Sbjct  47   KSKMANPRRTV----TENHRF---------------SPLINLLKKPQAFPLLLSFFLFLT  87

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSS---NEDNSANLVRFP-ASSPLVAKDKRG  536
            W+T R Q  S    S    +        H  S   +ED+  NL+RF  AS   V KD RG
Sbjct  88   WITLRLQHSSH-LSSSSSDTKSAAKSHHHPDSEVLDEDDKVNLIRFDTASISPVRKDDRG  146

Query  537  WLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLEN  716
            WLL+P++LA DS + GG  +C SIHVGEIKPG +RGNHRHHTCNETFVIWGA T FRLEN
Sbjct  147  WLLDPVALARDSQLHGGAATCVSIHVGEIKPGELRGNHRHHTCNETFVIWGAKTRFRLEN  206

Query  717  NAIQKGYAEVKLGADEVAV  773
            + ++KGYAEV +G DEVAV
Sbjct  207  HKVEKGYAEVLIGEDEVAV  225



>ref|XP_010427519.1| PREDICTED: uncharacterized protein LOC104712341 [Camelina sativa]
 ref|XP_010427520.1| PREDICTED: uncharacterized protein LOC104712341 [Camelina sativa]
Length=220

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 120/193 (62%), Gaps = 19/193 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +      +H+L              +S L + LKKP A P LL FFL LTW+T
Sbjct  1    MANPRRVVI----ENHRL--------------LSPLINLLKKPQAIPLLLFFFLFLTWIT  42

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLNPI  554
             R Q  S    S       +       + ++D+  NLVRF  AS   V KD RGWLL+P+
Sbjct  43   LRLQHSSHVSSSSSHPKSTLKSHPDLKNLDDDDKVNLVRFGLASLSPVRKDDRGWLLDPV  102

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
             LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ ++KG
Sbjct  103  ILARDSQLKGGASSCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTRFRLENHKVEKG  162

Query  735  YAEVKLGADEVAV  773
            YAEV +G DEVAV
Sbjct  163  YAEVLIGEDEVAV  175



>ref|XP_007028181.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY08683.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=227

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 119/195 (61%), Gaps = 16/195 (8%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR     +    + P           + +SS+K  LKKP AFPF+L   LLLTWV+
Sbjct  1    MANPRRISHSNNSQSVENPFQF---QTQSLSYLSSVKHLLKKPQAFPFMLLLLLLLTWVS  57

Query  378  FRFQRPS-EHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPL-VAKDKRGWLLNP  551
             R Q  S  H    G   G     +          ANL RF +  P  + KDKRGWLLNP
Sbjct  58   LRLQYSSPSHHEQWGKDDGDDGDFK----------ANLFRFRSGLPSDIVKDKRGWLLNP  107

Query  552  ISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-Q  728
            +SLAL + + GG MSC S+H+GEI+PG VRGNHRH+TCNETFVIWGA T FR+ENN I  
Sbjct  108  VSLALQNGVKGGAMSCVSVHIGEIRPGCVRGNHRHYTCNETFVIWGAKTKFRVENNQIVN  167

Query  729  KGYAEVKLGADEVAV  773
            +GYAEV +G DEVAV
Sbjct  168  RGYAEVTIGEDEVAV  182



>ref|XP_002878111.1| hypothetical protein ARALYDRAFT_486120 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54370.1| hypothetical protein ARALYDRAFT_486120 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 116/193 (60%), Gaps = 20/193 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +                        +S + + LKKP AFP LLSFFL LTW++
Sbjct  1    MANPRRVVIDNQR-------------------LSPIINLLKKPQAFPILLSFFLFLTWIS  41

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLNPI  554
             R Q  S    S       +N        ++D+  NLVRF  AS     KD RGWLL+P+
Sbjct  42   LRLQHSSHVSSSSSHPKSTLNSHPDLKVFDDDDKVNLVRFGLASLSPARKDDRGWLLDPV  101

Query  555  SLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQKG  734
             LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ + KG
Sbjct  102  ILARDSQLKGGAASCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTRFRLENHEVDKG  161

Query  735  YAEVKLGADEVAV  773
            YAEV +G DEVAV
Sbjct  162  YAEVFIGEDEVAV  174



>ref|XP_002456510.1| hypothetical protein SORBIDRAFT_03g037620 [Sorghum bicolor]
 gb|EES01630.1| hypothetical protein SORBIDRAFT_03g037620 [Sorghum bicolor]
Length=229

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 129/201 (64%), Gaps = 25/201 (12%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQ-----LPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsffll  362
            MANPRR    A   H Q     LP +        ++V SSL  FLK+P +FPFLLS F+L
Sbjct  1    MANPRR----AIALHIQTQPPPLPTTAASALPPHSSVASSLLHFLKRPASFPFLLSLFVL  56

Query  363  lTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKR  533
            LTW++ RF  PS   PS+G        GR   S   D  ANLVRFPA    +P +A+D R
Sbjct  57   LTWLSLRFHHPSPP-PSLG--------GRP--SVVHDPQANLVRFPAELHPTP-IARDGR  104

Query  534  GWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLE  713
            GWLL+P++ A D+ + GG + C  +HVG+I+PGG+RGNHRHHTCNETFVIWGA T FRLE
Sbjct  105  GWLLDPVAAARDAGLPGGALVCLLLHVGQIQPGGLRGNHRHHTCNETFVIWGAKTKFRLE  164

