BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13743_g3_i1 len=1161 path=[1037:0-555 108:556-591 1626:592-1160]

Length=1161
                                                                      Score     E

gb|AAD33880.1|AF141653_1  beta-1,3-glucanase                            347   2e-113   Nicotiana tabacum [American tobacco]
sp|P52399.1|E13L_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    347   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_009801409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    346   3e-113   
ref|XP_009780913.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    346   4e-113   
ref|XP_009796657.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        346   5e-113   
sp|P23547.1|E13G_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    344   2e-112   Nicotiana tabacum [American tobacco]
ref|XP_009775775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    344   2e-112   
sp|P23433.1|E13D_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    344   2e-112   Nicotiana tabacum [American tobacco]
sp|P52398.1|E13K_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    342   1e-111   Nicotiana tabacum [American tobacco]
sp|P23432.1|E13C_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    342   2e-111   Nicotiana tabacum [American tobacco]
gb|AAA34103.1|  PR2                                                     341   4e-111   Nicotiana tabacum [American tobacco]
ref|XP_009607576.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    341   4e-111   
ref|XP_009619948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    339   2e-110   
ref|XP_009596559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        339   3e-110   
gb|AAN78310.1|  acidic class II 1,3-beta-glucanase precursor            335   3e-109   Solanum tuberosum [potatoes]
ref|XP_007133418.1|  hypothetical protein PHAVU_011G177000g             334   2e-108   
ref|XP_006367558.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    334   3e-108   
ref|XP_006365633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    330   3e-107   
ref|NP_001234798.1|  glucan endo-1,3-beta-glucosidase A precursor       330   4e-107   
ref|XP_008227211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    329   1e-106   
ref|XP_006365629.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    328   4e-106   
ref|XP_009770429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    328   5e-106   
ref|XP_004228512.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    328   7e-106   
emb|CAA08910.1|  glucan endo-1,3-beta-D-glucosidase                     327   2e-105   Solanum tuberosum [potatoes]
emb|CAE53273.1|  1,3-beta-glucan glucanohydrolase                       326   2e-105   Solanum tuberosum [potatoes]
ref|XP_010101247.1|  Glucan endo-1,3-beta-glucosidase                   326   2e-105   
gb|KEH30624.1|  glucan endo-1,3-beta-glucosidase                        325   4e-105   
emb|CAE52322.1|  1,3-beta-D-glucan glucanohydrolase precursor           325   4e-105   Solanum tuberosum [potatoes]
ref|XP_003540349.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    325   4e-105   
ref|XP_009589771.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    325   5e-105   
ref|XP_006367559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    325   5e-105   
ref|XP_009587943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    325   6e-105   
ref|XP_009764461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    323   2e-104   
emb|CDO98259.1|  unnamed protein product                                322   6e-104   
ref|NP_001266064.1|  glucan endo-1,3-beta-glucosidase-like precursor    321   2e-103   
dbj|BAG34628.1|  beta-1,3-glucanase                                     320   3e-103   Lotus japonicus
pdb|3UR7|A  Chain A, Higher-density Crystal Structure Of Potato E...    320   3e-103   
ref|XP_007132239.1|  hypothetical protein PHAVU_011G077900g             320   4e-103   
gb|AAN78309.1|  acidic class II 1,3-beta-glucanase precursor            320   4e-103   Solanum tuberosum [potatoes]
dbj|BAE53384.1|  beta-1,3-glucanase                                     320   4e-103   
ref|XP_003607319.1|  Endo-beta-1 3-glucanase                            319   1e-102   
gb|AFK41254.1|  unknown                                                 319   2e-102   
pdb|4GZI|A  Chain A, Active-site Mutant Of Potato Endo-1,3-beta-g...    317   3e-102   
ref|XP_007211511.1|  hypothetical protein PRUPE_ppa007999mg             318   3e-102   
dbj|BAE53383.1|  beta-1,3-glucanase                                     318   5e-102   
gb|KHN05499.1|  Glucan endo-1,3-beta-glucosidase, acidic isoform ...    317   5e-102   
gb|AAL30420.1|AF434173_1  glucanase                                     316   2e-101   Sambucus nigra
ref|XP_003607315.1|  Glucan endo-1,3-beta-glucosidase                   315   3e-101   
ref|XP_009366077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    315   3e-101   
gb|ACU20860.1|  unknown                                                 315   4e-101   Glycine max [soybeans]
emb|CDP20080.1|  unnamed protein product                                315   5e-101   
ref|XP_008363318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    315   5e-101   
gb|AFP23132.1|  beta-1,3-glucanase                                      315   6e-101   
ref|NP_001237271.1|  endo-1,3-beta-glucanase precursor                  315   6e-101   
ref|XP_008366411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    315   7e-101   
ref|XP_009374912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    313   1e-100   
ref|XP_009592823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    313   2e-100   
ref|XP_002278123.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        313   3e-100   Vitis vinifera
ref|XP_002299791.2|  3-glucanase family protein                         312   4e-100   Populus trichocarpa [western balsam poplar]
gb|ABK95326.1|  unknown                                                 312   4e-100   Populus trichocarpa [western balsam poplar]
ref|XP_003607321.1|  Endo-beta-1 3-glucanase                            314   6e-100   
ref|XP_008227227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    311   1e-99    
gb|AAX81590.1|  beta-1,3-glucanase                                      311   3e-99    Fragaria x ananassa
ref|XP_003607316.1|  Glucan endo-1 3-beta-d-glucosidase                 310   3e-99    
ref|XP_010101245.1|  Glucan endo-1,3-beta-glucosidase                   310   3e-99    
emb|CDP09617.1|  unnamed protein product                                311   7e-99    
ref|XP_003537741.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    308   2e-98    
ref|XP_009790797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    308   3e-98    
ref|XP_011045404.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    308   3e-98    
ref|XP_007015141.1|  Glucan endo-1,3-beta-glucosidase, acidic, pu...    306   9e-98    
ref|XP_011001638.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    305   3e-97    
ref|XP_006423938.1|  hypothetical protein CICLE_v10029843mg             305   3e-97    
ref|XP_004291760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    304   7e-97    
gb|AAR06588.1|  beta-1,3-glucanase                                      304   9e-97    Vitis riparia [frost grape]
dbj|BAC66141.1|  beta-1,3-glucanase                                     304   1e-96    Fragaria x ananassa
ref|XP_004142554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    303   1e-96    
ref|XP_006480384.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    305   1e-96    
emb|CAH17549.1|  beta-1,3-glucanase                                     303   2e-96    Olea europaea
gb|KDP22122.1|  hypothetical protein JCGZ_25953                         302   3e-96    
ref|XP_008811757.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    303   3e-96    
ref|XP_010045033.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    302   3e-96    
ref|XP_007015119.1|  Glycosyl hydrolase superfamily protein, puta...    303   4e-96    
gb|AES89518.2|  glucan endo-1,3-beta-glucosidase                        305   5e-96    
gb|KDO61190.1|  hypothetical protein CISIN_1g048190mg                   301   7e-96    
dbj|BAC66185.1|  beta-1,3-glucanase                                     301   8e-96    Fragaria x ananassa
gb|AAX81589.1|  beta-1,3-glucanase                                      301   8e-96    Fragaria x ananassa
dbj|BAC66186.1|  beta-1,3-glucanase                                     301   9e-96    Fragaria x ananassa
ref|XP_010063513.1|  PREDICTED: lichenase                               302   9e-96    
ref|XP_006446183.1|  hypothetical protein CICLE_v10017983mg             300   1e-95    
ref|XP_006470762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    301   1e-95    
gb|KHN05500.1|  Glucan endo-1,3-beta-glucosidase                        298   8e-95    
ref|XP_004171028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    298   9e-95    
ref|XP_004232306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    298   2e-94    
ref|XP_004505795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    298   2e-94    
ref|XP_008356363.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    297   5e-94    
gb|AAO16642.1|  beta-1,3-glucanase                                      297   7e-94    Fragaria x ananassa
ref|XP_004297245.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    296   1e-93    
gb|AAF44667.2|AF239617_1  beta-1,3-glucanase                            296   1e-93    Vitis vinifera
ref|XP_003548789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    295   2e-93    
ref|XP_004154643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    297   2e-93    
ref|XP_007015136.1|  Glycosyl hydrolase superfamily protein, puta...    295   2e-93    
ref|XP_002513528.1|  Lichenase precursor, putative                      295   2e-93    Ricinus communis
ref|NP_001275613.1|  glucan endo-1,3-beta-glucosidase, acidic iso...    295   3e-93    
ref|XP_004139045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    296   3e-93    
ref|XP_007035767.1|  Glycosyl hydrolase superfamily protein             297   4e-93    
ref|XP_008223323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    295   7e-93    
ref|NP_001267896.1|  class I beta-1,3-glucanase precursor               295   8e-93    
ref|XP_002459073.1|  hypothetical protein SORBIDRAFT_03g045450          293   9e-93    Sorghum bicolor [broomcorn]
gb|ACD45060.1|  beta-1,3-glucanase                                      294   1e-92    Vitis riparia [frost grape]
ref|XP_008227224.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    295   1e-92    
gb|AIT56224.1|  beta-1,3 glucanase 3                                    293   1e-92    
emb|CDP14184.1|  unnamed protein product                                293   1e-92    
emb|CDP14179.1|  unnamed protein product                                293   1e-92    
emb|CAA09765.1|  beta-1,3-glucanase                                     293   2e-92    Cichorium intybus x Cichorium endivia
dbj|BAM28606.1|  beta-1,3-glucanase                                     293   2e-92    
gb|AAQ90286.1|  beta-1,3-glucanase, basic                               293   2e-92    Coffea arabica x Coffea canephora
ref|XP_009363234.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    292   3e-92    
ref|XP_009349227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    292   3e-92    
gb|AEE81082.1|  beta-1,3-glucanase                                      292   4e-92    
ref|XP_004505798.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    292   5e-92    
ref|NP_001268153.1|  beta 1-3 glucanase precursor                       292   5e-92    
gb|AGQ89281.1|  beta-1,3-glucanase A                                    291   6e-92    
ref|XP_003632274.2|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    291   7e-92    
ref|XP_008240769.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    291   9e-92    
gb|KHN03122.1|  Glucan endo-1,3-beta-glucosidase                        290   9e-92    
gb|AEV41413.1|  beta-1,3-glucanase                                      291   2e-91    
ref|XP_008443726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    290   2e-91    
ref|XP_008231643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    290   2e-91    
gb|ACZ74626.1|  beta-1,3-glucanase form RRII Gln 3                      291   2e-91    Hevea brasiliensis [Para rubber tree]
gb|AIR93912.1|  glucanase                                               297   3e-91    
ref|XP_008240767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    290   3e-91    
ref|XP_008811754.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    290   3e-91    
ref|XP_010273332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    290   4e-91    
ref|XP_007226561.1|  hypothetical protein PRUPE_ppa024457mg             289   5e-91    
gb|AAA34078.1|  beta(1,3)-glucanase regulator                           290   5e-91    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009414139.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    289   6e-91    
emb|CDP09619.1|  unnamed protein product                                288   8e-91    
ref|XP_008373020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    289   8e-91    
ref|XP_009391471.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    288   9e-91    
sp|P27666.1|E13F_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    289   1e-90    Nicotiana tabacum [American tobacco]
ref|XP_002459074.1|  hypothetical protein SORBIDRAFT_03g045460          288   1e-90    Sorghum bicolor [broomcorn]
ref|XP_006365201.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   1e-90    
gb|ACD45061.1|  beta-1,3-glucanase                                      288   1e-90    Vitis vinifera
gb|KHN05498.1|  Glucan endo-1,3-beta-glucosidase, basic vacuolar ...    288   2e-90    
gb|ACF93731.1|  basic beta-1,3-glucanase                                289   2e-90    Nicotiana tabacum [American tobacco]
ref|XP_009760304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   2e-90    
ref|XP_008240766.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   2e-90    
ref|XP_008811753.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    287   2e-90    
ref|XP_009626316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   2e-90    
emb|CAA30261.1|  beta-glucanase precursor                               288   3e-90    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAL30426.1|AF435089_1  beta-1,3-glucanase                            287   3e-90    Prunus persica
ref|XP_007212652.1|  hypothetical protein PRUPE_ppa018225mg             287   3e-90    
emb|CAN71821.1|  hypothetical protein VITISV_027077                     287   3e-90    Vitis vinifera
sp|P23431.1|E13B_NICPL  RecName: Full=Glucan endo-1,3-beta-glucos...    288   3e-90    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P52396.1|E13I_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    285   4e-90    Nicotiana tabacum [American tobacco]
sp|P15797.2|E13B_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    288   4e-90    Nicotiana tabacum [American tobacco]
gb|ABD85024.1|  beta-1,3-glucanase                                      286   5e-90    Lilium hybrid division VII [oriental hybrid lilies]
sp|P07979.3|GUB_NICPL  RecName: Full=Lichenase; AltName: Full=End...    288   6e-90    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010273331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    287   6e-90    
ref|XP_010279591.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   7e-90    
ref|NP_001234805.1|  glucan endo-1,3-beta-glucosidase B precursor       287   7e-90    
ref|XP_004251356.2|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    286   8e-90    
dbj|BAA77783.1|  beta 1,3-glucanase                                     286   9e-90    Oryza sativa [red rice]
ref|XP_002277446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        286   1e-89    Vitis vinifera
dbj|BAF95876.1|  beta 1-3 glucanase                                     286   1e-89    Vitis hybrid cultivar
ref|XP_003607328.1|  Beta-1 3-glucanase                                 286   1e-89    
ref|XP_007015137.1|  Glycosyl hydrolase superfamily protein, puta...    286   2e-89    
ref|XP_006599939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    293   2e-89    
ref|XP_010921891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    285   2e-89    
gb|AHW57401.1|  beta-1,3 glucanase 4                                    285   2e-89    
gb|AAD28732.1|AF112965_1  beta-1,3-glucanase precursor                  285   2e-89    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010921893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    285   3e-89    
gb|AAA63541.1|  basic beta-1,3-glucanase                                285   3e-89    Nicotiana tabacum [American tobacco]
sp|P23546.1|E13E_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    285   4e-89    Nicotiana tabacum [American tobacco]
ref|XP_011083774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    284   4e-89    
emb|CBH32608.1|  glucan endo-1,3-beta-glucosidase GII precursor,p...    284   5e-89    
ref|XP_011090470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   5e-89    
gb|ADW08742.1|  1,3-beta-D-glucanase GH17_39                            284   6e-89    
gb|AFJ97274.1|  beta-1,3-glucanase                                      285   6e-89    
gb|AIS22073.1|  beta-1,3 glucanase 4                                    284   6e-89    
ref|XP_002277193.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   8e-89    Vitis vinifera
gb|ABG49448.1|  beta-1,3-glucanase                                      285   8e-89    Hevea brasiliensis [Para rubber tree]
ref|XP_007203676.1|  hypothetical protein PRUPE_ppa026579mg             282   9e-89    
ref|XP_010921866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    283   1e-88    
ref|XP_006365200.1|  PREDICTED: uncharacterized protein LOC102593111    293   1e-88    
gb|AAP87281.1|  beta-1,3-glucanase                                      284   1e-88    Hevea brasiliensis [Para rubber tree]
sp|P52408.1|E13B_PRUPE  RecName: Full=Glucan endo-1,3-beta-glucos...    283   2e-88    Prunus persica
gb|ABN03966.1|  beta-1,3-glucanase                                      283   2e-88    Hevea brasiliensis [Para rubber tree]
ref|XP_007203263.1|  hypothetical protein PRUPE_ppa025430mg             283   3e-88    
gb|ACY91851.1|  beta-1,3-glucanase form RRII Gln 2                      283   3e-88    Hevea brasiliensis [Para rubber tree]
gb|ABN09655.1|  beta-1,3-glucanase                                      283   3e-88    Hevea brasiliensis [Para rubber tree]
ref|XP_006358202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   3e-88    
gb|ABB04443.1|  pathogenesis-related protein 6                          281   4e-88    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABN09654.1|  beta-1,3-glucanase                                      283   5e-88    Hevea brasiliensis [Para rubber tree]
ref|XP_010434858.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   5e-88    
ref|XP_010907249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    281   5e-88    
ref|XP_006365202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   6e-88    
gb|KEH41572.1|  glycoside hydrolase family 17 protein                   283   7e-88    
gb|EMS67695.1|  Glucan endo-1,3-beta-glucosidase GIII                   281   9e-88    
ref|XP_010921890.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    281   9e-88    
emb|CDP14183.1|  unnamed protein product                                281   1e-87    
prf||1410344A  glucan endoglucosidase                                   281   1e-87 
ref|XP_006414372.1|  hypothetical protein EUTSA_v10025628mg             281   1e-87    
gb|ACJ62652.1|  beta 1,3 glucanase                                      280   1e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62630.1|  beta 1,3 glucanase                                      280   2e-87    Zea mays subsp. parviglumis [Balsas teosinte]
pdb|4HPG|A  Chain A, Crystal Structure Of A Glycosylated Beta-1,3...    279   2e-87    
gb|KDP26103.1|  hypothetical protein JCGZ_21136                         280   2e-87    
ref|XP_010269788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    280   2e-87    
gb|ACJ62694.1|  beta 1,3 glucanase                                      280   2e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04452.1|  pathogenesis-related protein 6                          280   2e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62636.1|  beta 1,3 glucanase                                      280   2e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAX76839.1|  beta-1,3-glucanase                                      280   2e-87    Brassica rapa subsp. chinensis [bok-choy]
gb|ABJ74161.1|  beta-1,3-glucanase                                      279   2e-87    Hevea brasiliensis [Para rubber tree]
dbj|BAJ33717.1|  unnamed protein product                                280   2e-87    
ref|NP_001274869.1|  glucan endo-1,3-beta-glucosidase, basic isof...    280   3e-87    
ref|XP_004962627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    279   3e-87    
gb|AIT56226.1|  beta-1,3 glucanase 6                                    280   3e-87    
gb|AFU52655.1|  beta-1,3-glucanase 22                                   280   3e-87    
ref|XP_004516619.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    280   3e-87    
ref|XP_010090235.1|  Glucan endo-1,3-beta-glucosidase, basic isoform    279   4e-87    
gb|ABJ98942.1|  beta-1,3-glucanase                                      279   4e-87    Musa x paradisiaca [banana]
gb|KHN03123.1|  Glucan endo-1,3-beta-glucosidase                        278   4e-87    
emb|CAB38443.1|  beta-1,3-glucanase                                     279   5e-87    Hevea brasiliensis [Para rubber tree]
gb|ABM74067.1|  beta-1,3-glucanase 1                                    279   5e-87    Prunus avium [gean]
gb|ABB04444.1|  pathogenesis-related protein 6                          279   5e-87    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004516618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    280   5e-87    
ref|XP_004505799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    278   6e-87    
gb|ACJ62691.1|  beta 1,3 glucanase                                      278   6e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62646.1|  beta 1,3 glucanase                                      278   6e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62647.1|  beta 1,3 glucanase                                      278   7e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62696.1|  beta 1,3 glucanase                                      278   7e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62629.1|  beta 1,3 glucanase                                      278   7e-87    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006409034.1|  hypothetical protein EUTSA_v10003126mg             280   7e-87    
gb|ACJ62633.1|  beta 1,3 glucanase                                      278   8e-87    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003607322.1|  Endo-1 3-beta-glucanase                            280   8e-87    
gb|ACJ62673.1|  beta 1,3 glucanase                                      278   8e-87    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006396056.1|  hypothetical protein EUTSA_v10007971mg             279   8e-87    
gb|ABB04441.1|  pathogenesis-related protein 6                          278   9e-87    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABN09653.1|  beta-1,3-glucanase                                      279   9e-87    Hevea brasiliensis [Para rubber tree]
ref|XP_008351633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    278   1e-86    
gb|ACJ62639.1|  beta 1,3 glucanase                                      278   1e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62625.1|  beta 1,3 glucanase                                      278   1e-86    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010273330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    277   1e-86    
ref|XP_008240765.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    278   1e-86    
gb|ACJ62645.1|  beta 1,3 glucanase                                      278   1e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62680.1|  beta 1,3 glucanase                                      278   1e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04445.1|  pathogenesis-related protein 6                          278   1e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAF08679.1|  beta-1,3-glucanase                                      277   1e-86    Musa acuminata [banana]
ref|XP_006284042.1|  hypothetical protein CARUB_v10005163mg             278   2e-86    
gb|AAA87456.1|  beta-1,3-glucanase                                      279   2e-86    Hevea brasiliensis [Para rubber tree]
gb|ACJ62688.1|  beta 1,3 glucanase                                      277   2e-86    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006645312.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    286   2e-86    
gb|AAB82772.2|  beta-1, 3-glucananse                                    277   2e-86    Musa acuminata [banana]
ref|XP_009139044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    277   2e-86    
gb|ABA33843.1|  pathogenesis-related protein 6                          277   2e-86    Zea diploperennis [chapule]
gb|ACJ62674.1|  beta 1,3 glucanase                                      277   2e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62685.1|  beta 1,3 glucanase                                      277   2e-86    Zea mays subsp. parviglumis [Balsas teosinte]
tpg|DAA55874.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    277   2e-86    
gb|ABB04447.1|  pathogenesis-related protein 6                          277   3e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62661.1|  beta 1,3 glucanase                                      277   3e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAG24921.1|AF311749_1  beta-1,3-glucanase                            276   3e-86    Hevea brasiliensis [Para rubber tree]
gb|ABB04442.1|  pathogenesis-related protein 6                          277   3e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAC19114.1|  1,3-beta-glucan glucanohydrolase                        278   3e-86    Solanum tuberosum [potatoes]
gb|ACJ62663.1|  beta 1,3 glucanase                                      276   3e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33840.1|  pathogenesis-related protein 6                          276   3e-86    Zea diploperennis [chapule]
emb|CDY30991.1|  BnaC04g24330D                                          278   3e-86    
gb|ACJ62638.1|  beta 1,3 glucanase                                      276   3e-86    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010938656.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    277   3e-86    
sp|P52407.2|E13B_HEVBR  RecName: Full=Glucan endo-1,3-beta-glucos...    278   4e-86    Hevea brasiliensis [Para rubber tree]
gb|ACJ62632.1|  beta 1,3 glucanase                                      276   4e-86    Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105947.1|  glucan endo-1,3-beta-glucosidase homolog1 pr...    276   4e-86    Zea mays [maize]
ref|XP_002878141.1|  hypothetical protein ARALYDRAFT_486169             276   4e-86    
ref|XP_009350958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   4e-86    
gb|ABB04446.1|  pathogenesis-related protein 6                          276   5e-86    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006430506.1|  hypothetical protein CICLE_v10012099mg             276   5e-86    
gb|ABB04451.1|  pathogenesis-related protein 6                          276   6e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62686.1|  beta 1,3 glucanase                                      276   6e-86    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADG56569.1|  beta-1,3-glucanase                                      276   7e-86    
gb|ADR71671.1|  beta-1,3-glucanase                                      276   7e-86    
gb|ACJ62657.1|  beta 1,3 glucanase                                      276   7e-86    
ref|XP_009419800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    276   7e-86    
gb|ABB04450.1|  pathogenesis-related protein 6                          276   8e-86    
gb|ACJ62642.1|  beta 1,3 glucanase                                      276   8e-86    
gb|ACJ62631.1|  beta 1,3 glucanase                                      276   8e-86    
gb|ACJ62668.1|  beta 1,3 glucanase                                      276   8e-86    
gb|ACJ62690.1|  beta 1,3 glucanase                                      275   8e-86    
gb|ACJ62644.1|  beta 1,3 glucanase                                      275   9e-86    
gb|ACJ62628.1|  beta 1,3 glucanase                                      275   9e-86    
gb|ACJ62624.1|  beta 1,3 glucanase                                      275   9e-86    
ref|XP_008360676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   9e-86    
gb|ABB04449.1|  truncated pathogenesis-related protein 6                275   9e-86    
gb|ABA33838.1|  pathogenesis-related protein 6                          275   9e-86    
ref|XP_007028622.1|  Glucan endo-1,3-beta-glucosidase                   276   9e-86    
gb|ABB04448.1|  pathogenesis-related protein 6                          275   1e-85    
gb|AES89519.2|  glycoside hydrolase family 17 protein                   277   1e-85    
gb|ABK96486.1|  unknown                                                 276   2e-85    
ref|XP_008459107.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   2e-85    
ref|XP_009348395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   2e-85    
ref|XP_004295093.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   2e-85    
sp|P52400.1|E131_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...    275   2e-85    
ref|XP_011010204.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   2e-85    
gb|ACJ62662.1|  beta 1,3 glucanase                                      274   2e-85    
ref|XP_011039449.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   2e-85    
ref|XP_010440186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   3e-85    
gb|AAD10382.1|  beta-1,3-glucanase precursor                            274   3e-85    
ref|XP_011013086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   3e-85    
ref|NP_193361.4|  putative beta-1,3-endoglucanase                       275   3e-85    
ref|XP_006645316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    274   3e-85    
ref|XP_002277173.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   3e-85    
ref|XP_009336583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    274   4e-85    
ref|XP_006482037.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    274   4e-85    
ref|XP_010449818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    274   4e-85    
gb|ACJ62655.1|  beta 1,3 glucanase                                      274   4e-85    
ref|XP_010907250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    274   5e-85    
gb|ACU78080.1|  beta-1,3-glucanase                                      274   5e-85    
ref|NP_001045372.1|  Os01g0944700                                       273   5e-85    
gb|ABC94639.1|  glucanase                                               274   5e-85    
gb|KFK34961.1|  hypothetical protein AALP_AA5G216400                    273   5e-85    
ref|XP_006292288.1|  hypothetical protein CARUB_v10018497mg             274   6e-85    
ref|XP_010525511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    273   6e-85    
gb|ADW08743.1|  1,3-beta-D-glucanase GH17_44                            274   7e-85    
ref|XP_010056683.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    273   8e-85    
ref|XP_007028619.1|  Glucan endo-1,3-beta-glucosidase, putative         274   9e-85    
ref|XP_006599943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    273   1e-84    
ref|XP_010036312.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    273   1e-84    
ref|NP_001234155.1|  glucan endo-1,3-beta-D-glucosidase precursor       273   1e-84    
ref|XP_009146295.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    273   1e-84    
ref|XP_006491501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    274   1e-84    
ref|XP_002868146.1|  AT4g16260/dl4170c                                  273   1e-84    
emb|CDY32230.1|  BnaA01g17540D                                          273   1e-84    
ref|XP_011083775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    273   1e-84    
gb|ADG36438.1|  glucanase                                               271   2e-84    
ref|XP_010673693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    272   2e-84    
pdb|2CYG|A  Chain A, Crystal Structure At 1.45- Resolution Of The...    271   2e-84    
gb|KDO39186.1|  hypothetical protein CISIN_1g018955mg                   272   2e-84    
gb|EYU35916.1|  hypothetical protein MIMGU_mgv1a009371mg                272   2e-84    
emb|CAA92278.1|  1,3-beta-glucanase                                     272   2e-84    
ref|XP_004505796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    273   2e-84    
ref|XP_002314934.2|  Glucan endo-1 family protein                       273   2e-84    
emb|CDY34445.1|  BnaC01g21880D                                          272   2e-84    
gb|EAY77172.1|  hypothetical protein OsI_05142                          271   3e-84    
gb|ABU40624.1|  beta-1,3-glucananse                                     272   3e-84    
gb|KFK36125.1|  hypothetical protein AALP_AA4G081000                    272   3e-84    
gb|AFJ97275.1|  beta-1,3-glucanase                                      273   3e-84    
ref|XP_008800262.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        271   4e-84    
ref|XP_010427595.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    271   4e-84    
ref|XP_010692567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    271   4e-84    
emb|CDP14182.1|  unnamed protein product                                273   4e-84    
gb|AGT78193.1|  beta-1,3 glucanase 2                                    271   4e-84    
gb|EAY77183.1|  hypothetical protein OsI_05153                          271   5e-84    
ref|XP_006421178.1|  hypothetical protein CICLE_v10005316mg             271   6e-84    
gb|EAY77205.1|  hypothetical protein OsI_05174                          271   6e-84    
dbj|BAG68207.1|  beta-1,3-glucanase                                     271   7e-84    
ref|XP_004135753.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    271   7e-84    
emb|CAA03908.1|  beta-1,3-glucanase                                     271   8e-84    
gb|AAD10383.1|  beta-1,3-glucanase precursor                            270   8e-84    
emb|CDX88937.1|  BnaA04g02490D                                          271   9e-84    
ref|XP_009139042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    271   9e-84    
ref|XP_011039450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    271   9e-84    
gb|KDO39187.1|  hypothetical protein CISIN_1g018955mg                   271   9e-84    
gb|ABQ45848.1|  beta-1,3-glucanase                                      270   9e-84    
gb|ABO87659.1|  beta-1,3 glucanase                                      271   1e-83    
emb|CDM85343.1|  unnamed protein product                                270   1e-83    
ref|XP_004173972.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    269   1e-83    
ref|XP_006421182.1|  hypothetical protein CICLE_v10005195mg             271   2e-83    
ref|XP_009414181.1|  PREDICTED: lichenase-like                          270   2e-83    
ref|XP_010273335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    270   2e-83    
ref|XP_006491503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    270   2e-83    
gb|ABA33845.1|  pathogenesis-related protein 6                          269   2e-83    
ref|NP_191286.1|  beta-1,3-glucanase 1                                  270   2e-83    
dbj|BAJ93960.1|  predicted protein                                      270   2e-83    
gb|AAL35900.1|AF443600_1  endo-1,3-beta-glucanase                       269   2e-83    
ref|XP_006358017.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    270   2e-83    
ref|XP_010427596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    270   2e-83    
gb|ABK28605.1|  unknown                                                 270   2e-83    
ref|NP_001045357.1|  Os01g0940800                                       269   3e-83    
ref|XP_009414358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    269   3e-83    
ref|XP_010653914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    269   3e-83    
ref|XP_002308921.2|  hypothetical protein POPTR_0006s04460g             270   3e-83    
ref|XP_009629906.1|  PREDICTED: lichenase                               270   3e-83    
gb|AEQ01058.1|  putative endo-beta-1,3-glucanase                        270   4e-83    
gb|KDO40853.1|  hypothetical protein CISIN_1g0197552mg                  268   5e-83    
ref|XP_003554151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    269   5e-83    
gb|AIT56229.1|  beta-1,3 glucanase 2                                    269   5e-83    
ref|XP_010921895.1|  PREDICTED: lichenase-2-like                        268   5e-83    
ref|XP_009348394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    269   6e-83    
emb|CDX72059.1|  BnaC08g28150D                                          268   6e-83    
ref|XP_006421176.1|  hypothetical protein CICLE_v10005181mg             270   6e-83    
gb|AAM61105.1|  glucan endo-1,3-beta-D-glucosidase-like protein         268   7e-83    
ref|XP_007202324.1|  hypothetical protein PRUPE_ppa008126mg             268   7e-83    
ref|XP_009336584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    268   7e-83    
ref|XP_006491499.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    268   8e-83    
ref|XP_010097796.1|  Glucan endo-1,3-beta-glucosidase, basic vacu...    268   8e-83    
ref|XP_008392341.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    268   9e-83    
gb|AEO27890.1|  beta-1,3-glucanase                                      268   9e-83    
ref|XP_006421179.1|  hypothetical protein CICLE_v10007126mg             268   1e-82    
gb|AAF33405.1|AF230109_1  beta-1,3 glucanase                            268   1e-82    
gb|ADW08746.1|  1,3-beta-D-glucanase GH17_101                           268   1e-82    
ref|NP_001045359.1|  Os01g0941400                                       268   1e-82    
ref|XP_004505797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    267   1e-82    
ref|XP_010551091.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    268   1e-82    
gb|ABC69706.1|  beta-1,3-glucanase                                      268   1e-82    
ref|XP_009139043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        268   1e-82    
gb|KDP26100.1|  hypothetical protein JCGZ_21133                         268   1e-82    
gb|AAB03501.1|  beta-1,3-glucanase                                      268   2e-82    
ref|XP_009597885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    267   2e-82    
emb|CAA38324.1|  glucan endo-1,3-beta-glucosidase                       267   2e-82    
gb|EYU45079.1|  hypothetical protein MIMGU_mgv1a009451mg                267   2e-82    
ref|XP_002323325.2|  hypothetical protein POPTR_0016s05800g             267   2e-82    
ref|XP_006373789.1|  hypothetical protein POPTR_0016s05780g             266   2e-82    
dbj|BAO09557.1|  beta-1,3-glucanase                                     266   3e-82    
emb|CBH32609.1|  glucan endo-1,3-beta-glucosidase GII precursor,p...    266   4e-82    
sp|P49236.1|E13B_BRACM  RecName: Full=Glucan endo-1,3-beta-glucos...    266   4e-82    
gb|ACY06774.1|  glucanase                                               266   4e-82    
dbj|BAJ99108.1|  predicted protein                                      266   4e-82    
emb|CDX72057.1|  BnaC08g28170D                                          266   5e-82    
ref|XP_008360675.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    266   5e-82    
ref|XP_008788591.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    266   5e-82    
ref|XP_008811756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    266   6e-82    
ref|XP_011027332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    266   7e-82    
ref|XP_010056661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    266   7e-82    
gb|AAD28734.1|AF112967_1  beta-1,3-glucanase precursor                  265   8e-82    
gb|KDO43948.1|  hypothetical protein CISIN_1g018966mg                   266   8e-82    
ref|XP_006491502.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    266   8e-82    
ref|XP_010036311.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    265   9e-82    
ref|NP_001045358.1|  Os01g0941200                                       265   1e-81    
ref|XP_006491500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    266   1e-81    
ref|XP_003569324.2|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    265   1e-81    
ref|XP_002513812.1|  Lichenase precursor, putative                      265   1e-81    
gb|KHN14941.1|  Glucan endo-1,3-beta-glucosidase                        265   1e-81    
gb|KDO40855.1|  hypothetical protein CISIN_1g043874mg                   264   1e-81    
ref|XP_009795195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    265   2e-81    
gb|EAY77204.1|  hypothetical protein OsI_05173                          264   2e-81    
ref|XP_003554152.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    264   4e-81    
gb|ABK58141.1|  beta-1,3-glucanase                                      263   4e-81    
ref|XP_008245692.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    264   5e-81    
ref|XP_010427593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    263   5e-81    
ref|XP_006409033.1|  hypothetical protein EUTSA_v10003127mg             263   5e-81    
gb|KGN65972.1|  hypothetical protein Csa_1G555080                       273   6e-81    
gb|AAY88778.1|  beta-1,3-glucanase                                      263   7e-81    
gb|AAY96422.1|  beta-1,3-glucanase                                      263   7e-81    
ref|XP_010673702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    263   8e-81    
ref|XP_009767610.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    262   1e-80    
ref|XP_002314939.2|  hypothetical protein POPTR_0010s15320g             262   1e-80    
emb|CDY33832.1|  BnaCnng07500D                                          263   1e-80    
ref|XP_008375107.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    263   1e-80    
ref|XP_002878139.1|  beta-1,3-glucanase 3                               261   1e-80    
gb|AAY40462.1|  beta-1,3-glucanase class III                            262   1e-80    
gb|ACU23690.1|  unknown                                                 262   1e-80    
gb|EAY77184.1|  hypothetical protein OsI_05154                          262   2e-80    
ref|XP_010673694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    262   2e-80    
ref|XP_010516340.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    262   2e-80    
ref|XP_008234087.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    262   2e-80    
ref|XP_002308018.2|  hypothetical protein POPTR_0006s04670g             262   2e-80    
ref|XP_008245642.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    261   2e-80    
ref|NP_001238474.1|  glucan endo-1,3-beta-glucosidase precursor         262   2e-80    
emb|CBI17186.3|  unnamed protein product                                261   2e-80    
ref|XP_008245641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    261   2e-80    
ref|XP_010427594.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    262   2e-80    
ref|XP_009611391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    261   3e-80    
emb|CDY67090.1|  BnaAnng23590D                                          261   3e-80    
ref|NP_001045373.2|  Os01g0944800                                       261   3e-80    
emb|CDP20081.1|  unnamed protein product                                259   3e-80    
ref|XP_009104047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    261   3e-80    
gb|AAA34082.1|  prepro-beta-1,3-glucanase precursor                     261   4e-80    
gb|ABC94638.2|  basic glucanase                                         261   4e-80    
gb|EMS59988.1|  Glucan endo-1,3-beta-glucosidase GIII                   260   4e-80    
ref|XP_009760305.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    261   5e-80    
ref|XP_003521159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    261   5e-80    
ref|XP_010232797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   6e-80    
ref|NP_191285.1|  beta 1,3-glucanase 2                                  261   6e-80    
ref|XP_009626317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    260   7e-80    
gb|AAM75342.1|AF515785_1  beta-1,3-glucanase II                         260   7e-80    
ref|XP_008354184.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    261   9e-80    
ref|XP_002442416.1|  hypothetical protein SORBIDRAFT_08g019670          260   9e-80    
ref|XP_010056651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    260   1e-79    
gb|AFU52648.1|  beta-1,3-glucanase 13                                   260   1e-79    
ref|XP_006645313.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   1e-79    
gb|KFK34960.1|  hypothetical protein AALP_AA5G216300                    259   1e-79    
prf||1803523A  beta glucanase:ISOTYPE=II                                260   1e-79 
emb|CDY06122.1|  BnaA09g36580D                                          260   1e-79    
gb|AHE76175.1|  beta-1,3-endoglucanase                                  259   1e-79    
ref|XP_009116429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    260   1e-79    
gb|AFN85666.1|  glucanase 1                                             260   1e-79    
ref|XP_006291444.1|  hypothetical protein CARUB_v10017580mg             260   1e-79    
gb|AAD10381.1|  beta-1,3-glucanase precursor                            259   2e-79    
ref|XP_009587264.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    259   2e-79    
gb|AFA26674.1|  beta-1,3-glucanase                                      258   2e-79    
ref|NP_001105734.1|  glucan endo-1,3-beta-glucosidase, acidic iso...    259   2e-79    
ref|NP_191283.2|  beta-1,3-glucanase 3                                  259   3e-79    
ref|XP_008244290.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    259   3e-79    
emb|CDX75986.1|  BnaA04g02500D                                          258   3e-79    
ref|XP_006644609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    258   4e-79    
sp|P15737.1|E13B_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...    258   4e-79    
ref|XP_007221101.1|  hypothetical protein PRUPE_ppa017239mg             258   4e-79    
sp|P52402.1|E133_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...    258   4e-79    
ref|XP_010504651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    258   4e-79    
ref|XP_009116431.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    259   4e-79    
ref|XP_008654818.1|  PREDICTED: putative O-Glycosyl hydrolase sup...    258   5e-79    
gb|AGW45300.1|  beta-1,3-glucanase                                      258   5e-79    