Query  714  NNAIQ-KGYAEVKLGADEVAV  773
            N  I+ KGY E  + ADEVA+
Sbjct  165  NADIKDKGYGEAIIAADEVAI  185



>ref|NP_001152497.1| LOC100286137 [Zea mays]
 gb|ACG47898.1| cupin, RmlC-type [Zea mays]
 tpg|DAA57182.1| TPA: cupin, RmlC-type [Zea mays]
Length=227

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 129/199 (65%), Gaps = 23/199 (12%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQL---PVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllT  368
            MANPRR    A   H Q    P+ +      P T+ SSL  FLK+P +FPFLLS F+LLT
Sbjct  1    MANPRR----AIALHIQTQPPPLPSTAAALPPHTLASSLLHFLKRPASFPFLLSLFVLLT  56

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGW  539
            W++ RF  PS   PS+G        GR   S   +  ANLVRFPA    +P +A+D RGW
Sbjct  57   WLSLRFHHPSPP-PSLG--------GRP--SVVHEPQANLVRFPAELYPTP-IARDGRGW  104

Query  540  LLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENN  719
            LL+P++ A D+ + GG + C  +HVG+I+PGG+RGNHRHHTCNETFVIWGA T FRLEN 
Sbjct  105  LLDPVAAARDAGLPGGALVCLLLHVGQIQPGGLRGNHRHHTCNETFVIWGAKTKFRLENA  164

Query  720  AIQ-KGYAEVKLGADEVAV  773
             I+ +GY E  + ADEVA+
Sbjct  165  GIKDEGYGEAMIAADEVAI  183



>gb|KFK34919.1| hypothetical protein AALP_AA5G210600 [Arabis alpina]
Length=222

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 119/194 (61%), Gaps = 22/194 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +                        +S L + LKKP AFP LL FF+ LTW++
Sbjct  1    MANPRRIVIENQR-------------------LSPLINLLKKPLAFPLLLGFFVFLTWIS  41

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRF--PASSPLVAKDKRGWLLNP  551
             R Q  S    S    S + +        + D+ ANL+RF   + SP V KD RGWLL+P
Sbjct  42   LRLQHSSHFSSSSHTKSAVKSSNSDLEIHDGDDEANLIRFGLVSISP-VRKDDRGWLLDP  100

Query  552  ISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQK  731
            + LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLENN ++K
Sbjct  101  VILARDSLLKGGAGSCLSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTKFRLENNKVEK  160

Query  732  GYAEVKLGADEVAV  773
            GYAEV +G +EVAV
Sbjct  161  GYAEVVIGENEVAV  174



>ref|XP_010922109.1| PREDICTED: uncharacterized protein LOC105045504 [Elaeis guineensis]
Length=238

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 126/206 (61%), Gaps = 26/206 (13%)
 Frame = +3

Query  198  MANPRRT---LFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllT  368
            MANPRRT   L   + T               ++ +S++  FLK+P AFP LLS F+LLT
Sbjct  1    MANPRRTSLQLQQQNPTLPFSDPPPSPPPPPCSSTLSAVAVFLKRPQAFPILLSVFVLLT  60

Query  369  WVTFRFQRP--------SEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASS--PLV  518
            W++ R Q P        S   PS   G G             D  ANLVRF A      +
Sbjct  61   WLSLRLQSPGGGAFRLRSHASPSQAQGQG------------SDIDANLVRFSAVEFPSQI  108

Query  519  AKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHT  698
            A+D RGWLL+P+++A ++ I GG + CAS+HVG+I+PGG+RGNHRH++CNETFVIWGA T
Sbjct  109  ARDWRGWLLDPVTVAREAGIHGGALDCASVHVGQIRPGGLRGNHRHNSCNETFVIWGAET  168

Query  699  LFRLENNAIQ-KGYAEVKLGADEVAV  773
            +FRLEN  ++ KGYAEV +G DEVAV
Sbjct  169  MFRLENARMEDKGYAEVSIGVDEVAV  194



>ref|NP_567041.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK95325.1|AF410339_1 AT3g56820/T8M16_150 [Arabidopsis thaliana]
 gb|AAM66975.1| unknown [Arabidopsis thaliana]
 gb|AAN31078.1| At3g56820/T8M16_150 [Arabidopsis thaliana]
 gb|AEE79569.1| uncharacterized protein AT3G56820 [Arabidopsis thaliana]
Length=220

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 117/195 (60%), Gaps = 22/195 (11%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +                        +S L + LKKP A P LLS FLLLTW++
Sbjct  1    MANPRRVVIENQR-------------------LSPLINLLKKPQAIPLLLSLFLLLTWIS  41

Query  378  FRFQRPSEHFPSMGLG--SGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLN  548
             R Q  S+   S         +N        ++D+ ANLVRF  AS     KD RGWLL+
Sbjct  42   LRLQHSSQSHVSSSSSHPKSTVNSHPDLKVYDDDDKANLVRFGLASLSPARKDDRGWLLD  101

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            P+ LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FRLEN+ + 
Sbjct  102  PVILARDSELKGGAASCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTKFRLENHEVD  161

Query  729  KGYAEVKLGADEVAV  773
            KGYAEV +G DEVAV
Sbjct  162  KGYAEVLIGEDEVAV  176



>ref|XP_006644878.1| PREDICTED: uncharacterized protein LOC102719437 [Oryza brachyantha]
Length=226

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 125/199 (63%), Gaps = 24/199 (12%)
 Frame = +3

Query  198  MANPRRTL---FPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllT  368
            MANPRR +    PA       P++         ++ SSL  FLK+P +FPFLLS F+LLT
Sbjct  1    MANPRRAIALQIPAQTE----PLAAAPAAAPAFSLPSSLLYFLKRPASFPFLLSLFVLLT  56

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGW  539
            W++ RF  PS   PS  L            S   D  ANLVRFPA    +P +A D RGW
Sbjct  57   WISLRFHHPS---PSAPLHRP---------SVVHDPQANLVRFPAELYPTP-IAADGRGW  103

Query  540  LLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENN  719
            LL+P++ A D+ + GG + C S+HVG+I+PGG+RGNHRHHTCNETFVIWGA T FRLEN 
Sbjct  104  LLDPVAAARDAGLPGGALVCLSLHVGQIQPGGLRGNHRHHTCNETFVIWGARTKFRLENT  163

Query  720  AIQ-KGYAEVKLGADEVAV  773
             ++ KGY E  + ADEVA+
Sbjct  164  DVKDKGYGEAMIAADEVAI  182



>ref|XP_008811947.1| PREDICTED: uncharacterized protein LOC103722963 [Phoenix dactylifera]
Length=237

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 124/208 (60%), Gaps = 31/208 (15%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPV-----STGGGDQSPATVVSSLKSFLKKPHAfpfllsffll  362
            MANPRRT       H Q P               ++ +S++  FLK+P AFP LLS F+L
Sbjct  1    MANPRRTSLQ---LHQQNPTLPFSDLPPSPSPPCSSALSAVAVFLKRPQAFPILLSVFVL  57

Query  363  lTWVTFRFQRP--------SEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASS--P  512
            LTW++ R Q P        S   PS   G G             D  ANLVRF A     
Sbjct  58   LTWLSLRLQSPGAAAVRLRSPTSPSQAQGQG------------ADIDANLVRFSAVEFPS  105

Query  513  LVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGA  692
             +AKD RGWLLNP+  A ++ I GG + CAS+HVG+I+PGG+RGNHRH++CNETF+IWGA
Sbjct  106  QIAKDWRGWLLNPVVAAREAGIHGGALDCASVHVGQIRPGGMRGNHRHNSCNETFIIWGA  165

Query  693  HTLFRLENNAIQ-KGYAEVKLGADEVAV  773
             T+FRLEN  ++ KGYAEV +G DEVAV
Sbjct  166  ETVFRLENAHVKDKGYAEVSIGVDEVAV  193



>gb|KHG09920.1| hypothetical protein F383_13295 [Gossypium arboreum]
Length=226

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 11/152 (7%)
 Frame = +3

Query  324  PHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPA  503
            PHA PFLL   LLLTWV+ R Q  S  F    LG        +    ++D+ ANLVRF +
Sbjct  39   PHALPFLLLLLLLLTWVSLRLQYSSR-FRHQQLG--------QDGHGDDDSKANLVRFKS  89

Query  504  SSP-LVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFV  680
              P  +AKDKRGWLL+P+SLAL   + GG +SC+ +H+GEI+ GG+RGNHRH++CNETFV
Sbjct  90   GLPSAIAKDKRGWLLDPVSLALQFGVRGGAVSCSQVHIGEIRRGGIRGNHRHYSCNETFV  149

Query  681  IWGAHTLFRLENNAIQ-KGYAEVKLGADEVAV  773
            IWGA T FRLENN +  +GYAEV +G DEV V
Sbjct  150  IWGAKTKFRLENNQMDGRGYAEVTIGEDEVVV  181



>ref|XP_004493283.1| PREDICTED: uncharacterized protein LOC101489167 [Cicer arietinum]
Length=247

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = +3

Query  297  SSLKSFLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDN  476
            S + SFL++PH+ PF+LS FL L W++ R  RPS   P                S N+D 
Sbjct  56   SLVTSFLQRPHSLPFVLSIFLFLAWISLRSYRPSHPLPLS--------------SPNDDV  101

Query  477  SANLVRFPASSPL-VAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHR  653
             ANL RF +S P  + KD RGW+L+PI+LAL SSISGG ++CAS+H+GEI+PG +RGNHR
Sbjct  102  KANLRRFSSSFPSPITKDNRGWILDPIALALSSSISGGAVTCASLHLGEIRPGKLRGNHR  161

Query  654  HHTCNETFVIWGAHTLFRLENNAIQK-GYAEVKLGADEVAV  773
            HH CNETFV+WGA   FR EN+ +   GYAEV +G DEV V
Sbjct  162  HHDCNETFVLWGASIKFRAENSKVADIGYAEVTIGRDEVVV  202



>ref|XP_004970310.1| PREDICTED: uncharacterized protein LOC101774892 [Setaria italica]
Length=227

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 16/163 (10%)
 Frame = +3

Query  297  SSLKSFLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDN  476
            SSL  FLK+P +FPFLLS F+LLTW++ RF RPS   PS+G    +++          + 
Sbjct  33   SSLLHFLKRPASFPFLLSLFVLLTWLSLRFHRPSPP-PSLGGRPAVVH----------EP  81