>gb|AAD33880.1|AF141653_1 beta-1,3-glucanase [Nicotiana tabacum]
Length=351

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 236/338 (70%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G +     I G QSIGVCYG+  NNLP+    I LY   GIR LR+Y PD N
Sbjct  10    LAAALVLVGLIMCSIQIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKLRIYYPDKN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL GSNI++I+ VPN  L ALAN + A  WVQ NI   +P V FKY+++GN+V P  
Sbjct  70    IFKALNGSNIEIILGVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
                 S++ L A+KNV+ AL AA  +  IK ST TYSGVL +TYPPE  +F++E K+ + P
Sbjct  130   NDQYSEFLLQAMKNVYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I+QFLA+NNLPLLAN+YPYF    +   V L +ALF++  + S    NLFDA+L+S Y A
Sbjct  190   IIQFLARNNLPLLANVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGPNVEIIVSESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDEN+K      + TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENDKI----GEITEKHFGLFSPDQRAKYQLNFN  343



>sp|P52399.1|E13L_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL153; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAD33881.1|AF141654_1 beta-1,3-glucanase [Nicotiana tabacum]
 gb|AAA34079.1| GL153 [Nicotiana tabacum]
Length=356

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 237/338 (70%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+I NNLP+    I LYK  GIR +R+Y PD N
Sbjct  10    LAAALVLVGLLMCSIQMIGAQSIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYYPDKN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL+GSNI++I+DVPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  70    IFKALKGSNIEIILDVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPIN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A++NV+ AL A+  +  IK +TATYSG+L +TYPP+  +F+ E  + + P
Sbjct  130   NGQYSQFLLHAMENVYNALAASGLQDKIKVTTATYSGLLANTYPPKASIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I+QFLAQNNLPLLAN+YPYF    +   V L +ALF++    S    NLFDA+L+S Y A
Sbjct  190   IIQFLAQNNLPLLANVYPYFVHISNTADVPLSYALFTQRGKNSAGYQNLFDAILDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKSIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDEN K      + TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENVKK----GEITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009801409.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL161 
[Nicotiana sylvestris]
Length=351

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 236/338 (70%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G +     I G QSIGVCYG+  NNLP+    I LY   GIR +R+Y PD N
Sbjct  10    LAAALVLVGLIMCSIQIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKMRIYYPDKN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL GSNI++I+ VPN  L ALAN + A  WVQ NI   +P V FKY+++GN+V P  
Sbjct  70    IFKALNGSNIEIILGVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
                 S++ L A+KNV+ AL AA  +  IK ST TYSGVL +TYPPE  +F++E K+ + P
Sbjct  130   NDQYSEFLLQAMKNVYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I+QFLA+NNLPLLAN+YPYF    +   V L +ALF++  + S    NLFDA+L+S Y A
Sbjct  190   IIQFLARNNLPLLANVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGPNVEIIVSESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDEN+K      + TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENDKI----GEITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009780913.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Nicotiana sylvestris]
Length=343

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 240/338 (71%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L  +    G QSIGVCYG+I NNLP+    I LY   GIR +R+Y PDTN
Sbjct  10    LAAALVLVGLLRCSIQMIGAQSIGVCYGKIANNLPSDQDVIKLYNANGIRRMRIYYPDTN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGK  427
             VF+AL+GSNI++I+DVPN  L +L + + A  WVQ NI+  +P+V FKY++VGNEV P  
Sbjct  70    VFNALKGSNIEIILDVPNQDLESLTDPSRANGWVQDNIINHFPDVKFKYISVGNEVSPTN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  + +   A++NV+ AL AA  +  IK STATYSG+L +TYPP++ +F+ E  + + P
Sbjct  130   NGQYAPFVAPAMQNVYNALAAAGLKDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I+QFL ++NLPLLAN+YPYF    +   V L +ALF++  + S    NLFDA+L+S Y A
Sbjct  190   IIQFLVRHNLPLLANVYPYFGHIFNTADVPLSYALFTQQGTNSAGYQNLFDALLDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDENNK      D TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENNK----GGDITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009796657.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana sylvestris]
Length=351

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 189/338 (56%), Positives = 240/338 (71%), Gaps = 16/338 (5%)
 Frame = +2

Query  86    AAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             AA+L+L+G L     I G QS IGVCYG I NNLP+    I LYK  GIR +R+Y PDTN
Sbjct  14    AAVLILVGLLMCNIQITGAQSNIGVCYGEIANNLPSEQDVINLYKANGIRKMRIYYPDTN  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL GSNI++I+DVPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  74    IFKALNGSNIEIILDVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPTN  133

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A+KNV+ AL AA  +  IK STATYSG+L +TYPP++ +F++E K+ + P
Sbjct  134   NGQYSQFLLHAMKNVYNALAAAGLQDKIKVSTATYSGLLANTYPPKDSIFREELKSFINP  193

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFS--EVNSYSEENNLFDAMLESFYA  772
             I++FLA+NNLPLLANIYPYF    +   V L +ALF+  E NS   +N LFDA+L+S Y 
Sbjct  194   IIEFLARNNLPLLANIYPYFGHIYNTVDVPLSYALFNQQETNSTGYQN-LFDALLDSIYF  252

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             AVEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NL+ HV+G  GT K+PG  IETY
Sbjct  253   AVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIIETY  312

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      + TE+HFGLF P+  +KY L+F
Sbjct  313   LFAMFDENEK----QGEITEKHFGLFYPNRAAKYQLNF  346



>sp|P23547.1|E13G_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GI9; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
AltName: Full=PR-2B; AltName: Full=PR-36; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAA63542.1| acidic beta-1,3-glucanase [Nicotiana tabacum]
Length=343

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 239/338 (71%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+  NNLP+    I LY   GIR +R+Y PDTN
Sbjct  10    LAAALVLVGLLICSIQMIGAQSIGVCYGKHANNLPSDQDVINLYNANGIRKMRIYNPDTN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGK  427
             VF+ALRGSNI++I+DVP   L +L + + A  WVQ NI+  +P+V FKY+AVGNEV PG 
Sbjct  70    VFNALRGSNIEIILDVPLQDLQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  + +   A++NV+ AL AA  +  IK STATYSG+L +TYPP++ +F+ E  + + P
Sbjct  130   NGQYAPFVAPAMQNVYNALAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSY-SEENNLFDAMLESFYAA  775
             I+QFL Q+NLPLLAN+YPYF    +   V L +ALF++  +  +   NLFDA+L+S Y A
Sbjct  190   IIQFLVQHNLPLLANVYPYFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGKAIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDENNK      D TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENNKE----GDITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009775775.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana sylvestris]
Length=343

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 240/338 (71%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+  NNLP+    I LY   GIR +R+Y PDTN
Sbjct  10    LAAALVLVGLLICSIQMIGAQSIGVCYGKHANNLPSDQDVINLYNANGIRKMRIYNPDTN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGK  427
             VF+ALRGSNI++I+DVP   L +L + + A  WVQ NI+  +P+V FKY+AVGNEV PG 
Sbjct  70    VFNALRGSNIEIILDVPLQDLQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  + +   A++NV+ AL AA  +  IK STATYSG+L +TYPP++ +F+ E  + + P
Sbjct  130   NGQYAPFVAPAMQNVYNALAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSY-SEENNLFDAMLESFYAA  775
             I+QFL Q+NLPLLAN+YPYF    +   V L +ALF++  +  +   NLFDA+L+S Y A
Sbjct  190   IIQFLVQHNLPLLANVYPYFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG+ IETYL
Sbjct  250   VEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGNAIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDENNK      D TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENNKE----GDITEKHFGLFSPDQRAKYQLNFN  343



>sp|P23433.1|E13D_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38303.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
Length=351

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/338 (56%), Positives = 240/338 (71%), Gaps = 16/338 (5%)
 Frame = +2

Query  86    AAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             AA+L+L+G L     I G QS IGVCYG I NNLP+    I LYK  GIR +R+Y PDTN
Sbjct  14    AAVLILVGLLMCNIQITGAQSNIGVCYGEIANNLPSEQDVINLYKANGIRKMRIYYPDTN  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL GSNI++I++VPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  74    IFKALNGSNIEIILEVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPTN  133

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A+KNV+ AL AA  +  IK STATYSG+L +TYPP++ +F++E K+ + P
Sbjct  134   NGQYSQFLLHAMKNVYNALAAAGLQDKIKVSTATYSGLLANTYPPKDSIFREELKSFINP  193

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFS--EVNSYSEENNLFDAMLESFYA  772
             I++FLA+NNLPLLANIYPYF    +   V L +ALF+  E NS   +N LFDA+L+S Y 
Sbjct  194   IIEFLARNNLPLLANIYPYFGHIYNTVDVPLSYALFNQQETNSTGYQN-LFDALLDSIYF  252

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             AVEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NL+ HV+G  GT K+PG  IETY
Sbjct  253   AVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIIETY  312

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      + TE+HFGLF P+  +KY L+F
Sbjct  313   LFAMFDENEK----QGEITEKHFGLFYPNRAAKYQLNF  346



>sp|P52398.1|E13K_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL161; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAA34053.1| beta-1,3-glucanase [Nicotiana tabacum]
Length=331

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             + I G QSIGVCYG+  NNLP+    I LY   GIR LR+Y PD N+F AL GSNI++I+
Sbjct  4     IQIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKLRIYYPDKNIFKALNGSNIEIIL  63

Query  293   DVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTG--SDYALAALKN  463
              VPN  L ALAN + A  WVQ NI   +P V FKY+++GN+V P      S++ L A+KN
Sbjct  64    GVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTNNDQYSEFLLQAMKN  123

Query  464   VHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLA  640
             V+ AL AA  +  IK ST TYSGVL +TYPPE  +F++E K+ + PI+QFLA+NNLPLLA
Sbjct  124   VYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINPIIQFLARNNLPLLA  183

Query  641   NIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVS  817
             N+YPYF    +   V L +ALF++  + S    NLFDA+L+S Y AVEKAGG NV+I+VS
Sbjct  184   NVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIVS  243

Query  818   ETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             E+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYLFAMFDEN+K     
Sbjct  244   ESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENDKI----  299

Query  998   NDQTERHFGLFTPDMMSKYNLSFN  1069
              + TE+HFGLF+PD  +KY L+FN
Sbjct  300   GEITEKHFGLFSPDQRAKYQLNFN  323



>sp|P23432.1|E13C_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38302.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
 emb|CAA57255.1| (1-)-beta-glucanase [Nicotiana tabacum]
Length=351

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/337 (54%), Positives = 240/337 (71%), Gaps = 14/337 (4%)
 Frame = +2

Query  86    AAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             AA+L+L+G L     + G QS IGVCYG+I NNLP+    I LYK  GIR +R+Y  DTN
Sbjct  14    AAVLILVGLLMCNIQMTGAQSNIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYNSDTN  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F +L GSNI++I+DVPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  74    IFKSLNGSNIEIILDVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPSN  133

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A++NV+ AL AA  +  IK +TATYSG+L +TYPP++ +F++E K+ + P
Sbjct  134   NGQYSQFLLHAMENVYNALAAAGLQDKIKVTTATYSGLLANTYPPKDSIFREEFKSFINP  193

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I++FLA+NNLPLLANIYPYF    +   V L +ALF++  + S    NLFDA+L+S Y A
Sbjct  194   IIEFLARNNLPLLANIYPYFGHIYNTVDVPLSYALFNQQGTNSTGYQNLFDALLDSIYFA  253

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NL+ HV+G  GT K+PG  +ETYL
Sbjct  254   VEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIVETYL  313

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             FAMFDEN K    N + TE+HFGLF P+  +KY L+F
Sbjct  314   FAMFDENEK----NGEVTEKHFGLFYPNRTAKYQLNF  346



>gb|AAA34103.1| PR2 [Nicotiana tabacum]
Length=343

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 239/338 (71%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+  NNLP+    I LY   GIR +R+Y PDTN
Sbjct  10    LAAALVLVGLLICSIQMIGAQSIGVCYGKHANNLPSDQDVINLYDANGIRKMRIYNPDTN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGK  427
             VF+ALRGSNI++I+DVP   L +L + + A  WVQ NI+  +P+V FKY+AVGNEV PG 
Sbjct  70    VFNALRGSNIEIILDVPLQDLQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  + +   A++NV+ AL AA  +  IK STATYSG+L +T PP++ +F+ E  + + P
Sbjct  130   NGQYAPFVAPAMQNVYNALAAAGLQDQIKVSTATYSGILANTNPPKDSIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSY-SEENNLFDAMLESFYAA  775
             I+QFL Q+NLPLLAN+YPYF    +   V L +ALF++  +  +   NLFDA+L+S Y A
Sbjct  190   IIQFLVQHNLPLLANVYPYFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG+ IETYL
Sbjct  250   VEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGNAIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDENNK      D TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENNKE----GDITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009607576.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL153 
[Nicotiana tomentosiformis]
Length=356

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 235/338 (70%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+I NNLP+    I LYK  GI  +R+Y PD N
Sbjct  10    LAAALVLVGVLMCSIQMIGAQSIGVCYGKIANNLPSEQDVINLYKANGITKMRIYYPDKN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F AL+GSNI++I+DVPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  70    IFKALKGSNIEIILDVPNQDLEALANSSIASGWVQDNIRSHFPYVKFKYISIGNEVSPSN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A++NV+ AL A+  +  IK +TA YSG+L +TYPP+  +F+ E  + + P
Sbjct  130   NGQYSQFLLHAMENVYNALAASGLQDKIKVTTAIYSGLLANTYPPKASIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I+QFLA+NNLPLLAN+YPY     +   V L +ALF++    S    NLFDA+L+S Y A
Sbjct  190   IIQFLARNNLPLLANVYPYLVHISNTAGVALSYALFTQRGKNSAGYQNLFDAILDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKSIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDEN+K      + TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENDK----KGEITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009619948.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana tomentosiformis]
Length=343

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 241/338 (71%), Gaps = 13/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA L+L+G L     + G QSIGVCYG+I NNLP+    I LY   GI+ +R+Y P+TN
Sbjct  10    LAAALVLVGLLMCSIQMIGAQSIGVCYGKIANNLPSDQDVINLYNANGIKRMRIYYPETN  69

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGK  427
             VF+AL+GSNI++I+DVPN  L +L + + A  WVQ NI+  +P+V FKY+AVGNEV P  
Sbjct  70    VFNALKGSNIEIILDVPNQDLESLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPTN  129

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  + +   A++NV+ AL AA  +  IK STATYSG+L +TYPP++ +F+ E  + + P
Sbjct  130   NGQYAPFVGPAMQNVYNALAAAGLQDQIKVSTATYSGLLANTYPPKDSIFRGEFNSFINP  189

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSY-SEENNLFDAMLESFYAA  775
             I+QFLA+NNLPLLAN+YPYF    +   V L +ALF++  +  +   NLFDA+L+S Y A
Sbjct  190   IIQFLARNNLPLLANVYPYFGHIYNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFA  249

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETYL
Sbjct  250   VEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKTIETYL  309

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMFDEN+K      + TE+HFGLF+PD  +KY L+FN
Sbjct  310   FAMFDENDKK----GEITEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009596559.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=351

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/337 (53%), Positives = 239/337 (71%), Gaps = 14/337 (4%)
 Frame = +2

Query  86    AAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             AA+L+L+G L     + G QS IGVCYG+I NNLP+    I LYK  GIR +R+Y  DTN
Sbjct  14    AAVLILVGLLMCNIQMTGAQSNIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYNSDTN  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
             +F +L GSNI++I+DVPN  L ALAN + A  WVQ NI   +P V FKY+++GNEV P  
Sbjct  74    IFKSLNGSNIEIILDVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPSN  133

Query  428   TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              G  S + L A++N++ AL A+  +  IK STA YSG+L +TYPP++ +F++E K+ + P
Sbjct  134   NGQYSQFLLHAMENIYNALAASGLQDKIKVSTAIYSGLLANTYPPKDSIFREEIKSFINP  193

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAA  775
             I++FLA+NNLPLLANIYPYF    +   V L +ALF++  + S    NLFDA+L+S Y A
Sbjct  194   IIEFLARNNLPLLANIYPYFGHIYNTVDVPLSYALFNQQGTNSTGYQNLFDALLDSIYFA  253

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NL+ HV+G  GT K+PG  +ETYL
Sbjct  254   VEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGIIVETYL  313

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             FAMFDEN K    N + TE+HFGLF P+  +KY L+F
Sbjct  314   FAMFDENEK----NGEVTEKHFGLFYPNRTAKYQLNF  346



>gb|AAN78310.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=326

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 234/333 (70%), Gaps = 15/333 (5%)
 Frame = +2

Query  95    LLLIGFL-HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRG  271
             LLL+G L  I G Q IGVCYG+I NNLP+    I LY    I+ LR+Y PDTNVF+AL+G
Sbjct  1     LLLVGLLIQITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKLRIYYPDTNVFNALKG  60

Query  272   SNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL  448
             SNI++I+DVPN  L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA 
Sbjct  61    SNIEIILDVPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRASGKYAR  120

Query  449   ---AALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
                 A++N++ AL +A  +  IK STATY G+L +TYPP++ +F++E K+ + PI+ FLA
Sbjct  121   FVGPAMENIYNALSSAGLQNQIKVSTATYLGLLTNTYPPKDSIFREEYKSFINPIIGFLA  180

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSE--VNSYSEENNLFDAMLESFYAAVEKAG  790
             ++NLPLLANIYPYFA   D  +V L +ALF +  +N    +N LFDA+++S Y A EK G
Sbjct  181   RHNLPLLANIYPYFAHADD--NVPLSYALFKQQGLNDAGYQN-LFDALVDSMYFATEKLG  237

Query  791   GSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFD  970
             G N++I+VSE+GWPSEG P A+  NA TYY NLI HV+G  GT K+PG  IETYLF MFD
Sbjct  238   GQNIEIIVSESGWPSEGHPSATLENARTYYTNLINHVKGGAGTPKKPGKTIETYLFTMFD  297