Query  477  SANLVRFPAS---SPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGN  647
             ANLVRFPA    +P +A+D RGWLL+P++ A D+ + GG  +C S+HVG+I+PGG+RGN
Sbjct  82   QANLVRFPAELHPTP-IARDGRGWLLDPVAAARDAGLPGGAFACLSLHVGQIQPGGLRGN  140

Query  648  HRHHTCNETFVIWGAHTLFRLENNAIQ-KGYAEVKLGADEVAV  773
            HRHHTCNETFVIWGA T FRLEN  ++ KGY E  + ADEV +
Sbjct  141  HRHHTCNETFVIWGAKTKFRLENADVKDKGYGEAIIAADEVGI  183



>ref|XP_003520355.1| PREDICTED: uncharacterized protein LOC100807512 [Glycine max]
 gb|KHN42149.1| hypothetical protein glysoja_021639 [Glycine soja]
Length=189

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 103/154 (67%), Gaps = 15/154 (10%)
 Frame = +3

Query  312  FLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLV  491
            FL++PH+ PF+L+FFL L W++   QR S  +                 SS+ D  ANLV
Sbjct  6    FLQRPHSIPFVLAFFLFLAWISLALQRASYSYAPPH-------------SSHTDIRANLV  52

Query  492  RFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNE  671
            RF AS   VAKDKRGW+ +PI+LAL S ISGG ++CAS+HVGEI+ G  R NHRHH CNE
Sbjct  53   RFDASE--VAKDKRGWIFDPIALALASGISGGAVTCASLHVGEIRAGNKRANHRHHHCNE  110

Query  672  TFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            TF+IWGA T +RLENN    GYAEV LG DE+ V
Sbjct  111  TFLIWGAATKYRLENNDEDNGYAEVMLGRDEIVV  144



>emb|CBI32851.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 128/196 (65%), Gaps = 26/196 (13%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKS---FLKKPHAfpfllsfflllT  368
            M NPRR   P + +           +Q+  T+  SL S   FLK+P AFPFLLS FLLLT
Sbjct  1    MVNPRRISHPNTIS-----------NQTSETLTPSLSSLFFFLKRPQAFPFLLSIFLLLT  49

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLN  548
            W++ R QR S  F S    +    +       + D  ANLVRF   S     DKRGWLLN
Sbjct  50   WLSLRLQR-SSLFNSPPNRNAFQTL-------DHDREANLVRF---SSHFFTDKRGWLLN  98

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-  725
            PIS A D+SISGG ++CAS+HVGEI+PGG+RGNHRHH CNETF+IWGA T FRLEN+ + 
Sbjct  99   PISAASDASISGGAVNCASVHVGEIRPGGMRGNHRHHGCNETFIIWGAKTAFRLENHQVP  158

Query  726  QKGYAEVKLGADEVAV  773
            +KGYAEV +GA+EVAV
Sbjct  159  EKGYAEVIIGANEVAV  174



>ref|XP_002283750.1| PREDICTED: uncharacterized protein LOC100249949 isoform X2 [Vitis 
vinifera]
Length=220

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 128/196 (65%), Gaps = 26/196 (13%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKS---FLKKPHAfpfllsfflllT  368
            M NPRR   P + +           +Q+  T+  SL S   FLK+P AFPFLLS FLLLT
Sbjct  2    MVNPRRISHPNTIS-----------NQTSETLTPSLSSLFFFLKRPQAFPFLLSIFLLLT  50

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLN  548
            W++ R QR S  F S    +    +       + D  ANLVRF   S     DKRGWLLN
Sbjct  51   WLSLRLQR-SSLFNSPPNRNAFQTL-------DHDREANLVRF---SSHFFTDKRGWLLN  99

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-  725
            PIS A D+SISGG ++CAS+HVGEI+PGG+RGNHRHH CNETF+IWGA T FRLEN+ + 
Sbjct  100  PISAASDASISGGAVNCASVHVGEIRPGGMRGNHRHHGCNETFIIWGAKTAFRLENHQVP  159

Query  726  QKGYAEVKLGADEVAV  773
            +KGYAEV +GA+EVAV
Sbjct  160  EKGYAEVIIGANEVAV  175



>ref|XP_007161828.1| hypothetical protein PHAVU_001G101300g [Phaseolus vulgaris]
 gb|ESW33822.1| hypothetical protein PHAVU_001G101300g [Phaseolus vulgaris]
Length=228

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 103/154 (67%), Gaps = 17/154 (11%)
 Frame = +3

Query  312  FLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLV  491
            F+++P+  PFLL  FL L W++ R Q  S   P                SS+ D  ANLV
Sbjct  47   FIQRPYPIPFLLVIFLFLAWISLRTQHVSRTPPH---------------SSHRDALANLV  91

Query  492  RFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNE  671
            RF +S   VAKD RGWL +PI+LALDS +SGG ++C+S+HVGEI+PG  RGNHRHH CNE
Sbjct  92   RFHSSH--VAKDNRGWLFDPIALALDSGVSGGAVTCSSLHVGEIRPGKRRGNHRHHDCNE  149

Query  672  TFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            TF+IWGA T FRLEN+    GYAEV +G DE+AV
Sbjct  150  TFLIWGAATRFRLENSRENDGYAEVTIGRDEIAV  183



>ref|XP_003564446.1| PREDICTED: uncharacterized protein LOC100824167 [Brachypodium 
distachyon]
Length=227

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 125/196 (64%), Gaps = 17/196 (9%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +  A   H Q P        S +++ SSL +FLK+P +FPFLLS F+LLTW++
Sbjct  1    MANPRRAI--ALQIHTQAPPIPAAAASSSSSLPSSLLNFLKRPASFPFLLSLFVLLTWIS  58

Query  378  FRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGWLLN  548
             RF +P+    +   G  +            D  ANLVR+PA+   +P +A D RGWLL+
Sbjct  59   LRFHQPAPTSTASLRGPTVA----------FDPQANLVRYPAALHPTP-IAADARGWLLD  107

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAIQ  728
            P++ A D+ + GG + C  +HVG I PGG+RGNHRHHTCNETFVIWGA T FRLEN  I+
Sbjct  108  PVAAAHDAGLPGGALVCLKLHVGLIPPGGLRGNHRHHTCNETFVIWGAKTKFRLENADIK  167

Query  729  -KGYAEVKLGADEVAV  773
             KGY E  + ADEVAV
Sbjct  168  DKGYGEAMIAADEVAV  183



>ref|XP_010036422.1| PREDICTED: uncharacterized protein LOC104425419 [Eucalyptus grandis]
 gb|KCW47972.1| hypothetical protein EUGRSUZ_K01704 [Eucalyptus grandis]
Length=237

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 113/185 (61%), Gaps = 19/185 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVV---------SSLKSFLKKPHAfpflls  350
            MANPRR  + A+G      +S      SPA  V         SS  +FLKKPHA P LLS
Sbjct  1    MANPRRPSYAAAGG--PAAISLESAQASPAAAVLAQRSAFSYSSFVNFLKKPHAIPILLS  58

Query  351  fflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDK  530
             FLLLTW++ R Q  S    +    +   +  RR     +D  ANLVRFP  S     DK
Sbjct  59   AFLLLTWISLRLQASSS---AASRFASSRDGERRR--EEDDRKANLVRFPLGS---FSDK  110

Query  531  RGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            RGWL++P S+ALD+ I GG ++CAS HVGEI+P GVR NHRHHTCNETFVIWGA T FRL
Sbjct  111  RGWLVDPASVALDNGIRGGAVTCASFHVGEIRPRGVRANHRHHTCNETFVIWGAKTKFRL  170

Query  711  ENNAI  725
            E++ +
Sbjct  171  ESSEM  175



>ref|XP_003554079.1| PREDICTED: uncharacterized protein LOC100782059 [Glycine max]
Length=230

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 99/154 (64%), Gaps = 17/154 (11%)
 Frame = +3

Query  312  FLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLV  491
            FL++PH+ P +L+ FL L W++ R QR +   P                S   D  ANL 
Sbjct  49   FLQRPHSIPLVLAVFLFLAWLSLRLQRVAYAPPH---------------SFQTDIRANLA  93

Query  492  RFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNE  671
            RF +S   VAKD RGW+ +PI+LA  S ISGG +SCAS+HVGEI+PG +R NHRHH  NE
Sbjct  94   RFDSSE--VAKDNRGWIFDPIALARASGISGGAVSCASLHVGEIRPGKIRANHRHHDSNE  151

Query  672  TFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            TF+IWGA T FR+ENN    GYAEV LG DE+AV
Sbjct  152  TFLIWGAATKFRMENNDEDDGYAEVILGRDEIAV  185



>ref|XP_010653667.1| PREDICTED: uncharacterized protein LOC100249949 isoform X1 [Vitis 
vinifera]
Length=221

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 128/197 (65%), Gaps = 27/197 (14%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKS---FLKKPHAfpfllsfflllT  368
            M NPRR   P + +           +Q+  T+  SL S   FLK+P AFPFLLS FLLLT
Sbjct  2    MVNPRRISHPNTIS-----------NQTSETLTPSLSSLFFFLKRPQAFPFLLSIFLLLT  50

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPASSPLVAKDKRGWLLN  548
            W++ R QR S  F S    +    +       + D  ANLVRF   S     DKRGWLLN
Sbjct  51   WLSLRLQR-SSLFNSPPNRNAFQTL-------DHDREANLVRF---SSHFFTDKRGWLLN  99

Query  549  PISLALDSSISGG-TMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI  725
            PIS A D+SISGG  ++CAS+HVGEI+PGG+RGNHRHH CNETF+IWGA T FRLEN+ +
Sbjct  100  PISAASDASISGGGAVNCASVHVGEIRPGGMRGNHRHHGCNETFIIWGAKTAFRLENHQV  159

Query  726  -QKGYAEVKLGADEVAV  773
             +KGYAEV +GA+EVAV
Sbjct  160  PEKGYAEVIIGANEVAV  176



>ref|NP_001044582.1| Os01g0810200 [Oryza sativa Japonica Group]
 dbj|BAD68236.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06496.1| Os01g0810200 [Oryza sativa Japonica Group]
 dbj|BAG91359.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71680.1| hypothetical protein OsI_04154 [Oryza sativa Indica Group]
 gb|EEE55557.1| hypothetical protein OsJ_03821 [Oryza sativa Japonica Group]
Length=226