Query  971   ENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             EN K  KP    +E+HFGLF PD   KY L+FN
Sbjct  298   ENRKDGKP----SEQHFGLFYPDKRPKYQLNFN  326



>ref|XP_007133418.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
 gb|ESW05412.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
Length=337

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 226/320 (71%), Gaps = 9/320 (3%)
 Frame = +2

Query  119   IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDV  298
             IAG ++IGVCYG +GNNLP+    + LYK+ GI  +R+Y P+    DALRGS I++I+DV
Sbjct  24    IAGAEAIGVCYGVLGNNLPSKQEVVDLYKSNGIGKMRIYFPEAETLDALRGSGIELIMDV  83

Query  299   PNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
               + L A+ + NAA  WV+ N+VPY  +VNFKY++VGNEV P +  + Y L+A++N+  A
Sbjct  84    ARESLQAMTDQNAATDWVRTNVVPYAQDVNFKYISVGNEVRPNQNEAQYILSAMRNIQNA  143

Query  476   LLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYP  652
             + +AN +G IK STA  S ++ ++YPP +GVF  E+   + PI++FL  N  PLLAN+YP
Sbjct  144   ISSANLQGQIKVSTAIDSTLISNSYPPNDGVFNSES--YVRPIIEFLKSNGSPLLANVYP  201

Query  653   YFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETGW  829
             YFA   D  ++ L +ALF++    S    NLFDAML+S YAA+EK G S+V+IVVSE+GW
Sbjct  202   YFAYIYDKQNIPLDYALFTQQGQNSVGYQNLFDAMLDSTYAALEKMGASDVKIVVSESGW  261

Query  830   PSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQT  1009
             PS GG  AS  NA TYY NLI H +G +GT KRPG  IETYLFAMFDENNK    N +++
Sbjct  262   PSAGGDAASTQNAATYYANLISHAKGGNGTPKRPGGSIETYLFAMFDENNK----NGEES  317

Query  1010  ERHFGLFTPDMMSKYNLSFN  1069
             ERHFGLFTPD   KY LSFN
Sbjct  318   ERHFGLFTPDKSPKYQLSFN  337



>ref|XP_006367558.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like [Solanum tuberosum]
Length=352

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 239/350 (68%), Gaps = 25/350 (7%)
 Frame = +2

Query  83    IAAILLLIGFL-HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             + A  LL+G L  + G QSIGVCYG+I NNLP+      LY + GI+ +R+Y PDTNVF+
Sbjct  7     VGASFLLVGLLIQMTGAQSIGVCYGKIANNLPSDQDVKNLYNSNGIKKMRIYYPDTNVFN  66

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK---  427
             AL+GS+I++I+DVPN  L ALAN ++A  WVQ NI+  +P+V FKY+AVGNEV P K   
Sbjct  67    ALKGSDIEIILDVPNQDLEALANPSSANGWVQDNIISNFPDVKFKYIAVGNEVDPVKFKY  126

Query  428   ------------TG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENG  562
                         TG  + Y   A++NV+ AL +A  +  I  STATY G+L +TYPP + 
Sbjct  127   IAVGNEIDPDTNTGQYTQYVGPAMENVYNALTSAGLQDQINVSTATYLGLLTNTYPPSDS  186

Query  563   VFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NN  739
             +F++E K+ + PI++FLA+NNLPLLANIYPYF    + + V L +ALF++  + S    N
Sbjct  187   IFREEYKSFINPIIEFLARNNLPLLANIYPYFGHIDNTNDVPLSYALFNDQGTNSAGYQN  246

Query  740   LFDAMLESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGT  919
             LFDA+L+S Y A EK GG N++I+VSE+GWPSEG P  +  NA+TYY NLI HV+G  GT
Sbjct  247   LFDALLDSMYFATEKLGGQNIEIIVSESGWPSEGHPAITLENAQTYYTNLINHVKGGVGT  306

Query  920   RKRPGSHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
              K+PG  IETYLFAMFDEN K    +   +E+HFGLF PD  +KY L+FN
Sbjct  307   PKKPGRAIETYLFAMFDENQK----DGQSSEQHFGLFYPDQRAKYQLNFN  352



>ref|XP_006365633.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like, partial [Solanum 
tuberosum]
Length=316

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 227/321 (71%), Gaps = 12/321 (4%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G Q IGVCYG+I NNLP+    I LY    I+ +R+Y PDTNVF+AL+GSNI++I+DVPN
Sbjct  2     GAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPDTNVFNALKGSNIEIILDVPN  61

Query  305   DMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AALKNVHA  472
               L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA     A++N++ 
Sbjct  62    QDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRASGKYARFVGPAMENIYN  121

Query  473   ALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIY  649
             AL +A  +  IK STATY G+L +TYPP +G+F++E K+ + PI+ FLA++NLPLLANIY
Sbjct  122   ALSSAGLQNQIKVSTATYLGLLTNTYPPRDGIFREEYKSFINPIIGFLARHNLPLLANIY  181

Query  650   PYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
             PYFA   D  +V L +ALF +   + +   NLFDA+++S Y A EK GG N++I+VSE+G
Sbjct  182   PYFAHADD--NVPLSYALFKQQGLNDAGYQNLFDALVDSMYFATEKLGGQNIEIIVSESG  239

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPSEG P A+  NA TYY NLI HV+G  GT K+PG  IETYLFAMFDEN K  KP    
Sbjct  240   WPSEGHPSATLENARTYYTNLINHVKGGAGTPKKPGKTIETYLFAMFDENRKDGKP----  295

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
             +E+HFGLF PD   KY L+FN
Sbjct  296   SEQHFGLFYPDKRPKYQLNFN  316



>ref|NP_001234798.1| glucan endo-1,3-beta-glucosidase A precursor [Solanum lycopersicum]
 sp|Q01412.1|E13A_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase A; AltName: Full=(1->3)-beta-glucan 
endohydrolase A; Short=(1->3)-beta-glucanase 
A; AltName: Full=Acidic beta-1,3-glucanase; AltName: 
Full=Beta-1,3-endoglucanase A; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03617.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=336

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 227/325 (70%), Gaps = 12/325 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             + I G Q IGVCYG+I NNLP+    I LY +  I+ +R+Y P+TNVF+AL+GSNI++I+
Sbjct  18    IQITGAQPIGVCYGKIANNLPSDQDVIKLYNSNNIKKMRIYFPETNVFNALKGSNIEIIL  77

Query  293   DVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AALK  460
             DVPN  L ALAN +    WVQ NI   +P+V FKY+AVGNEV PG+    YA     A++
Sbjct  78    DVPNQDLEALANPSKRQGWVQDNIRNHFPDVKFKYIAVGNEVDPGRDSGKYARFVGPAME  137

Query  461   NVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLL  637
             N++ AL +A  +  IK STATY G+L +TYPP + +F+DE K+ + PI+ FL+++NLPLL
Sbjct  138   NIYNALSSAGLQNQIKVSTATYLGLLTNTYPPRDSIFRDEYKSFINPIIGFLSRHNLPLL  197

Query  638   ANIYPYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             ANIYPYF    D  +V LP+ALF +   + +   NLFDA+++S Y A EK GG N++I+V
Sbjct  198   ANIYPYFGHADD--NVPLPYALFKQQGLNDAGYQNLFDALVDSMYFATEKLGGQNIEIIV  255

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEG P A+  NA TYY NLI HV+G  GT K+PG  IETYLFAMFDEN K  KP
Sbjct  256   SESGWPSEGHPSATLENAMTYYTNLINHVKGGAGTPKKPGRTIETYLFAMFDENRKDGKP  315

Query  995   NNDQTERHFGLFTPDMMSKYNLSFN  1069
                 +E+HFGLF PD   KY L F+
Sbjct  316   ----SEQHFGLFKPDQRPKYQLKFD  336



>ref|XP_008227211.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=336

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 225/325 (69%), Gaps = 11/325 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYG+ GNNLP+ T  + LYK+ GI  +R+YEP+   + AL+GSNI++IV
Sbjct  15    LQITGAQSVGVCYGQNGNNLPSPTEVVDLYKSNGIGRMRIYEPNDPTYQALKGSNIELIV  74

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHA  472
              + ND L  L +  AA  WVQ+N+  +P+V FKY+AVGNEV+PG   + Y L A++N+H 
Sbjct  75    TILNDKLQGLTDAAAATDWVQKNVQAFPDVKFKYIAVGNEVHPGDPQTQYLLPAIQNIHN  134

Query  473   ALLAAN-RGGIKASTATYSGVLDHT--YPPENGVFKDEAKNLMYPIVQFLAQNNLPLLAN  643
             A++AAN +G IK STA  + ++D T  YPP  G + D AK+ + P++ FLA N  PLL N
Sbjct  135   AIVAANLQGQIKVSTAIDTTLVDSTSAYPPSAGKYSDAAKSFITPVINFLASNGAPLLVN  194

Query  644   IYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             +YPYF+   +P  ++L +ALF+     + +     NLFDA+L++ Y+A+EKA   +V+IV
Sbjct  195   VYPYFSYHDNPAQIELAYALFTSQGITTPDGVKYQNLFDALLDAQYSALEKANAPDVEIV  254

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPSEG   A+  NA+T+Y+NLI HV+G  GT KRPG  IETYLFAMFDEN K   
Sbjct  255   VSESGWPSEGDDVATPQNAQTFYQNLINHVKGTTGTPKRPGKAIETYLFAMFDENTK---  311

Query  992   PNNDQTERHFGLFTPDMMSKYNLSF  1066
                D+ ERHFGLF+P+   KY L+F
Sbjct  312   -GGDEVERHFGLFSPNKQPKYQLTF  335



>ref|XP_006365629.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=348

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 233/336 (69%), Gaps = 13/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             +A I LLIG L     + G  S IGVCYG+I NNLP+    I LYK  GIR +R+Y PDT
Sbjct  13    VATIFLLIGLLMCNVQMTGAYSNIGVCYGKIANNLPSDQDVINLYKANGIRKMRIYYPDT  72

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPG  424
             NVF+AL+GS+I++I+DVPN  L AL N + A  WVQ NI   +P+V FKY+++GNEV  G
Sbjct  73    NVFNALKGSSIEIILDVPNQDLEALTNPSNANGWVQDNIKNHFPDVKFKYISIGNEVSNG  132

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
             +  S + L  +KNV+ AL AA  +  IK STATYSG+L +TYPP++  F++E K  + PI
Sbjct  133   QF-SQFVLPVMKNVYNALSAAGLQDKIKVSTATYSGLLANTYPPKDSTFREEFKGFINPI  191

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAV  778
             ++FLA+NNLP+LANIYPYF    +   + L +ALF++    S    NLFDA+L+S Y A+
Sbjct  192   IEFLARNNLPILANIYPYFGHIYNMVDIPLSYALFNQQGENSIGYQNLFDALLDSTYFAI  251

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAGG NV+IVVSETGWPS G P A+  NA+ YY+NL+ HV+   GT K+PG  IETYLF
Sbjct  252   EKAGGPNVEIVVSETGWPSNGHPSATLENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLF  311

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K      + TE HFGLF P+  +KY+L F
Sbjct  312   AMFDENQK----QGEVTENHFGLFYPNQTAKYDLKF  343



>ref|XP_009770429.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score =   328 bits (840),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 226/324 (70%), Gaps = 12/324 (4%)
 Frame = +2

Query  119   IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDV  298
             I GVQSIGVCYGR GNNLP+    I LYK+ GI  LR+Y+P+  V +ALRGSN+++I+D+
Sbjct  15    ILGVQSIGVCYGRNGNNLPSPQDVINLYKDNGITNLRIYDPNPEVLNALRGSNVEIILDI  74

Query  299   PNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPG----KTGSDYALAALKN  463
             PN  L AL + NAA  WV  NI+ Y P+V  KY+A GNEV PG       + + L A+ N
Sbjct  75    PNYNLQALTDPNAATNWVHTNIINYFPSVKIKYIAAGNEVSPGFPQTAQFAPFILPAMHN  134

Query  464   VHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLA  640
             V  AL A   +  IK ST  YSGVL +TYPP N +F+D+ K  + PIVQFLAQN+ PLLA
Sbjct  135   VQRALAAYGVQNQIKVSTVMYSGVLTNTYPPWNAIFRDDLKGFIVPIVQFLAQNDSPLLA  194

Query  641   NIYPYFARTGDPDHVQLPFALFSE--VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             NIYPYFA  GDP HV LP+ALF++   +  S  +NLFDAML++ Y A+EKA G+N++IVV
Sbjct  195   NIYPYFAYRGDPAHVALPYALFTQPGADPGSGYHNLFDAMLDAQYYALEKADGNNIEIVV  254

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             +E+GWPS+GG  AS  NA TYY NL  HV+   GT  +PG  IETYLFAMFDEN K    
Sbjct  255   AESGWPSDGGFGASMENARTYYINLNNHVKLGGGTPHKPGKVIETYLFAMFDENLKE---  311

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
               D+TE+H+G+F P+   KYN++F
Sbjct  312   -GDETEKHYGVFYPNKAKKYNINF  334



>ref|XP_004228512.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=348

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 234/336 (70%), Gaps = 13/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             +A I +LIG L     + G  S IGVCYG+I NNLP+    I LYK  GIR +R+Y PDT
Sbjct  13    VAIIFVLIGLLMCNVQMTGAYSNIGVCYGKIANNLPSDQDVINLYKANGIRKMRIYYPDT  72

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPG  424
             NVF+AL+GSNI++I+DVPN  L AL   + A  WVQ NI   +P+V FKY+++GNEV  G
Sbjct  73    NVFNALKGSNIEIILDVPNQDLEALTFPSNANNWVQDNIKNHFPDVKFKYISIGNEVSNG  132

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
             +  S + L  +KN++  L AA  +  IK STATYSG+L +TYPP++ +F++E K  + PI
Sbjct  133   QI-SKFVLPVMKNIYNELSAAGLQDKIKVSTATYSGLLANTYPPKDSIFREEFKGFINPI  191

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAV  778
             ++FLA+NNLP+LANIYPYF    +   + L +ALF++ +  S    NLFDA+L+S Y A+
Sbjct  192   IEFLARNNLPILANIYPYFGHIYNMVDISLSYALFNQQDENSIGYQNLFDALLDSIYFAL  251

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAGG NV+IVVSETGWPS+G P A+  NA+ YY+NL+ HV+   GT K+PG  IETYLF
Sbjct  252   EKAGGPNVEIVVSETGWPSKGHPSATLENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLF  311

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K      + TE HFGLF P+  +KY+L F
Sbjct  312   AMFDENQKQ----GEVTENHFGLFYPNQTAKYDLKF  343



>emb|CAA08910.1| glucan endo-1,3-beta-D-glucosidase [Solanum tuberosum]
Length=347

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 231/333 (69%), Gaps = 15/333 (5%)
 Frame = +2

Query  110   FLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVI  289
              + I G Q IGVCYG+I NNLP+    I LY    I+ LR+Y PDTNVF+AL+GSNI++I
Sbjct  17    LIQITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKLRIYYPDTNVFNALKGSNIEII  76

Query  290   VDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AAL  457
             +DVPN  L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+  + YA     A+
Sbjct  77    LDVPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRDSAKYARFVGPAM  136

Query  458   KNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N++ AL +A  +  IK STATY G+L +TYPP N +F+++ ++ + PI+ FLA++NLPL
Sbjct  137   ENIYNALSSAGLQNQIKVSTATYLGLLTNTYPPRNSIFREDYRSFINPIIGFLARHNLPL  196

Query  635   LANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIV  811
             LANIYPYFA   D  +V L +ALF++   + +   NLFDA+++S Y A EK GG N++I+
Sbjct  197   LANIYPYFAHADD--NVPLSYALFNQQGRNDAGYQNLFDALVDSMYFATEKLGGQNIEII  254

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPSEG P A+  NA TYY NLI HV+G  GT K+PG  IETYLFAMFDEN K  K
Sbjct  255   VSESGWPSEGHPSATLENARTYYTNLINHVKGGTGTPKKPGKTIETYLFAMFDENRKDGK  314

Query  992   PNNDQTERHFGLFTPDMMSKYNLSFN*VQVMVC  1090
             P    +E+HFGLF PD   K +  F   Q+M+ 
Sbjct  315   P----SEQHFGLFYPDKRPKVSTQF---QLMIT  340



>emb|CAE53273.1| 1,3-beta-glucan glucanohydrolase [Solanum tuberosum]
Length=338

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/326 (54%), Positives = 225/326 (69%), Gaps = 10/326 (3%)
 Frame = +2

Query  110   FLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVI  289
              + I G QSIGVCYG+I NNLP     I LY    I+ +R+Y PDTNVF+AL+GSNI++I
Sbjct  17    LIQITGAQSIGVCYGKIANNLPLDQDVIKLYNANNIKKMRIYYPDTNVFNALKGSNIEII  76

Query  290   VDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AAL  457
             +DVPN  L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA      +
Sbjct  77    LDVPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRDSGKYARFVGPTM  136

Query  458   KNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N++ AL +A  +  IK STATYSG+L +TYPP + +F++E K+ + PI+ FLA++NLPL
Sbjct  137   ENIYNALSSAGLQNQIKVSTATYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPL  196

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIV  811
             LANIYPYF  T + + V L +ALF++  + S    NLFDA+L+S Y A+EK G  N++I+
Sbjct  197   LANIYPYFGHTDNTNDVPLSYALFNQQGTNSAGYQNLFDALLDSMYFAMEKLGAQNIEII  256

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPS G P A+  NA TYY NLI HV+G     K PG  IETYLFAMFDEN K   
Sbjct  257   VSESGWPSVGHPAATLENARTYYTNLINHVKGGVEPPKNPGRTIETYLFAMFDENQKDGN  316

Query  992   PNNDQTERHFGLFTPDMMSKYNLSFN  1069
             P    +E+HFGLF PD  SKY L+FN
Sbjct  317   P----SEQHFGLFYPDKRSKYQLNFN  338



>ref|XP_010101247.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88171.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=341

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/337 (52%), Positives = 226/337 (67%), Gaps = 16/337 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             + ++  L+G L     I+G QSIGVCYG++GNNLP  +  I LYK+  I  +R+Y PD  
Sbjct  13    MTSMFFLLGLLILSSEISGAQSIGVCYGKLGNNLPTESEVINLYKSNNIGKMRIYSPDQA  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGK  427
                AL+GSNI++IVDVP D L +L +  AA  WVQ NIV +  +VNFKY+AVGNE++PG 
Sbjct  73    TLQALKGSNIELIVDVPKDKLQSLNDAGAASDWVQTNIVSFSSDVNFKYIAVGNEIHPGD  132

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               ++Y L A+KNV +A+ +A+ +G IK STA  + +LD +YPP +GVF D A   + PI 
Sbjct  133   GEANYVLPAMKNVQSAINSASLQGKIKVSTAIDTSLLDKSYPPNDGVFSDAANGYITPIA  192

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE--NNLFDAMLESFYAAV  778
              FLA+N  PLLAN+YPYFA T D   + L +ALF+   S       NLFDA L++ YAA+
Sbjct  193   NFLAENGSPLLANVYPYFAYTND-RSIDLQYALFNSKGSSDGTGYQNLFDAQLDALYAAL  251

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EK    +V+IVVSE+GWPSEG   A+  NA TYY+NLI HV+G  GT KRP   IETYLF
Sbjct  252   EKVNAPDVKIVVSESGWPSEGDSAATTNNAGTYYRNLIAHVKG--GTPKRPQGPIETYLF  309

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             AMFDEN K     +   E+HFGLF+PD   KY LSF+
Sbjct  310   AMFDENQK-----DGAQEQHFGLFSPDKQPKYQLSFS  341



>gb|KEH30624.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=331

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 212/321 (66%), Gaps = 8/321 (2%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L   G QS+GVCYG  GNNLP   A + LYK+ GI  +R+Y PD  +  ALR SNI+VI+
Sbjct  17    LEFTGAQSVGVCYGGNGNNLPTKKAVVDLYKSKGIGKIRIYNPDEGILQALRSSNIEVIL  76

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHA  472
              VPN++L +L N   A  WV + +  Y  V  KY+AVGNEV+PG   S   L A++N+  
Sbjct  77    GVPNNVLKSLTNAQTASDWVNKYVKAYSIVKIKYIAVGNEVHPGSAESSSVLPAMQNIQK  136

Query  473   ALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIY  649
             A+ +AN +G IK STA  + ++  +YPP++GVF D A   + PIV FL  N  PLLAN+Y
Sbjct  137   AISSANLQGQIKVSTAIDTTLIGKSYPPKDGVFSDAASGYIKPIVNFLVSNGSPLLANVY  196

Query  650   PYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
             PYFA   +   + L +ALF++         NLFDAML+S YAA+EK GGSNV+IVVSE+G
Sbjct  197   PYFAYVNNQQSIGLDYALFTKQGKNEVGYQNLFDAMLDSIYAALEKVGGSNVKIVVSESG  256

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS+GG  AS GNA TYY NLI+HV+G  GT KRP   IETYLFAMFDEN K       +
Sbjct  257   WPSQGGTGASAGNAGTYYGNLIKHVKG--GTPKRPNGPIETYLFAMFDENQKP----GSE  310

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
              ERHFGLF PD   KY +SFN
Sbjct  311   IERHFGLFRPDKSPKYQISFN  331



>emb|CAE52322.1| 1,3-beta-D-glucan glucanohydrolase precursor [Solanum tuberosum]
Length=338

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 224/325 (69%), Gaps = 10/325 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             + I G Q IGVCYG+I NNLP+    I LY    I+ +R+Y P TNVF+AL+GSNI++I+
Sbjct  18    IQITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIIL  77

Query  293   DVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AALK  460
             DVPN  L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA     A++
Sbjct  78    DVPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRESGKYARFVGPAME  137

Query  461   NVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLL  637
             N++ AL +A  +  IK ST+TYSG+L +TYPP + +F++E K+ + PI+ FLA++NLPLL
Sbjct  138   NIYNALSSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLL  197

Query  638   ANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVV  814
             ANIYPYF    + + V L +ALF++         NLFDA+++S Y A EK GG N++I+V
Sbjct  198   ANIYPYFGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIV  257

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEG P A+  NA TYY NLI HV+   GT K+PG  IETYLFAMFDEN K    
Sbjct  258   SESGWPSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKK---  314

Query  995   NNDQTERHFGLFTPDMMSKYNLSFN  1069
               + +E+HFGLF PD   KY L+FN
Sbjct  315   -GEASEKHFGLFNPDQRPKYQLNFN  338



>ref|XP_003540349.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
 gb|KHN20625.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=326

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 221/332 (67%), Gaps = 9/332 (3%)
 Frame = +2

Query  83    IAAILLLIGFLH-IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ++AI LL+G L  I   QSIGVCYG IG+NLP+    + LYK  GI  +R+Y PD     
Sbjct  1     MSAIFLLVGMLSSITVAQSIGVCYGVIGDNLPSRQEVVDLYKTNGIGRMRIYYPDEEALQ  60

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGS  436
             ALRGS I++I+DV  + L +L + NAA  WV + + PY  +VNFKY+AVGNE++P    +
Sbjct  61    ALRGSGIELIMDVAKETLQSLTDSNAATDWVNKYVTPYSQDVNFKYIAVGNEIHPNTNEA  120

Query  437   DYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
              Y L+A+ N+  A+ +AN   IK STA  S ++ ++YPP +GVF  +A+  + PI+ FL 
Sbjct  121   QYILSAMTNIQNAISSANLQ-IKVSTAIDSTLITNSYPPNDGVFTSDAEPYIKPIINFLV  179

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGG  793
              N  PLLAN+YPYFA   D   + L +ALF++  N+     NLFDAML+S YAA+EK G 
Sbjct  180   SNGAPLLANVYPYFAYAND-QSIPLAYALFTQQGNNDVGYQNLFDAMLDSIYAALEKVGA  238

Query  794   SNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDE  973
             SN+QIVVSE+GWPSEGG  AS  NA TYY NLI+H    +GT KRPG  IETYLFAMFDE
Sbjct  239   SNLQIVVSESGWPSEGGAGASIDNAGTYYANLIRHASSGNGTPKRPGESIETYLFAMFDE  298

Query  974   NNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             N K        TERHFGLF PD   KY LSFN
Sbjct  299   NQK----QGADTERHFGLFNPDKSPKYQLSFN  326



>ref|XP_009589771.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=335

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 225/324 (69%), Gaps = 12/324 (4%)
 Frame = +2

Query  119   IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDV  298
             I GVQSIGVCYGR GNNLP+    I LYK+ GI  LR+Y+P+  V +ALRGS+I++I+D+
Sbjct  15    ILGVQSIGVCYGRNGNNLPSPQDVINLYKDNGITNLRIYDPNPEVLNALRGSSIEIILDI  74

Query  299   PNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPG----KTGSDYALAALKN  463
             PN  L ALA+ NAA  WV  NI+ Y P+V  KY+AVGNEV PG       + + L A++N
Sbjct  75    PNYNLQALADPNAATNWVHTNIINYFPSVKIKYIAVGNEVSPGFPQTAQFAPFILPAMQN  134

Query  464   VHAALLA-ANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLA  640
             V  A+     +  IK ST  YSGVL +TYPP N VF+D+ +  + PIVQFL  N  PLLA
Sbjct  135   VQRAVATYGVQNQIKVSTVMYSGVLSNTYPPWNAVFRDDLRGFIVPIVQFLTHNGSPLLA  194

Query  641   NIYPYFARTGDPDHVQLPFALFSE--VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             NIYPYFA  GDP HV LP+ALF++   +  S  +NLFDAML++ Y A+EK GG+N++IVV
Sbjct  195   NIYPYFAYRGDPAHVALPYALFTQPGADPGSGYHNLFDAMLDAQYYALEKVGGNNIEIVV  254

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             +E+GWPS+GG  AS  NA TYY NL  HV+   GT  +PG  IETYLFAMFDEN K    
Sbjct  255   AESGWPSDGGFGASMENAGTYYINLNNHVKSGGGTPHKPGKIIETYLFAMFDENLKE---  311

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
               D+TE+H+G+F P+   KYN++F
Sbjct  312   -GDETEKHYGVFYPNKAKKYNINF  334



>ref|XP_006367559.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=346

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 231/335 (69%), Gaps = 13/335 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQS-IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             +A I LLIG L     +AG  S IGVCYG+I NNLP+    I LYK  GIR +R+Y PDT
Sbjct  13    VATIFLLIGLLMCNVQMAGAYSNIGVCYGKIANNLPSHQDVINLYKANGIRKMRIYYPDT  72

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPG  424
             NVF+AL+GSNI++I+DVPN  L AL N + A  WVQ NI   +PNV FKY+++GNEV  G
Sbjct  73    NVFNALKGSNIEIILDVPNQDLEALTNPSNANGWVQDNIKSHFPNVKFKYISIGNEVSNG  132

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
             +  S + L+ ++NV+  L A   +  IK STATYSG+L +TYPP++ +F++E K  + PI
Sbjct  133   QI-SQFVLSVMENVYNELSAVGLQDKIKVSTATYSGLLANTYPPKDSIFREEFKGFINPI  191

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEENNLFDAMLESFYAAVE  781
             ++FLA+NNLP+LANI+PYF    +   + L +ALF+  NS   +N LFDA+L+S Y A+E
Sbjct  192   IEFLARNNLPILANIFPYFGHIYNMVDIPLSYALFNHENSIGYQN-LFDALLDSTYFAIE  250

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAGG NV+IVVSET WPS G P A   NA+ YY+NL+ HV+   GT K+PG  IETYLFA
Sbjct  251   KAGGPNVEIVVSETSWPSNGHPSAMPENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLFA  310

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K      + TE HFGL  P+  + Y+L F
Sbjct  311   MFDENQKQ----GEVTENHFGLSYPNQTANYDLKF  341



>ref|XP_009587943.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=340

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 222/329 (67%), Gaps = 11/329 (3%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             +++ +L I   Q IGVCYGR GNNLP+A   + LYK  GI  +R+Y+P      AL+GSN
Sbjct  13    MVMTYLQIIEAQPIGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIAETLTALKGSN  72

Query  278   IDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----Y  442
             I++I+D+PND L AL + NAA  WV  NIV Y P+V FKY+ VGNEV P    +     +
Sbjct  73    IEIILDIPNDNLQALTDPNAATNWVNANIVAYSPDVKFKYINVGNEVSPANVATSKFAPF  132

Query  443   ALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQN  622
              + AL+NV  A+    +  +K STA  +G+L +TYPP   VF D+  + + P++ FL QN
Sbjct  133   LIPALQNVQQAITKF-QLQVKVSTAIETGILRNTYPPSQSVFSDDISSFINPLIGFLKQN  191

Query  623   NLPLLANIYPYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGGSN  799
             NLP+LANIYPYF   GDP HV LP+ALF++ N   S  +NLFDAML++ Y AVEKAGG N
Sbjct  192   NLPVLANIYPYFGYLGDPAHVPLPYALFTQQNPDPSGYHNLFDAMLDATYYAVEKAGGEN  251

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             + IV+SE+GWPS+GG  AS  NA TYY NLI HV+   GT  +PG+ IETYLFA+FDEN 
Sbjct  252   LPIVISESGWPSDGGDGASIDNAGTYYSNLISHVKSGAGTPHKPGTAIETYLFAIFDENI  311

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             K       +TE+HFG+F PD   KYNL+F
Sbjct  312   KI----GAETEKHFGVFHPDKTPKYNLNF  336



>ref|XP_009764461.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 220/329 (67%), Gaps = 11/329 (3%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             +++ +L I   Q IGVCYGR GNNLP+A   + LYK  GI  +R+Y+P      AL+GSN
Sbjct  12    MVMTYLQIIEAQPIGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIAETLTALKGSN  71

Query  278   IDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----Y  442
             I++I+D+PND L AL + NAA  WV  NIV Y P+V FKY+ VGNE+ P  + +     +
Sbjct  72    IEIILDIPNDNLQALTDPNAATNWVNANIVAYSPDVKFKYINVGNEISPANSATSKFAPF  131

Query  443   ALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQN  622
              L AL+NV  A+       +K STA  +G+L +TYPP   VF+D+  + + P++ FL QN
Sbjct  132   LLPALQNVQQAITKFQLQ-VKVSTAIETGILTNTYPPSQSVFRDDISSFINPLIGFLKQN  190

Query  623   NLPLLANIYPYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGGSN  799
             NLP+LANIYPYF   GDP HV LP+ALF++ N   S   NLFDAML++ Y AVEKAGG N
Sbjct  191   NLPVLANIYPYFGYLGDPAHVPLPYALFTQQNPDPSGYRNLFDAMLDATYYAVEKAGGEN  250

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             + IVVSE+GWPS+GG  AS  NA  YY NLI HV+   GT  +PG+ IE YLFAMFDEN 
Sbjct  251   LPIVVSESGWPSDGGDGASIDNAGIYYTNLISHVKSGAGTPHKPGTPIEIYLFAMFDENI  310

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             K       +TE++FG+F PD   KYNLSF
Sbjct  311   KI----GAETEKYFGVFHPDKTPKYNLSF  335



>emb|CDO98259.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 176/343 (51%), Positives = 229/343 (67%), Gaps = 19/343 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHI------AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPD  244
             +A++L L+G   +      AG QSIGVCYG  GN+LP+    I LY   GI  +R+Y P 
Sbjct  1     MASMLALVGLFLLTPRISRAGAQSIGVCYGLNGNDLPSTQDVINLYNEKGIAKMRIYAPF  60

Query  245   TNVFDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVY  418
               V +ALRGSNI++IVDV N D+ P  ++ +AA +WVQ NI+ Y P+V FKY+AVGNEV 
Sbjct  61    PQVLNALRGSNIELIVDVANEDIEPLASDASAAAHWVQDNILRYSPDVQFKYIAVGNEVL  120

Query  419   PGKTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
             P    + Y L A++N+  A++AA  +  IK STATY+ +L  + PP  G F +++K  M 
Sbjct  121   PNFDNAKYILPAMENLQNAIIAAGLQDQIKVSTATYTALLAVSSPPSQGSFGNDSKLFMK  180

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PI+ FL QNN PLL NIYPYF   GDP ++ L +ALF+      ++      NLFDAML+
Sbjct  181   PIINFLVQNNAPLLVNIYPYFGYIGDPANIGLEYALFTSPGIVVQDGLLGYQNLFDAMLD  240

Query  761   SFYAAVEKA-GGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGS  937
             + Y A+E+  GG+ V+IVVSETGWPSEG   +S  NA TYYKNLI HV+G  GT +RPG 
Sbjct  241   AHYTALEREEGGNTVEIVVSETGWPSEGSSASSVENAGTYYKNLINHVKGGSGTPRRPGK  300

Query  938   HIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
              IETYLFAMFDEN KT     D+TE+HFGLFTP+   KY +SF
Sbjct  301   AIETYLFAMFDENEKT----GDETEKHFGLFTPNKQPKYAVSF  339



>ref|NP_001266064.1| glucan endo-1,3-beta-glucosidase-like precursor [Cicer arietinum]
 emb|CAA10167.1| glucan endo-1,3-beta-d-glucosidase [Cicer arietinum]
Length=331

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 223/337 (66%), Gaps = 14/337 (4%)
 Frame = +2

Query  83    IAAILLLIGFL------HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPD  244
             ++ IL+L+G L         G QS+GVCYG  GNNLP   A + LYK+ GI  +RLY PD
Sbjct  1     MSIILMLVGVLLSSTAFEFTGAQSVGVCYGANGNNLPTKQAVVDLYKSKGIGKIRLYNPD  60

Query  245   TNVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP  421
                  AL+ SNI+VI+ V ND L +L N  +A  WV + +  Y PNV  KY++VGNE++P
Sbjct  61    EGALQALKDSNIEVILGVSNDALNSLTNAQSATDWVNKYVKAYSPNVKIKYISVGNEIHP  120

Query  422   GKTGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
                 ++  L AL+N+  A+ +AN G IK STA  + ++  +YPP +GVF D A   + PI
Sbjct  121   DSPEANSVLPALQNIQNAISSANLGQIKVSTAIDTTLIGKSYPPNDGVFSDAASGYIKPI  180

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAV  778
             V FL  N  PLLAN+YPYF+   +   + L +ALF++  N+     NLFDA+L+S YAA+
Sbjct  181   VNFLVSNGSPLLANVYPYFSYVNNQQSIGLDYALFTKQGNNEVGYQNLFDAILDSIYAAL  240

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EK GGSNV+IVVSE+GWPS+GG  AS GNA+TYY NLI+H +G  GT KRP   IETYLF
Sbjct  241   EKVGGSNVKIVVSESGWPSQGGTGASVGNAQTYYGNLIKHAKG--GTPKRPNGPIETYLF  298

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             AMFDEN KT    + +TER+FGLF PD   KY L+FN
Sbjct  299   AMFDENLKT----DPETERYFGLFNPDKSPKYQLNFN  331



>dbj|BAG34628.1| beta-1,3-glucanase [Lotus japonicus]
Length=330

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             +  ILLL G L        G QS+GVCYG  G+NLP+    + LYK+ GI  +R+Y+ D 
Sbjct  1     MTTILLLFGILISTTVEFTGAQSVGVCYGANGDNLPSRQEVVDLYKSKGISRMRIYDQDE  60

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                 ALRGSNI+VI+ VPND L +L +  AA  WV + +  Y +V  KY+AVGNEV PG 
Sbjct  61    EALQALRGSNIEVILGVPNDKLQSLTDAGAANDWVNKYVKAYSDVKIKYIAVGNEVPPGD  120

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               +   L A++N+  A+ +AN +G IK S A  + ++ + YPPENGVF DEA++ + PIV
Sbjct  121   AAAGSVLPAMRNIQNAISSANLQGQIKVSLAIKTSLVANPYPPENGVFSDEARSYITPIV  180

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFY  769
              FL  N  PLLAN+Y YFA   DP H  L +ALF++     E+N     NLFDA+L+  Y
Sbjct  181   DFLKSNGAPLLANVYTYFAHVDDPQHNSLNYALFTQ----QEKNDAGYQNLFDAILDGVY  236

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             AA+EKAG  ++++VVSE+GWPS GG  A+  NAE+YYKNLIQHV+G  GT KRP   IET
Sbjct  237   AALEKAGTPDMKVVVSESGWPSAGGDAANVQNAESYYKNLIQHVKG--GTPKRPNGPIET  294

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             YLFAMFDEN K     + +TER+FGLF PD  +KY ++FN
Sbjct  295   YLFAMFDENRKP----DPETERNFGLFRPDKSAKYQINFN  330



>pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR7|B Chain B, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|A Chain A, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|B Chain B, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Length=323

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 221/319 (69%), Gaps = 10/319 (3%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             Q IGVCYG+I NNLP+    I LY    I+ +R+Y P TNVF+AL+GSNI++I+DVPN  
Sbjct  1     QPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILDVPNQD  60

Query  311   LPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AALKNVHAAL  478
             L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA     A++N++ AL
Sbjct  61    LEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRESGKYARFVGPAMENIYNAL  120

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK ST+TYSG+L +TYPP + +F++E K+ + PI+ FLA++NLPLLANIYPY
Sbjct  121   SSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLLANIYPY  180

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWP  832
             F    + + V L +ALF++         NLFDA+++S Y A EK GG N++I+VSE+GWP
Sbjct  181   FGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIVSESGWP  240

Query  833   SEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTE  1012
             SEG P A+  NA TYY NLI HV+   GT K+PG  IETYLFAMFDEN K      + +E
Sbjct  241   SEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKK----GEASE  296

Query  1013  RHFGLFTPDMMSKYNLSFN  1069
             +HFGLF PD   KY L+FN
Sbjct  297   KHFGLFNPDQRPKYQLNFN  315



>ref|XP_007132239.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
 gb|ESW04233.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
Length=332