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 20/197 (10%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKS-FLKKPHAfpfllsfflllTWV  374
            MANPRR +  A   H Q          +P+  + S    FLK+P +FPFLLS F+LLTW+
Sbjct  1    MANPRRAI--ALQIHTQTTPLAAAPAAAPSPSLPSSLVHFLKRPASFPFLLSLFVLLTWI  58

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGWLL  545
            + RF  PS   PS    + ++     H     D  ANLVR+PA+   +P +A D RGWLL
Sbjct  59   SLRFHHPS---PS----ASVLRAPVVH-----DPQANLVRYPAALYPTP-IAADGRGWLL  105

Query  546  NPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI  725
            +P++ A D+ + GG + C S+HVG+I+PGG+RGNHRHHTCNETFVIWGA T FRLEN  +
Sbjct  106  DPVAAARDAGLPGGALVCLSLHVGQIQPGGLRGNHRHHTCNETFVIWGAKTKFRLENADV  165

Query  726  -QKGYAEVKLGADEVAV  773
              +GY E  + ADEVA+
Sbjct  166  NDRGYGEAMIAADEVAI  182



>emb|CAC00745.1| hypothetical protein [Arabidopsis thaliana]
Length=239

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 117/214 (55%), Gaps = 41/214 (19%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWVT  377
            MANPRR +                        +S L + LKKP A P LLS FLLLTW++
Sbjct  1    MANPRRVVIENQR-------------------LSPLINLLKKPQAIPLLLSLFLLLTWIS  41

Query  378  FRFQRPSEHFPSMGLG--SGIMNMGRRHWSSNEDNSANLVRF-PASSPLVAKDKRGWLLN  548
             R Q  S+   S         +N        ++D+ ANLVRF  AS     KD RGWLL+
Sbjct  42   LRLQHSSQSHVSSSSSHPKSTVNSHPDLKVYDDDDKANLVRFGLASLSPARKDDRGWLLD  101

Query  549  PISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFR-------  707
            P+ LA DS + GG  SC SIHVGEI+PGG+RGNHRHHTCNETFVIWGA T FR       
Sbjct  102  PVILARDSELKGGAASCVSIHVGEIRPGGLRGNHRHHTCNETFVIWGAKTKFRGLGVFKV  161

Query  708  ------------LENNAIQKGYAEVKLGADEVAV  773
                        LEN+ + KGYAEV +G DEVAV
Sbjct  162  SRQTLDFSSFDVLENHEVDKGYAEVLIGEDEVAV  195



>gb|ABN05965.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AFK48451.1| unknown [Medicago truncatula]
 gb|AES81042.2| plant/T8M16-150 protein, putative [Medicago truncatula]
Length=229

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = +3

Query  297  SSLKSFLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDN  476
            S + SFL++PH+ PF+LS FL L W++ R  R S   P                S N D 
Sbjct  38   SLVTSFLQRPHSLPFVLSIFLFLAWISLRSYRSSHPLPLS--------------SPNNDV  83

Query  477  SANLVRFPASSPL-VAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHR  653
             ANL RF +  P  +AKD RGW+L+PI+LAL S ISGG ++CAS+H+GEI+PG +RGNHR
Sbjct  84   KANLRRFTSRFPSPIAKDNRGWILDPIALALSSIISGGAVTCASLHLGEIRPGKLRGNHR  143

Query  654  HHTCNETFVIWGAHTLFRLENNAIQK-GYAEVKLGADEVAV  773
            HH CNETFV+WGA   FR+EN+ +   GYAEV +  DEV V
Sbjct  144  HHDCNETFVLWGAAIKFRVENSEVTDIGYAEVIIDRDEVVV  184



>gb|KHN34590.1| hypothetical protein glysoja_011143, partial [Glycine soja]
Length=144

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  471  DNSANLVRFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNH  650
            D  ANLVRF AS   VAKD RGW+ +PI+LA  S ISGG +SCAS+HVGEI+PG +R NH
Sbjct  1    DIRANLVRFDASE--VAKDNRGWIFDPIALARASGISGGAVSCASLHVGEIRPGKIRANH  58

Query  651  RHHTCNETFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            RHH  NETF+IWGA T FR+ENN    GYAEV LG DE+AV
Sbjct  59   RHHDSNETFLIWGAATKFRMENNDEDDGYAEVILGRDEIAV  99



>ref|XP_003624824.1| hypothetical protein MTR_7g088040 [Medicago truncatula]
Length=348

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = +3

Query  297  SSLKSFLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDN  476
            S + SFL++PH+ PF+LS FL L W++ R  R S   P                S N D 
Sbjct  38   SLVTSFLQRPHSLPFVLSIFLFLAWISLRSYRSSHPLPLS--------------SPNNDV  83

Query  477  SANLVRFPASSPL-VAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHR  653
             ANL RF +  P  +AKD RGW+L+PI+LAL S ISGG ++CAS+H+GEI+PG +RGNHR
Sbjct  84   KANLRRFTSRFPSPIAKDNRGWILDPIALALSSIISGGAVTCASLHLGEIRPGKLRGNHR  143