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 226/330 (68%), Gaps = 10/330 (3%)
 Frame = +2

Query  89    AILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALR  268
              +L   G L + GV+S+GVCYG  GNNLP   A + LYK+ GI  +RLY PD     ALR
Sbjct  10    GVLSSTGVL-LTGVESVGVCYGGNGNNLPTKQAVVNLYKSNGIGKIRLYYPDEGALQALR  68

Query  269   GSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYA  445
             GSNI+VI+ VPND L +++N   A  WV + + PY  NV  KY+AVGNEV+PG   +   
Sbjct  69    GSNIEVILAVPNDQLQSVSNNGGATNWVNKYVKPYAGNVKLKYIAVGNEVHPGDALAGSV  128

Query  446   LAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQN  622
             L AL+++  A+ AAN +G IK STA  + +L ++YPP++GVF + A + + PI+ FLA+N
Sbjct  129   LPALQSIQNAISAANLQGQIKVSTAIDTTLLGNSYPPKDGVFSNSASSYITPIINFLAKN  188

Query  623   NLPLLANIYPYFARTGDPDHVQLPFALFS-EVNSYSEENNLFDAMLESFYAAVEKAGGSN  799
               PLLAN+YPYFA   +  ++ L +ALF+ + N+     NLFDA+++S YAA+EK G SN
Sbjct  189   GAPLLANVYPYFAYVNNQQNIGLDYALFTKQGNNEVGYQNLFDALVDSLYAALEKVGASN  248

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             V++VVSE+GWPS+GG  A+  NA TYY+NLI+HV+G  GT KRP   IETYLFAMFDEN 
Sbjct  249   VKVVVSESGWPSQGGVGATVQNAGTYYRNLIKHVKG--GTPKRPNGPIETYLFAMFDENQ  306

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             K       +TE+HFGLF PD   KY LSFN
Sbjct  307   K----GGAETEKHFGLFRPDKSPKYQLSFN  332



>gb|AAN78309.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=337

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 224/326 (69%), Gaps = 10/326 (3%)
 Frame = +2

Query  110   FLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVI  289
              + I G Q IGVCYG+I NNLP+    I LY    I+ +R+Y P TNVF+AL+GSNI++I
Sbjct  16    LIQITGAQPIGVCYGKIANNLPSDQDAIKLYNANNIKKMRIYYPHTNVFNALKGSNIEII  75

Query  290   VDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AAL  457
             +DVPN  L +LAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA     A+
Sbjct  76    LDVPNQDLESLANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRESGKYARFVGPAM  135

Query  458   KNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N++ AL +   +  IK ST+TYSG+L +TYPP + +F++E K  + PI+ FLA++NLPL
Sbjct  136   ENIYNALSSVGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKTFINPIIGFLARHNLPL  195

Query  635   LANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIV  811
             LANIYPYFA   + + V L +ALF++   + +    LFDA+++S Y A EK GG N++I+
Sbjct  196   LANIYPYFAHIDNTNAVPLSYALFNQQGRNDAGYQYLFDALVDSMYFATEKLGGQNIEII  255

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPSEG P A+  NA TYY NLI HV+   GT K+PG  IETYLFAMFDEN K   
Sbjct  256   VSESGWPSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGRTIETYLFAMFDENEKK--  313

Query  992   PNNDQTERHFGLFTPDMMSKYNLSFN  1069
                + +E+HFGLF PD   KY L+FN
Sbjct  314   --GEASEKHFGLFNPDQRPKYQLNFN  337



>dbj|BAE53384.1| beta-1,3-glucanase [Sesbania rostrata]
Length=339

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 213/317 (67%), Gaps = 8/317 (3%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G QS+GVCYG  GNNLP   A + LYK+ GI  +RLY PD     ALRGSNI+VI+ VPN
Sbjct  29    GAQSVGVCYGGNGNNLPTKQAVVDLYKSNGIGKIRLYYPDEGALQALRGSNIEVILGVPN  88

Query  305   DMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             D L +L N  AA  WV R +  Y NV  KY+AVGNEV+PG   +   L A++N+ +A+ +
Sbjct  89    DKLQSLTNAGAASDWVNRYVKAYSNVKIKYIAVGNEVHPGDAVAGSVLPAMRNIQSAISS  148

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +G IK STA  + +L ++YPP++GVF + A   + PI+ FL  N  PLLAN+YPYFA
Sbjct  149   ANLQGQIKVSTAIDTTLLGNSYPPKDGVFSNSASGYIRPIITFLVNNGAPLLANVYPYFA  208

Query  662   RTGDPDHVQLPFALFS-EVNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPSE  838
                +   + L +ALF+ + N+     NLFDA+L+S YAA+EK G  NV++VVSE+GWPSE
Sbjct  209   YVNNQQSIGLDYALFTKQGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVVSESGWPSE  268

Query  839   GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTERH  1018
             GG  A+  NA TYY+NLI+H +G  GT KRP   IETYLFAMFDEN K       + ERH
Sbjct  269   GGTGATVQNAGTYYRNLIRHAKG--GTPKRPNGPIETYLFAMFDENQK----QGPEIERH  322

Query  1019  FGLFTPDMMSKYNLSFN  1069
             FGLF PD   KY LSFN
Sbjct  323   FGLFRPDKSPKYQLSFN  339



>ref|XP_003607319.1| Endo-beta-1 3-glucanase [Medicago truncatula]
 gb|AES89516.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/336 (50%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             ++ I LL+G L I      VQS+GVCYG +GNNLP++   + LYK+ GI  +R+Y PD  
Sbjct  1     MSIIFLLVGILSIGLKFTVVQSVGVCYGVLGNNLPSSQEVVDLYKSNGIDKMRIYFPDEQ  60

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                AL+GSNI++I+DV  + L +L + N A  WVQ+ + PY  +V  KY+ VGNE+ P  
Sbjct  61    ALQALKGSNIELILDVAKETLSSLTDGNEATNWVQKYVTPYAQDVKIKYITVGNEIKPND  120

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               + Y   A++N+  A+ +AN +G IK STA    ++  +YPP +G F D+AK  + PI+
Sbjct  121   NEAQYIATAMQNIQNAISSANLQGQIKVSTAIDMTLIGTSYPPNDGAFTDQAKQYLQPII  180

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVE  781
              FL  N  PLLAN+YPYFA  G+   + L +ALF +  N+     NLFDA L+S YAA+E
Sbjct  181   DFLKNNGAPLLANVYPYFAYIGNKQSISLDYALFKQQGNNDVGYQNLFDAQLDSVYAALE  240

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             K GG++V+IVVSE+GWPS+GG  AS  NA TYY+NLI HV+  +GT KRPG+ IETYLFA
Sbjct  241   KVGGTDVKIVVSESGWPSDGGDSASTDNASTYYQNLINHVK--NGTPKRPGA-IETYLFA  297

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             MFDEN KT       TE+HFGLF PD  SKY  SFN
Sbjct  298   MFDENQKT----GAATEQHFGLFNPDKSSKYQTSFN  329



>gb|AFK41254.1| unknown [Lotus japonicus]
Length=343

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 222/340 (65%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             +  ILLL G L        G QS+GVCYG  G+NLP+    + LYK+ GI  +R+Y+ D 
Sbjct  14    MTTILLLFGILISTTVEFTGAQSVGVCYGANGDNLPSRQEVVDLYKSKGINRMRIYDQDE  73

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                 ALRGSNI+VI+ VPND L +L +  AA  WV + +  Y +V  KY+AVGNEV PG 
Sbjct  74    EALQALRGSNIEVILGVPNDKLQSLTDAGAANDWVNKYVKAYSDVKIKYIAVGNEVPPGD  133

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               +   L A++N+  A+ + N +G IK S A  + ++ + YPPENGVF DEA++ + PIV
Sbjct  134   AAAGSVLPAMRNIQNAISSTNLQGQIKVSLAIKTSLVANPYPPENGVFSDEARSYITPIV  193

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFY  769
              FL  N  PLLAN+Y YFA   DP H  L +ALF++     E+N     NLFDA+L+  Y
Sbjct  194   DFLKSNGAPLLANVYTYFAHVDDPQHNSLNYALFTQ----QEKNDAGYQNLFDAILDGVY  249

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             AA+EKAG   +++VVSE+GWPS GG  A+  NAE+YYKNLIQHV+G  GT KRP   IET
Sbjct  250   AALEKAGAPYMKVVVSESGWPSAGGDAANVQNAESYYKNLIQHVKG--GTPKRPNGPIET  307

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             YLFAMFDEN K     + +TER+FGLF PD  +KY +SFN
Sbjct  308   YLFAMFDENRKP----DPETERNFGLFRPDKSAKYQISFN  343



>pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose
 pdb|4GZJ|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose And Laminaratetrose
Length=323

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/319 (53%), Positives = 220/319 (69%), Gaps = 10/319 (3%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             Q IGVCYG+I NNLP+    I LY    I+ +R+Y P TNVF+AL+GSNI++I+DVPN  
Sbjct  1     QPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILDVPNQD  60

Query  311   LPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPGKTGSDYAL---AALKNVHAAL  478
             L ALAN + A  WVQ NI   +P+V FKY+AVGNEV PG+    YA     A++N++ AL
Sbjct  61    LEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRESGKYARFVGPAMENIYNAL  120

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK ST+TYSG+L +TYPP + +F++E K+ + PI+ FLA++NLPLLANIYPY
Sbjct  121   SSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLLANIYPY  180

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWP  832
             F    + + V L +ALF++         NLFDA+++S Y A EK GG N++I+VS +GWP
Sbjct  181   FGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIVSASGWP  240

Query  833   SEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTE  1012
             SEG P A+  NA TYY NLI HV+   GT K+PG  IETYLFAMFDEN K      + +E
Sbjct  241   SEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKK----GEASE  296

Query  1013  RHFGLFTPDMMSKYNLSFN  1069
             +HFGLF PD   KY L+FN
Sbjct  297   KHFGLFNPDQRPKYQLNFN  315



>ref|XP_007211511.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
 gb|EMJ12710.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
Length=349

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 219/324 (68%), Gaps = 10/324 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYGR GNNLP+ +  + LYK+ GI  +R+YEP+   + AL+GSNI++ V
Sbjct  29    LQITGAQSVGVCYGRNGNNLPSESDVVGLYKSNGIGRMRIYEPNDPTYQALKGSNIELTV  88

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              +    L  L +  AA  WVQ+N+  Y P+V FKY+AVGNEV P    + Y L A++N+H
Sbjct  89    TILKSQLQGLTDAAAATDWVQKNVQAYSPDVKFKYIAVGNEVRPTDPETQYLLPAIQNIH  148

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A++AAN +G IK STA  + ++D+ YPP  G + D AK+ + P++ FLA N  PLL N+
Sbjct  149   NAIVAANLQGQIKVSTAIDTTLVDNAYPPSAGKYSDAAKSFITPVINFLASNGAPLLVNV  208

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPY + T +P  + + +ALF+     + +     NLFDA+L++ Y+A+EKA   NV+IVV
Sbjct  209   YPYVSYTENPSQIDIAYALFTSQGITTPDGVKYQNLFDALLDAQYSALEKANAPNVEIVV  268

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEG   A+  NA+T+Y+NLI HV+G  GT KRPG  IETYLFAMFDEN K    
Sbjct  269   SESGWPSEGSDAATTQNAQTFYQNLINHVKGTTGTPKRPGKAIETYLFAMFDENIK----  324

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
             +  + ERHFGLF+P+   KY L+F
Sbjct  325   DGAEVERHFGLFSPNKQPKYQLTF  348



>dbj|BAE53383.1| beta-1,3-glucanase [Sesbania rostrata]
Length=343

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 222/335 (66%), Gaps = 14/335 (4%)
 Frame = +2

Query  89    AILLLIGFLHIAGV-----QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             A+LL IG L    V     QS+GVCYGR G+NLP    T+ LYK+ GI  +R+Y+PD   
Sbjct  15    AMLLFIGILSFTQVEFTAAQSVGVCYGRNGDNLPTQQETVDLYKSNGIGRMRIYDPDERS  74

Query  254   FDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
               AL+GSNI++I+ VPND L +L +  AA  W+  N+  Y  +V FKY+AVGNEV P   
Sbjct  75    LQALKGSNIELILGVPNDKLQSLNDAGAATDWINTNVKAYSSDVKFKYIAVGNEVEPNAN  134

Query  431   GSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A++N+  A+ +AN +  IK STA  S ++ ++YPP NGVF D A   + PIV 
Sbjct  135   EAQYVLPAMRNIQNAISSANLQDQIKVSTAIKSSLVTNSYPPNNGVFSDSASGYIKPIVD  194

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEK  784
             FL  N  PLLAN+YPYF+   +   V L +ALF++  +      NLFDA+L+S YAA+EK
Sbjct  195   FLVSNRAPLLANLYPYFSHVENQQTVPLNYALFTQQGTNDAGYQNLFDALLDSLYAALEK  254

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             AG SNV +VVSE+GWPS+GG  A+  NA TYY+NLI HV+G  GT KRP   IETYLFAM
Sbjct  255   AGASNVNVVVSESGWPSDGGVAANVDNAGTYYRNLINHVKG--GTPKRPNGPIETYLFAM  312

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FDEN K    + +++E+HFGLF PD   KY LS+N
Sbjct  313   FDENRK----DGEESEKHFGLFRPDKSPKYQLSYN  343



>gb|KHN05499.1| Glucan endo-1,3-beta-glucosidase, acidic isoform GL153 [Glycine 
soja]
Length=340

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 217/322 (67%), Gaps = 9/322 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             +   G QS+GVCYG  GNNLP   A + LYK+  I  +RLY PD  V  ALRGSNI+VI+
Sbjct  25    VEFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVIL  84

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              VPND L +L N  AA  WV + +  Y  NV FKY+AVGNE++PG + +   L AL+N+ 
Sbjct  85    GVPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGSVLPALENIQ  144

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ AAN +G +K STA  + +L ++YPP++GVF   A + + PIV FLA+N  PLLAN+
Sbjct  145   KAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLLANV  204

Query  647   YPYFARTGDPDHVQLPFALFSE-VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             YPYFA   +   + L +ALF++  N+     NLFDA+L+S YAA+EK G  NV++VVSE+
Sbjct  205   YPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVVSES  264

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPSEGG  A+  NA TYY+NLI H +G  GT KRP   IETYLFAMFDEN K    +  
Sbjct  265   GWPSEGGVGATVQNAGTYYRNLINHAKG--GTPKRPSGPIETYLFAMFDENQK----DGP  318

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + ERHFGLF PD   KY LSFN
Sbjct  319   EIERHFGLFRPDKSPKYQLSFN  340



>gb|AAL30420.1|AF434173_1 glucanase [Sambucus nigra]
Length=340

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 235/345 (68%), Gaps = 23/345 (7%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             + A L+LIG L     IAG QS+GVCYG+ GNNLP+    + LYK YGIR +R+Y+P   
Sbjct  1     MVAALVLIGLLMPTLQIAGAQSVGVCYGQKGNNLPSQRDVVNLYKKYGIRRMRVYDPAEP  60

Query  251   VFDALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPG  424
             +  ALRG +I++I+DVPN  L  LA N +AA  WVQ NI  Y  +V F+Y+AVGNEV P 
Sbjct  61    ILQALRGKSIEIILDVPNSDLQNLASNPSAAVTWVQNNIRNYSRDVRFRYIAVGNEVDPY  120

Query  425   KTGSDY---ALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLM  592
                  Y    L  ++NVH A++AA  +G IK STATY+GVL  T PP  G+++   ++ +
Sbjct  121   NENVQYISFVLPTMRNVHDAIVAAGLQGQIKVSTATYTGVLIVTSPPSAGLYRPNVRSFI  180

Query  593   YPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE---VNSYSEEN----NLFDA  751
              PI+ FL QNNLPLL N+YP+ A TG+ D +QLP+ALF+    V + S+ N    NLF A
Sbjct  181   DPIINFLVQNNLPLLVNVYPHIAITGNSD-IQLPYALFTAPGVVVTDSDRNLEYRNLFVA  239

Query  752   MLESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRP  931
             +L++ YAA+EKAGG NV+IVVSE+GWP++G P A+  NA+TY  NLI+HV+G  GT +RP
Sbjct  240   ILDAHYAALEKAGGPNVEIVVSESGWPTQGHPVATIDNAKTYNNNLIRHVKGRSGTPRRP  299

Query  932   GSHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             G  IETY+FAMFDE   T KP++    RHFGLF+P+    Y +SF
Sbjct  300   GRDIETYIFAMFDE---TQKPSD--MARHFGLFSPNQKLIYPISF  339



>ref|XP_003607315.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89512.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             ++ I LL+G L I      V+SIGVCYG IGNNLP+    + LYK+ GI  +R++ PD  
Sbjct  1     MSIIFLLVGILSIGLQFTAVESIGVCYGMIGNNLPSRQDVVNLYKSRGINQMRIFFPDEP  60

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                ALRGSNI++I+DV  + LP+L N N A  WV + + PY  NV  KY++VGNE+ P  
Sbjct  61    ALQALRGSNIELILDVAKETLPSLRNANEATNWVNKYVRPYAQNVKIKYISVGNEIKPND  120

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               + Y L A++N+  A+ +AN +G IK STA    ++  ++PP +GVF D+AK  + PI+
Sbjct  121   NEAQYILPAMQNIQNAISSANLQGQIKVSTAIDMTLIGKSFPPNDGVFSDQAKPYIQPII  180

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVE  781
              FL  N  PLLAN+YPYFA  GD  ++ L +ALF +  N+     NLFDA L+S YAA+E
Sbjct  181   NFLNNNGAPLLANVYPYFAYIGDKVNIPLDYALFRQQGNNAVGYQNLFDAQLDSVYAALE  240

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             K G S V+IVVSE+GWPS  G  AS  NA TYY+NLI HV+  +GT KRPG+ IETYLFA
Sbjct  241   KVGASGVKIVVSESGWPSAAGDSASTDNAATYYRNLINHVK--NGTPKRPGA-IETYLFA  297

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             MFDEN KT       TE+HFGLF PD   KY +SFN
Sbjct  298   MFDENQKT----GAATEQHFGLFNPDKSPKYQISFN  329



>ref|XP_009366077.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=348

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 225/338 (67%), Gaps = 14/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A+ILLL+  L     I G QS+GVCYGR GNNLP     + LYK+ GI  +R+YEP+  
Sbjct  14    MASILLLLVVLMPALQITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEA  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                ALRGSNI++ V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV PG 
Sbjct  74    TLQALRGSNIELTVTILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEVRPGA  133

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
                 + L A++N+H+A++AAN +G IK STA  + ++ + YPP +GV+ D A   + P++
Sbjct  134   AEVGFLLPAIQNIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVI  193

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYA  772
              FL  N  PLL N+YPYF+   +P  + L +ALF+     V   +   +LFDA+L++ YA
Sbjct  194   DFLVSNGAPLLVNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYA  253