Query  654  HHTCNETFVIWGAHTLFRLENNAIQK-GYAEVKLGADEVAV  773
            HH CNETFV+WGA   FR+EN+ +   GYAEV +  DEV V
Sbjct  144  HHDCNETFVLWGAAIKFRVENSEVTDIGYAEVIIDRDEVVV  184



>ref|XP_006430429.1| hypothetical protein CICLE_v10012641mg [Citrus clementina]
 gb|ESR43669.1| hypothetical protein CICLE_v10012641mg [Citrus clementina]
Length=172

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 111/176 (63%), Gaps = 16/176 (9%)
 Frame = +3

Query  195  QMANPRRTLFPASGTHHQLPVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllTWV  374
            ++ NPRR  F  +  +   P +         + VS + +FLK+P AFPFLLS F+LLTW+
Sbjct  2    RIPNPRRGSFSNTQQNPDNPFNVQN-----LSTVSIILNFLKRPQAFPFLLSIFVLLTWL  56

Query  375  TFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNS--ANLVRFPAS--SPLVAKDKRGWL  542
            + R Q  S  F        +       WSS +D+   ANLVRF +     L+ KD+RGWL
Sbjct  57   SLRLQHSSSQFE-------LNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWL  109

Query  543  LNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            LNPISLA+D+ + GG +SC S+HVGEI+PG +RGNHRH+T NETFVIWGA T FR+
Sbjct  110  LNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRV  165



>tpg|DAA57181.1| TPA: hypothetical protein ZEAMMB73_212841 [Zea mays]
Length=182

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 114/177 (64%), Gaps = 22/177 (12%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQL---PVSTGGGDQSPATVVSSLKSFLKKPHAfpfllsfflllT  368
            MANPRR    A   H Q    P+ +      P T+ SSL  FLK+P +FPFLLS F+LLT
Sbjct  1    MANPRR----AIALHIQTQPPPLPSTAAALPPHTLASSLLHFLKRPASFPFLLSLFVLLT  56

Query  369  WVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLVRFPAS---SPLVAKDKRGW  539
            W++ RF  PS   PS+G        GR   S   +  ANLVRFPA    +P +A+D RGW
Sbjct  57   WLSLRFHHPSPP-PSLG--------GRP--SVVHEPQANLVRFPAELYPTP-IARDGRGW  104

Query  540  LLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRL  710
            LL+P++ A D+ + GG + C  +HVG+I+PGG+RGNHRHHTCNETFVIWGA T FR+
Sbjct  105  LLDPVAAARDAGLPGGALVCLLLHVGQIQPGGLRGNHRHHTCNETFVIWGAKTKFRV  161



>emb|CDM84637.1| unnamed protein product [Triticum aestivum]
Length=226

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 17/158 (11%)
 Frame = +3

Query  312  FLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWSSNEDNSANLV  491
            FLK+P +FPFLLS F+LLTW++  F +P+   PS  L    +           D  ANLV
Sbjct  38   FLKRPASFPFLLSLFVLLTWISLHFHQPT---PSASLQRPTVV---------HDPQANLV  85

Query  492  RFPAS---SPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHT  662
            R+PA+   +P +A D+RGWLL+P++ A ++ +  G + C S+HVG I+PGG+RGNHRHHT
Sbjct  86   RYPAALHPTP-IAADERGWLLDPVAAAREAGLPDGALVCLSLHVGLIQPGGLRGNHRHHT  144

Query  663  CNETFVIWGAHTLFRLENNAIQ-KGYAEVKLGADEVAV  773
            CNETFVIWGA T FRLEN  ++ KGY E  + ADEVA+
Sbjct  145  CNETFVIWGAKTKFRLENPDVKDKGYGEAIIAADEVAI  182



>ref|XP_009410442.1| PREDICTED: uncharacterized protein LOC103992466 [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 107/160 (67%), Gaps = 6/160 (4%)
 Frame = +3

Query  312  FLKKPHAfpfllsfflllTWVTFRFQRPSEHFPSMGLGSGIMNMGRRHWS---SNEDNSA  482
            FLK+P AFP LLS F+LLTWV  R + P+       L SG+ +   R  +      D+ A
Sbjct  45   FLKRPSAFPLLLSVFVLLTWVFLRLEHPTSAGLRSSLSSGLSSSSSRSGTGPVDGADSDA  104

Query  483  NLVRFPASS--PLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRH  656
            NLVRF A      +A+D RGWL++P++ A ++ + G    CAS+HVG+I+PGG+RGNHRH
Sbjct  105  NLVRFSAVEFPSKIARDWRGWLMDPVTAAREARLRGRASKCASVHVGQIQPGGLRGNHRH  164

Query  657  HTCNETFVIWGAHTLFRLEN-NAIQKGYAEVKLGADEVAV  773
            HTCNETF+IWGA T FRLEN N   KGYAEV +  DEVA+
Sbjct  165  HTCNETFIIWGADTKFRLENPNVKDKGYAEVTIRYDEVAL  204



>ref|XP_007028182.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY08684.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=162

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 27/178 (15%)
 Frame = +3

Query  198  MANPRRTLFPASGTHHQLPVSTGGGDQSPA-TVVSSLKSFLKKPHAfpfllsfflllTWV  374
            MANPRR     S +++   V      Q+ + + +SS+K  LKKP AFPF+L   LLLTWV
Sbjct  1    MANPRRI----SHSNNSQSVENPFQFQTQSLSYLSSVKHLLKKPQAFPFMLLLLLLLTWV  56