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAG  NV+IVVSE+GWPSEGG  A+  NA T+Y+NLI+HV    GT KRPG  IETY
Sbjct  254   ALEKAGAPNVEIVVSESGWPSEGGNQATPENAATFYQNLIKHVTSTTGTPKRPGKAIETY  313

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      +  E+HFG+FTP+   KY L+F
Sbjct  314   LFAMFDENLKA----GNADEKHFGIFTPNKQPKYQLTF  347



>gb|ACU20860.1| unknown [Glycine max]
Length=340

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 9/322 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             +   G QS+GVCYG  GNNLP   A + LYK+  I  +RLY PD  V  ALRGSNI+VI+
Sbjct  25    VEFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVIL  84

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              VPND L +L N  AA  WV + +  Y  NV FKY+AVGNE++PG + +   L AL+N+ 
Sbjct  85    GVPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGSVLPALENIQ  144

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ AAN +G +K STA  + +L ++YPP++GVF   A + + PIV FLA+N  PLLAN+
Sbjct  145   KAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLLANV  204

Query  647   YPYFARTGDPDHVQLPFALFSE-VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             YPYFA   +   + L +ALF++  N+     NLFDA+L+S YAA+EK G  NV++VVSE+
Sbjct  205   YPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVVSES  264

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPSEGG  A+  NA TYY+NLI H +G  GT  RP   IETYLFAMFDEN K    +  
Sbjct  265   GWPSEGGVGATVQNAGTYYRNLINHAKG--GTPMRPSGPIETYLFAMFDENQK----DGP  318

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + ERHFGLF PD   KY LSFN
Sbjct  319   EIERHFGLFRPDKSPKYQLSFN  340



>emb|CDP20080.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 226/342 (66%), Gaps = 17/342 (5%)
 Frame = +2

Query  83    IAAILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +  IL L+G     L I  VQSIGVCYG  GNNLP+    I LY  YGI+ +R+Y PD  
Sbjct  2     MTTILTLLGLFLVSLKITEVQSIGVCYGLNGNNLPSKQDVINLYNRYGIQRMRIYAPDHE  61

Query  251   VFDALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPG  424
             V +ALRG+NI+++VDV N+ +P++A N +AA  WVQ NI  Y P V F+Y+AVGNEV   
Sbjct  62    VLNALRGTNIELLVDVANEDIPSIATNPSAAANWVQNNIKNYSPAVKFRYIAVGNEVSLS  121

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              + + Y   A++ + +AL +A  +  IK ST+  + +L  + PP  G F +EAK  + PI
Sbjct  122   SSIAQYVGPAMERIQSALASAGLQNQIKVSTSVAANLLSVSSPPSQGSFSNEAKPFIKPI  181

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             +  L QNN PLL N+YPYF+  GDP ++ L +ALF+      ++      N+FDA+L++ 
Sbjct  182   INLLVQNNAPLLVNVYPYFSYIGDPVNIHLDYALFTSQGIVVQDGSFGYRNIFDAILDAH  241

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGG-PDASHGNAETYYKNLIQHVEGNHGTRKRPGSHI  943
             Y+A+EK GGSNV IVVSETGWPS+G  P AS GNA TYY+N+I HV+   GT +RP + I
Sbjct  242   YSALEKEGGSNVDIVVSETGWPSDGNPPAASSGNAGTYYRNVISHVKSGQGTPRRPRTGI  301

Query  944   ETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             ETYLFAMFDEN K       +TERHFGLF P+  SKY +SFN
Sbjct  302   ETYLFAMFDENQKL----GAETERHFGLFFPNQQSKYGISFN  339



>ref|XP_008363318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 222/324 (69%), Gaps = 10/324 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYGR G+NLP     + LYK+ GI  +R+YEP+   F ALRGSNI++ +
Sbjct  28    LEITGAQSVGVCYGRNGDNLPAEGEVVDLYKSNGIGRMRMYEPNEATFQALRGSNIELTL  87

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              + N  L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+PG   + + L A++N+H
Sbjct  88    TILNSELSALNDAAAATAWVQKNVQPYSADVRFKYIAVGNEVHPGTAEAGFLLPAIQNIH  147

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A++AAN +G IK STA  + ++ + YPP +G++ D A   + PI+ FL  N  PLL N+
Sbjct  148   SAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGIYTDAANPFITPIINFLVSNGAPLLVNV  207

Query  647   YPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPYF+  GDP+++ L +ALF+     V   +   +LFDA+L++ Y+A+EKAG  N++IVV
Sbjct  208   YPYFSYNGDPNNIDLGYALFTSQGVVVPDGTRYPSLFDALLDAQYSALEKAGAPNIEIVV  267

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEGG  A+  NA T+Y+NLI HV    GT KRPG  IETYLFA+FDEN K  +P
Sbjct  268   SESGWPSEGGNQATAQNAATFYQNLISHVTSTTGTPKRPGRAIETYLFALFDENLKGPEP  327

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
                  E+HFG+F+P+   KY L+F
Sbjct  328   ----VEKHFGVFSPNKQHKYQLTF  347



>gb|AFP23132.1| beta-1,3-glucanase [Pyrus pyrifolia]
Length=348

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 224/338 (66%), Gaps = 14/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A+ILLL+  L     I G QS+GVCYGR GNNLP     + LYK+ GI  +R+YEP+  
Sbjct  14    MASILLLLVVLMPALQITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEA  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                ALRGSNI++ V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV PG 
Sbjct  74    TLQALRGSNIELTVTILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEVRPGA  133

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
                 + L A++N+H+A++AAN +G IK STA  + ++ + YPP +GV+ D A   + P++
Sbjct  134   AEVGFLLPAIQNIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVI  193

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYA  772
              FL  N  PLL N+YPYF+   +P  + L +ALF+     V   +   +LFDA+L++ YA
Sbjct  194   DFLVSNGAPLLVNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYA  253

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAG  NV+IVVSE+GWP EGG  A+  NA T+Y+NLI+HV    GT KRPG  IETY
Sbjct  254   ALEKAGAPNVEIVVSESGWPFEGGNQATPENAATFYQNLIKHVTSTTGTPKRPGKAIETY  313

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      +  E+HFG+FTPD   KY L+F
Sbjct  314   LFAMFDENLKA----GNADEKHFGIFTPDKQPKYQLTF  347



>ref|NP_001237271.1| endo-1,3-beta-glucanase precursor [Glycine max]
 gb|AAR26001.1| endo-1,3-beta-glucanase [Glycine max]
Length=340

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 9/322 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             +   G QS+GVCYG  GNNLP   A + LYK+  I  +RLY PD  V  ALRGSNI+VI+
Sbjct  25    VEFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVIL  84

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              VPND L +L N  AA  WV + +  Y  NV FKY+AVGNE++PG + +   L AL+N+ 
Sbjct  85    GVPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGSVLPALENIQ  144

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ AAN +G +K STA  + +L ++YPP++GVF   A + + PIV FLA+N  PLLAN+
Sbjct  145   KAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLLANV  204

Query  647   YPYFARTGDPDHVQLPFALFSE-VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             YPYFA   +   + L +ALF++  N+     NLFDA+L+S YAA+EK G  NV++VVSE+
Sbjct  205   YPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVVSES  264

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPSEGG  A+  NA TYY+NLI H +G  GT KRP   IETYLFAMFD N K    +  
Sbjct  265   GWPSEGGVGATVQNAGTYYRNLINHAKG--GTPKRPSGPIETYLFAMFDGNQK----DGP  318

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + ERHFGLF PD   KY LSFN
Sbjct  319   EIERHFGLFRPDKSPKYQLSFN  340



>ref|XP_008366411.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 225/338 (67%), Gaps = 14/338 (4%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A+ILLL+  L     I G QS+GVCYGR GNNLP     + LYK+ GI  +R+YEP+  
Sbjct  14    MASILLLLVVLMPALQITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEA  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                ALRGSNI++ V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P  
Sbjct  74    TLQALRGSNIELTVTILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEVHPDA  133

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
                 + L A++N+H+A++AAN +G IK STA  + ++ + YPP +GV+ D A   + P++
Sbjct  134   AEVGFLLPAIQNIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVI  193

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYA  772
              FL  N  PLL N+YPYF+   +P  + L +ALF+     V   +   +LFDA+L++ YA
Sbjct  194   DFLVSNGAPLLVNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYA  253

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAG  NV+IVVSE+GWPSEGG  A+  NA T+Y+NLI+HV    GT KRPG  IETY
Sbjct  254   ALEKAGAPNVEIVVSESGWPSEGGNQATPQNAATFYQNLIKHVTSTTGTPKRPGKAIETY  313

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      +  E+HFG+F+PD   KY L+F
Sbjct  314   LFAMFDENLK----EGNADEKHFGIFSPDKQPKYQLTF  347



>ref|XP_009374912.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=335

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 224/324 (69%), Gaps = 10/324 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYGR G+NLP     + LYK+ GI  +R+YEP+   F ALRGSNI++ V
Sbjct  15    LEITGAQSVGVCYGRNGDNLPAEGEVVDLYKSNGIGRMRMYEPNEATFQALRGSNIELTV  74

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              + N+ L AL +  AA  WVQ+N+ P+  +V FKY+AVGNEV+PG   + + L A++N+H
Sbjct  75    TILNNELSALNDAAAATAWVQKNVQPFSADVRFKYIAVGNEVHPGTAEAGFLLPAIQNIH  134

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A++AAN +G IK STA  + ++ + YPP +G++ ++A   + PI+ FL  N  PLL N+
Sbjct  135   SAIVAANLQGQIKVSTAIDATLVTNPYPPSDGIYTEDANPFITPIINFLVSNGAPLLVNV  194

Query  647   YPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPYF+   DP+++ L +ALF+     V   +   +LFDA+L++ Y+A+EKAG  N++IVV
Sbjct  195   YPYFSYNDDPNNIDLGYALFTSQGVVVPDGTRYPSLFDALLDAQYSALEKAGAPNIEIVV  254

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEGG  A+  NA T+Y+NLI HV  N GT KRPG  IETYLFA+FDEN K  +P
Sbjct  255   SESGWPSEGGNQATAQNAATFYQNLISHVTSNTGTPKRPGRAIETYLFALFDENLKGPEP  314

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
                  E+HFG+F+P+   KY L+F
Sbjct  315   ----VEKHFGVFSPNKQPKYQLTF  334



>ref|XP_009592823.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=345

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 220/335 (66%), Gaps = 12/335 (4%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             +L+  L I   Q +GVCYGR GNNLP+A   + LYK  GI  +R+Y+P      AL+GSN
Sbjct  13    MLMTCLQIIDAQPVGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIPETLTALKGSN  72

Query  278   IDVIVDVPNDML-PALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----  439
             I +I+D+ ND L P   +  AA  WV  NI  Y P V FKY++VGNEV P   G+     
Sbjct  73    ISIILDISNDNLQPFSIDPKAAENWVIANIKSYFPQVKFKYISVGNEVSPKNVGTSQFVP  132

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             + L AL+NV  A+     +  +KA+T   +G+L +TYPP   VF D+  + + PI+ FL 
Sbjct  133   FVLPALRNVQQAITKFRMQNQVKATTTIDTGLLTNTYPPSKSVFSDDVTSFINPIIGFLK  192

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGG  793
             QNNLPLLAN+YPY+   GDP  V LP+ALF++ N   +  +NLFDAML++ Y AVEKAGG
Sbjct  193   QNNLPLLANVYPYYGYIGDPGRVPLPYALFTQKNPDLTGYHNLFDAMLDATYYAVEKAGG  252

Query  794   SNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDE  973
              NVQIVV+E+GWPS+GG  AS  NA TYY+NLI HV+   GT  +PG  IETYLFAMFDE
Sbjct  253   DNVQIVVAESGWPSDGGFGASMENAGTYYRNLISHVKLGAGTIHKPGKAIETYLFAMFDE  312

Query  974   NNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN*VQ  1078
             N K       +TE+HFG+F PD   KYNL+F+ +Q
Sbjct  313   NIKI----GAETEKHFGVFHPDNTQKYNLNFDRIQ  343



>ref|XP_002278123.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 sp|A7PQW3.2|E13B_VITVI RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Vitis 
vinifera]
Length=344

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 243/341 (71%), Gaps = 22/341 (6%)
 Frame = +2

Query  92    ILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ++LL+GF+ ++    G QSIGVCYGR GNNLP+A+  I LYK+ GI  +R+Y+P+++   
Sbjct  11    VVLLLGFVIMSTITIGAQSIGVCYGRNGNNLPSASQVINLYKSNGIGSMRIYDPNSDTLQ  70

Query  260   ALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTG  433
             ALRGS+I++I+DVPN D+    ++ +AA  WVQ N+V Y + V F+Y+AVGNEV P  + 
Sbjct  71    ALRGSDIELILDVPNTDLQSLASDASAAATWVQNNVVNYASEVKFRYIAVGNEVLPTGSN  130

Query  434   SDYA---LAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
             + YA   L A+KNV +A+ +A  +  IK STAT+S VL  +YPP  G F D+  + + PI
Sbjct  131   AQYAQYVLPAMKNVQSAITSAGLQDQIKVSTATFSAVLGKSYPPSEGSFSDDVSSFINPI  190

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             + FLA+N  PLLANIYPYF+ TGD  +++L +ALF+      ++      NLFDA+L++ 
Sbjct  191   ISFLAENGSPLLANIYPYFSYTGDTQNIRLDYALFTASGVVVQDGSYQYQNLFDALLDAL  250

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+EKAGGSN++IVVSE+GWPSEGG  A+  NA TYYKNLI HV+G  GT ++ G+ IE
Sbjct  251   YAALEKAGGSNLKIVVSESGWPSEGGTAATVDNARTYYKNLINHVKG--GTPRKSGA-IE  307

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             TYLFAMFDEN KT      +TE+HFGLFTP   SKY +SF+
Sbjct  308   TYLFAMFDENQKT----GLETEKHFGLFTPGQESKYQISFS  344



>ref|XP_002299791.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE84596.2| 3-glucanase family protein [Populus trichocarpa]
Length=338

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 223/336 (66%), Gaps = 18/336 (5%)
 Frame = +2

Query  92    ILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ILLL G     L ++  QSIGVCYG+ GNNLP+    ++L++   I  +R+Y+P+ +  +
Sbjct  9     ILLLFGLIISRLTLSDAQSIGVCYGKNGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             ALRGSNI+V++ VPND L +L + +AA  WVQ N+V Y  NV F+Y+AVGNEV+PG   +
Sbjct  69    ALRGSNIEVVLGVPNDKLQSLTDASAATTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANA  128

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
                L A++N+H A+ +AN +  IK STA  + +L  +YPP +G F D A + + PI+ FL
Sbjct  129   QSVLPAMQNIHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSDSASSYINPIINFL  188

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLLAN+YPYF+ TG+P  + L +ALF+      ++      NLFDA+L+S YAA+
Sbjct  189   RTNGSPLLANVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAAL  248

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  ++ IVVSE+GWPSEGG  A+  NA T+Y+NLI HV+   GT +R G  IETYLF
Sbjct  249   EKAGAPDLNIVVSESGWPSEGGTAATADNAGTFYRNLINHVK--QGTPRRSGQAIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K         E+HFGLF P+   KY L+F
Sbjct  307   AMFDENLKAAG-----IEQHFGLFLPNKQPKYQLTF  337



>gb|ABK95326.1| unknown [Populus trichocarpa]
Length=338

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 223/336 (66%), Gaps = 18/336 (5%)
 Frame = +2

Query  92    ILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ILLL G     L ++  QSIGVCYG+ GNNLP+    ++L++   I  +R+Y+P+ +  +
Sbjct  9     ILLLFGLMISRLTLSDAQSIGVCYGKNGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             ALRGSNI+V++ VPND L +L + +AA  WVQ N+V Y  NV F+Y+AVGNEV+PG   +
Sbjct  69    ALRGSNIEVVLGVPNDKLQSLTDASAATTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANA  128

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
                L A++N+H A+ +AN +  IK STA  + +L  +YPP +G F D A + + PI+ FL
Sbjct  129   QSVLPAMQNIHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSDSASSYINPIINFL  188

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLLAN+YPYF+ TG+P  + L +ALF+      ++      NLFDA+L+S YAA+
Sbjct  189   RTNGSPLLANVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAAL  248

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  ++ IVVSE+GWPSEGG  A+  NA T+Y+NLI HV+   GT +R G  IETYLF
Sbjct  249   EKAGAPDLNIVVSESGWPSEGGTAATADNAGTFYRNLINHVK--QGTPRRSGQAIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K         E+HFGLF P+   KY L+F
Sbjct  307   AMFDENLKAAG-----IEQHFGLFLPNKQPKYQLTF  337



>ref|XP_003607321.1| Endo-beta-1 3-glucanase [Medicago truncatula]
Length=398

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 220/330 (67%), Gaps = 9/330 (3%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             ++ I LL+G L   G+Q  GVCYG +GNNLP+    + LYK+ GI  +R+Y PD  V  A
Sbjct  56    MSIIFLLVGILLSIGLQFTGVCYGVLGNNLPSKQEVVDLYKSKGIGKMRIYYPDQEVLQA  115

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI++I+ V  + L +L +   A  WVQ+ + PY  +V  KY+ VGNE+ P    + 
Sbjct  116   LRGSNIELILGVTKETLSSLTDAGEATNWVQKYVTPYAQDVKIKYITVGNEIKPNDNEAQ  175

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y   A++N+  A+ +AN +G IK STA    ++ ++YPP  GVF D+A + + PI+ FL 
Sbjct  176   YIATAMQNIQNAISSANLQGQIKVSTAIDMTLIGNSYPPNAGVFTDQANSYIQPIINFLV  235

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGG  793
             +N  PLLAN+YPYFA  G+   + L + LF +  N+    NN+FDAML+S YAA+EK GG
Sbjct  236   KNGAPLLANVYPYFAYIGNKQSISLDYVLFKQQGNNEVGYNNIFDAMLDSVYAALEKVGG  295

Query  794   SNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDE  973
             SNV+IVVSE+GWPS+GG  AS  NA TYY NLI H++  +GT KRPG+ IETYLFAMFDE
Sbjct  296   SNVKIVVSESGWPSKGGDSASIDNAATYYSNLINHIK--NGTPKRPGAAIETYLFAMFDE  353

Query  974   NNKTVKPNNDQTERHFGLFTPDMMSKYNLS  1063
             N KT       TE+H+GLF PD   KY+++
Sbjct  354   NQKT----GATTEQHYGLFNPDKSPKYHVA  379



>ref|XP_008227227.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=343

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 216/314 (69%), Gaps = 10/314 (3%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYG+ GNNLP+ T  + LYK+ GI  +R+YEP+   ++AL+GSNI++ V
Sbjct  15    LQITGAQSVGVCYGQNGNNLPSPTEVVDLYKSNGIGRMRIYEPNYPTYEALKGSNIELTV  74