Query  375  TFRFQR--PSEHFPSMGLGSGIMNMGRRHWSSNEDN----SANLVRFPASSPL-VAKDKR  533
            + R Q   PS H                 W  ++ +     ANL RF +  P  + KDKR
Sbjct  57   SLRLQYSSPSHH---------------EQWGKDDGDDGDFKANLFRFRSGLPSDIVKDKR  101

Query  534  GWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFR  707
            GWLLNP+SLAL + + GG MSC S+H+GEI+PG VRGNHRH+TCNETFVIWGA T FR
Sbjct  102  GWLLNPVSLALQNGVKGGAMSCVSVHIGEIRPGCVRGNHRHYTCNETFVIWGAKTKFR  159



>ref|XP_006832889.1| hypothetical protein AMTR_s00095p00110450 [Amborella trichopoda]
 gb|ERM98167.1| hypothetical protein AMTR_s00095p00110450 [Amborella trichopoda]
Length=243

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = +3

Query  477  SANLVRFPAS--SPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNH  650
            S N + + ++  S     D+RGWLLNP++ A +S +SGG + C S+HVGEI+PGGVRGNH
Sbjct  98   SDNFIAYSSATHSNFFFNDRRGWLLNPVTAARESGLSGGALDCRSVHVGEIRPGGVRGNH  157

Query  651  RHHTCNETFVIWGAHTLFRLE-NNAIQKGYAEVKLGADEVAV  773
            RHH C+ETF+IWGA TLFR+E N+ I K Y E  + ADEVAV
Sbjct  158  RHHNCSETFIIWGAKTLFRVEKNHVIGKDYEEFIVAADEVAV  199



>gb|ADE77103.1| unknown [Picea sitchensis]
Length=187

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  501  ASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFV  680
            A  PL   DKRGWL++P++ A ++ +SGG +SC  +HVGEIKP GVR NHRH +CNETF+
Sbjct  52   AFVPLPFPDKRGWLMDPVAAAAEAGLSGGAISCEGVHVGEIKPRGVRANHRHRSCNETFI  111

Query  681  IWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            IWGA TLFR E++  +KGY EV +GA++V V
Sbjct  112  IWGAKTLFRFEDSGREKGYGEVLVGAEDVVV  142



>emb|CAN63125.1| hypothetical protein VITISV_010768 [Vitis vinifera]
Length=168

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +3

Query  582  GGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWGAHTLFRLENNAI-QKGYAEVKLGA  758
            GG ++CAS+HVGEI+PGG+RGNHRHH CNETF+IWGA T FRLEN+ + +KGYAEV +GA
Sbjct  59   GGAVNCASVHVGEIRPGGMRGNHRHHGCNETFIIWGAKTAFRLENHQVPEKGYAEVIIGA  118

Query  759  DEVAV  773
            +EVAV
Sbjct  119  NEVAV  123



>gb|KHN24203.1| Aspartic proteinase [Glycine soja]
Length=229

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +3

Query  495  FPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNET  674
            F AS   VAKDK GW+ +PI+LAL   IS G ++C S+H+GEI+ G  R N RHH CNET
Sbjct  118  FDASK--VAKDKHGWIFDPIALALAFGISSGAVTCGSLHMGEIRVGNKRANQRHHICNET  175

Query  675  FVIWGAHTLFRL  710
            F+IWGA T FR+
Sbjct  176  FLIWGATTKFRM  187



>ref|XP_010463013.1| PREDICTED: uncharacterized protein LOC104743658 [Camelina sativa]
Length=98

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  639  RGNHRHHTCNETFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            + NH+HHTCNETFVIWGA T FRLEN+ ++KGYAEV +G DEVAV
Sbjct  9    KRNHQHHTCNETFVIWGAKTRFRLENHKVEKGYAEVLIGEDEVAV  53



>ref|XP_006589103.1| PREDICTED: uncharacterized protein LOC102659703 isoform X1 [Glycine 
max]
Length=153

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  510  PLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTCNETFVIWG  689
            PL+    R W    +   +  S +GG ++C S+H+GEI+ G  R N RHH CNETF+IWG
Sbjct  46   PLLLDAIRIWRRFCVENGIFES-AGGAVTCGSLHMGEIRVGNKRANQRHHICNETFLIWG  104

Query  690  AHTLFRL  710
            A T FR+
Sbjct  105  ATTKFRM  111



>ref|XP_002509315.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70573.1| predicted protein [Micromonas sp. RCC299]
Length=239

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query  486  LVRFPASSPLVAKDKRGWLLNPISLALDSSISGGTMSCASIHVGEIKPGGVRGNHRHHTC  665
            LV  P      +  +  W+ + +  A+D +   G   C  +HVG I+PGG RGNHRH T 
Sbjct  100  LVLLPGDDDPRSDGEDHWMTSVLD-AVDEAGLKGPSRCLDLHVGTIRPGGARGNHRHKTR  158

Query  666  NETFVIWGAHTLFRLENNAIQKGYAEVKLGADEVAV  773
            +E+ ++WGA    R+E   +  GY +  +  D+V V
Sbjct  159  DESLIVWGASGRIRVERPGM--GYHDYVIDRDDVVV  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424