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              +P D L  L + +AA  WV++N+  Y P+V FKY+AVGNEV+P    + Y L A++N+H
Sbjct  75    TIPIDKLQGLNDADAATDWVEKNVQAYLPDVKFKYIAVGNEVHPTDAEAQYLLPAIQNIH  134

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A++AAN +G IK STA  +  +D+ YPP  G + D AK+ + P++ FLA N  PLL N+
Sbjct  135   SAIVAANLQGQIKVSTAIDTSHVDNDYPPSAGKYSDAAKSFITPVINFLASNGAPLLVNV  194

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPYF+ T +P  + L +ALF+       +     NLFDA+L++ Y+A+EKA  SNV+IVV
Sbjct  195   YPYFSYTANPADIDLAYALFTSQGVTMPDGVKYQNLFDALLDAQYSALEKANASNVEIVV  254

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPS+GG  A+  NA+T+Y+NLI HV G  GT KRPG  IETYLFAMFDEN K    
Sbjct  255   SESGWPSKGGDAATPKNAQTFYQNLINHVTGTSGTPKRPGKAIETYLFAMFDENIKA---  311

Query  995   NNDQTERHFGLFTP  1036
                +  RHFG+F P
Sbjct  312   -GSEVVRHFGIFYP  324



>gb|AAX81590.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 228/335 (68%), Gaps = 16/335 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR G+NLP+ T  + LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGAQSAGVCYGRNGDNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+PG   + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPGAAEAQ  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y L A++N+  A+ AAN +G IK STA  + +LD ++PP +G F   A + + PI+ FL 
Sbjct  137   YLLPAIQNIQNAVTAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLG  196

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVE  781
              N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+E
Sbjct  197   NNGAPLLVNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALE  256

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG SN+ IVVSE+GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFA
Sbjct  257   KAGASNMAIVVSESGWPSEGSDAATNGNAGTYYSNLISHVK--TGTPKRPNGAIETYLFA  314

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   MFDENLK----DGAEIEKHFGIFSPNKQPKYQLTF  345



>ref|XP_003607316.1| Glucan endo-1 3-beta-d-glucosidase [Medicago truncatula]
 gb|AES89513.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/336 (51%), Positives = 218/336 (65%), Gaps = 14/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             ++ I LL+G L I      V+SIGVCYG IGNNLP+    + LY++ GI  +RLY PD  
Sbjct  1     MSIIFLLVGILSIGLKLTAVESIGVCYGMIGNNLPSRQDVVNLYRSRGINQMRLYFPDEQ  60

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGK  427
                ALRGSNI++I+DV  + L +L N N A  WV R + PY  +V  KY+ VGNE+ P  
Sbjct  61    ALQALRGSNIELILDVARETLNSLRNANEATNWVNRYVKPYARDVKIKYITVGNEIKPYD  120

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
             + +   L A++N+  A+ AAN +G IK S A    ++ ++YPP NGVF D+AK  + PI+
Sbjct  121   SEAQSILPAMQNIQNAISAANLQGQIKVSIAIDMTLIGNSYPPNNGVFTDQAKPYIQPII  180

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVE  781
              FL  N  PLLAN+YPYFA   +   + L +ALF +  N+     NLFDA L+S YAA+E
Sbjct  181   NFLKNNGAPLLANVYPYFAYINNKQSISLDYALFRQQGNNQVGYRNLFDAQLDSVYAALE  240

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             K G S V+IVVSE+GWPS GG  AS  NA TYY+NLI HV   +GT KRPG+ IETYLFA
Sbjct  241   KVGASGVKIVVSESGWPSAGGDSASTDNAATYYRNLINHVR--NGTPKRPGA-IETYLFA  297

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             MFDEN KT       TE+HFGLF P+   KY +SFN
Sbjct  298   MFDENQKT----GAATEQHFGLFNPNRTPKYQISFN  329



>ref|XP_010101245.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88169.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=326

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 217/319 (68%), Gaps = 12/319 (4%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G QSIGVCYG++ NNLP  +  I LYK+  I  +R+Y PD     AL+GSNI++IVDV N
Sbjct  16    GAQSIGVCYGKLANNLPTESEVINLYKSNNIGKMRIYSPDQATLQALKGSNIELIVDVTN  75

Query  305   DMLPALANFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
             + L +L +  AA  WVQRNIV + + V+FKY+AVGNE++PG   +++ L A+KNV +A+ 
Sbjct  76    EKLQSLTDAGAASDWVQRNIVSFSSGVSFKYIAVGNEIHPGDGEANFVLPAMKNVQSAIN  135

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +A+ +G IK ST+  + +L  +YPP +G F D AK  + PI  FL QN  PLLAN+YPYF
Sbjct  136   SASLQGKIKVSTSIDTSLLGKSYPPNDGAFSDAAKGYIKPIANFLTQNGSPLLANVYPYF  195

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE--NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWP  832
             A TGD   + L +ALF+   S +     NLFDA L++ YAA+EK    +V+IVVSE+GWP
Sbjct  196   AYTGD-RSIDLQYALFNSKGSSNGTGYQNLFDAQLDALYAALEKVKAPDVKIVVSESGWP  254

Query  833   SEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTE  1012
             SEG   A+  NA TYY+NLI HV+G  GT K+P   IETYLFAMF+EN K     +   E
Sbjct  255   SEGDSAATTNNAGTYYRNLIAHVKG--GTPKKPQGPIETYLFAMFNENQK-----DGAQE  307

Query  1013  RHFGLFTPDMMSKYNLSFN  1069
             +H+GLF+PD   KY LSF+
Sbjct  308   QHYGLFSPDKQPKYQLSFS  326



>emb|CDP09617.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 219/323 (68%), Gaps = 13/323 (4%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  GNNLP+  A I LYK  GI+ +R+Y PD  V +AL+G+NI+++VDVPN
Sbjct  65    GVQSIGVCYGLNGNNLPSKQAVINLYKRNGIQRMRIYGPDPEVLNALKGTNIELLVDVPN  124

Query  305   DMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
             + +  +A N +AA  WVQ NI  Y P V F+Y++VGNEV  G   + Y   A++ +  A+
Sbjct  125   ESIQDVATNPSAAANWVQNNIKKYSPAVKFRYISVGNEVPVGSAVARYVGPAMEKIQKAI  184

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK ST+  +G++ ++YPP +G F +EAK  + PI+ FL QNN PLL N+YPY
Sbjct  185   ASAGLQNQIKVSTSILTGLVTNSYPPSHGSFSNEAKPFIKPIINFLVQNNAPLLVNVYPY  244

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             F+  G  + + L +ALF+   +  ++      NLFDAML+  Y+A+EK GGS V IVVSE
Sbjct  245   FSYIGSRNTIPLDYALFTSQKTVVQDGKLGYQNLFDAMLDGHYSALEKEGGSKVNIVVSE  304

Query  821   TGWPSEGGPD-ASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             TGWPS G P  AS  NA TYYKN+I+HV    GT K+PG+ IETYLFAMFDEN K     
Sbjct  305   TGWPSAGNPPAASSANAGTYYKNVIRHVMSGKGTPKKPGAGIETYLFAMFDENQK----R  360

Query  998   NDQTERHFGLFTPDMMSKYNLSF  1066
              ++TE+HFGLF+P+   KY +SF
Sbjct  361   GEETEKHFGLFSPNQQPKYGISF  383



>ref|XP_003537741.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
Length=338

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 221/335 (66%), Gaps = 11/335 (3%)
 Frame = +2

Query  83    IAAILLLIGFLH-IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             +++ILLL+G L  I   QSIGVCYG +GNNLP+    + LYK  GI  +R+Y PD     
Sbjct  9     MSSILLLVGMLSSITVAQSIGVCYGVLGNNLPSRQEVVDLYKTNGIGRMRIYYPDEEALQ  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGS  436
             ALRGS I++I+DV  + L ++ + NAA  WV + +  Y  +VNFKY+AVGNE++P    +
Sbjct  69    ALRGSGIELIMDVAKETLQSMTDPNAATDWVNKYVTAYSQDVNFKYIAVGNEIHPNTNEA  128

Query  437   DYALAALKNVHAALLAANRGGIKASTATYSG-VLDHTYPPENGVFKDEAKNLMYPIVQFL  613
              Y L+A+ N+  A+ +AN   IK STA  S  +   +YPP + VF  +A+  + PI+ FL
Sbjct  129   QYILSAMTNIQNAISSANL-QIKVSTAIDSTFIAPPSYPPNDAVFTSDAEPYVKPIIDFL  187

Query  614   AQNNLPLLANIYPYFARTGDPDH-VQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKA  787
              +N  PLLAN+YPYFA   D  + + L +ALF++  N+ +   NLFDAML+S YAAVEK 
Sbjct  188   VRNEAPLLANVYPYFAYANDQQNSIPLAYALFTQQGNNDAGYQNLFDAMLDSIYAAVEKV  247

Query  788   GGSNVQIVVSETGWPSE-GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             G SN+QIVVSE+GWPSE GG  AS  NA TY  NLI H  G  GT KRPG  IETYLFAM
Sbjct  248   GASNLQIVVSESGWPSEGGGTGASIDNAGTYNANLISHASGGSGTPKRPGGSIETYLFAM  307

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FDEN K     + +TERHFGLF PD   KY L+FN
Sbjct  308   FDENQK----QDAETERHFGLFRPDKSPKYQLNFN  338



>ref|XP_009790797.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=340

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 219/332 (66%), Gaps = 12/332 (4%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             +L+  L I   Q +GVCYGR GNNLP++   + LYK  GI  +R+Y+P     +AL+GSN
Sbjct  13    MLMTCLQIIDAQPLGVCYGRNGNNLPSSQDVVNLYKANGITNMRVYDPIPETLNALKGSN  72

Query  278   IDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----  439
             I +I+D+ ND L + + +  AA  WV  NI  Y P V FKY++VGNEV P   G+     
Sbjct  73    ISIILDISNDNLQSFSTDPKAAENWVIANIKSYFPQVKFKYISVGNEVSPKNVGTSQFVP  132

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             + L AL+NV  A+     +  +KA+T   +G+L +TYPP   VF D+  + + PI+ FL 
Sbjct  133   FVLPALRNVQQAITKFRMQNQVKATTTIDTGLLTNTYPPAKSVFSDDVTSFINPIIGFLK  192

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVN-SYSEENNLFDAMLESFYAAVEKAGG  793
             QNNLPLLANIYPY+   G+PD V LP+ALF++     +  +NLFDAML++ Y AVEKAGG
Sbjct  193   QNNLPLLANIYPYYGYIGNPDQVPLPYALFTQKKPDPTGYHNLFDAMLDATYYAVEKAGG  252

Query  794   SNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDE  973
              NVQIVV+E+GWPS+GG  AS  NA TYY+NLI HV+   GT  +P   IETYLFAMFDE
Sbjct  253   DNVQIVVAESGWPSDGGFGASMKNAGTYYRNLISHVKLGAGTPHKPEKAIETYLFAMFDE  312

Query  974   NNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             N K       +TE++FG+F PD   KYNL+FN
Sbjct  313   NIKI----GAETEKYFGVFHPDKTQKYNLTFN  340



>ref|XP_011045404.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 220/336 (65%), Gaps = 18/336 (5%)
 Frame = +2

Query  92    ILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ILLL G     L ++  QSIGVCYG+ GNNLP+    ++L++   I  +R+Y+P+ +  +
Sbjct  9     ILLLFGLMISRLTLSDAQSIGVCYGKDGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             ALRGSNI+VI+ VPND L +L + +AA  WVQ N+V Y  NV F+Y+AVGNEV+PG   +
Sbjct  69    ALRGSNIEVILGVPNDKLQSLTDASAAKTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANA  128

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
                L A++NVH A+ +AN +  IK STA  + +L  +YPP +G F   A   + PI+ FL
Sbjct  129   QSVLPAMQNVHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSTGASPYINPIINFL  188

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLLAN+YPYF+ TG+P  + L +ALF+      ++      NLFDA+L+S YAA+
Sbjct  189   RTNGSPLLANVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAAL  248

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  N+ IVVSE+GWPSEGG  A+  NA T+Y+NLI H +   GT +R G  IETYLF
Sbjct  249   EKAGAPNLNIVVSESGWPSEGGTAATVDNAGTFYRNLINHAK--QGTPRRSGQAIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K         E+HFGLF P+   KY L+F
Sbjct  307   AMFDENLKAAG-----IEQHFGLFLPNKQPKYQLTF  337



>ref|XP_007015141.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
 gb|EOY32760.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
Length=345

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 214/325 (66%), Gaps = 16/325 (5%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
              I G QSIGVCYGR G+NLP A   ++LY++ GI  +R+Y+P+    +ALRGSNI++I+D
Sbjct  28    EITGAQSIGVCYGRNGDNLPGAAEVVSLYQSNGIGRMRIYDPNQETLNALRGSNIELILD  87

Query  296   VPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHA  472
             VP D L  L++  AA  WVQRN+V + P+V F+Y+A+GNEV P    + + L A+ NVH 
Sbjct  88    VPLDKLRDLSDAAAANDWVQRNVVSFSPDVKFRYIAIGNEVSPSDQLAAFVLPAMTNVHN  147

Query  473   ALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIY  649
             AL AA  +  IK STA  S V+  + PP  G F D +   + PI+ FLA N  PLLANIY
Sbjct  148   ALAAAGLQDQIKVSTAVASSVIGTSSPPSAGSFSDTSSPFITPIISFLASNGAPLLANIY  207

Query  650   PYFARTGDPDHVQLPFALFS------EVNSYSEENNLFDAMLESFYAAVEKAGGSNVQIV  811
             PYF+ TGDP ++ L FALF+      +   YS + NLFDA+++S Y+A+EK  G+NV IV
Sbjct  208   PYFSYTGDPTNIGLDFALFTAPGVVVQDGQYSYQ-NLFDALVDSLYSALEKTEGANVNIV  266

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPSEGG  A+  NA  YY+NLI HV    GT KR G  IETYLFAMFDEN K   
Sbjct  267   VSESGWPSEGGNAANVDNAGKYYRNLINHV--TQGTPKRSGQAIETYLFAMFDENLKAAG  324

Query  992   PNNDQTERHFGLFTPDMMSKYNLSF  1066
                   E+HFGLF P+   KY ++ 
Sbjct  325   -----FEQHFGLFLPNRQPKYQINL  344



>ref|XP_011001638.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 219/336 (65%), Gaps = 18/336 (5%)
 Frame = +2

Query  92    ILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ILLL G     L ++  QSIGVCYG+ GNNLP+    ++L++   I  +R+Y+P+ +  +
Sbjct  9     ILLLFGLMISRLTLSDAQSIGVCYGKDGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             ALRGSNI+VI+ VPND L +L + +AA  WVQ N+V Y  NV F+Y+AVGNEV+PG   +
Sbjct  69    ALRGSNIEVILGVPNDKLQSLTDASAAKTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANA  128

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
                L A++NVH A+ +AN +  IK STA  + +L  +YPP +G F   A   + PI+ FL
Sbjct  129   QSVLPAMQNVHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSTGASPYINPIINFL  188

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLLAN+YPYF+ T +P  + L +ALF+      ++      NLFDA+L+S YAA+
Sbjct  189   RTNGSPLLANVYPYFSYTDNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAAL  248

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  N+ IVVSE+GWPSEGG  A+  NA T+Y+NLI H +   GT +R G  IETYLF
Sbjct  249   EKAGAPNLNIVVSESGWPSEGGTAATVDNAGTFYRNLINHAK--QGTPRRSGQAIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K         E+HFGLF P+   KY L+F
Sbjct  307   AMFDENLKAAG-----IEQHFGLFLPNKQPKYQLTF  337



>ref|XP_006423938.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|ESR37178.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|KDO56353.1| hypothetical protein CISIN_1g048613mg [Citrus sinensis]
Length=336

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 214/323 (66%), Gaps = 13/323 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L  A  + IGVCYGR+ NNLP+    + LY + GI  +R+Y+P+     ALRGSNI++++
Sbjct  18    LTAAQTRPIGVCYGRVANNLPSDQEVVNLYHSNGITKMRIYDPNEPTLQALRGSNIELML  77

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              +PN  L AL+N + A  WVQ NI+ + P+V F+YVAVGNE+ P    + + L A++N++
Sbjct  78    GIPNGDLQALSNPSVASSWVQNNILAFTPDVKFRYVAVGNEISPSDEAASFVLPAMQNIY  137

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ +AN +   K STA  + +L ++YPP  G F D A + + PIVQFL Q   PLLANI
Sbjct  138   NAIASANLQAQTKVSTAIQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANI  197

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYF+  GD   ++L +ALF+   +  ++      NLFDA L++ Y+A+EKAG  +V++V
Sbjct  198   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGAPDVEVV  257

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSETGWPSEGG  A+  NA TYYKN+I HV    GT KRPG  IETYLFAMFDEN K   
Sbjct  258   VSETGWPSEGGDAATVDNANTYYKNMINHVSA--GTPKRPGKVIETYLFAMFDENQKGPA  315

Query  992   PNNDQTERHFGLFTPDMMSKYNL  1060
                 +TERHFGLF+P+   KY L
Sbjct  316   ----ETERHFGLFSPNKQPKYKL  334



>ref|XP_004291760.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=346

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 226/335 (67%), Gaps = 16/335 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR G+NLP+ T  I LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAQ  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y L A++N+  A+ AAN +G IK STA  + +LD ++PP +G F   A + + PI+ FL 
Sbjct  137   YLLPAIQNIQNAVTAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLG  196

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVE  781
              N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+E
Sbjct  197   NNGAPLLVNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALE  256

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG  N+ IVVSE+GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFA
Sbjct  257   KAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFA  314

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   MFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  345



>gb|AAR06588.1| beta-1,3-glucanase [Vitis riparia]
Length=344

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 231/327 (71%), Gaps = 20/327 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G QSIGVCYG  G+NLP+A+  I LYK+ GI  +R+Y+P+++   AL+GS I++I+DVPN
Sbjct  26    GAQSIGVCYGTNGDNLPSASQVINLYKSNGIGSMRIYDPNSDTLQALKGSGIELILDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYA---LAALKNVH  469
               L +LA + + A  WVQ N+V Y  +V F+Y+A GNEV P  + + YA   L A+KNV 
Sbjct  86    TSLQSLASDASDASTWVQNNVVNYASDVKFRYIAAGNEVLPTGSNAQYAQYVLPAMKNVQ  145

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A+ +A  +G IK STATYS VL  +YPP  G F  +  + + PI+ FLA+N  PLLANI
Sbjct  146   SAITSAGLQGQIKVSTATYSSVLGTSYPPSAGSFSSDVSSFINPIISFLAENGSPLLANI  205

Query  647   YPYFARTGDPDHVQLPFALFS--EV----NSYSEENNLFDAMLESFYAAVEKAGGSNVQI  808
             YPYF+ TG+   +QL +ALF+  EV     SY +  NLFDA+L++ YAA+ KAGGSN++I
Sbjct  206   YPYFSYTGNTQSIQLDYALFTSPEVVVKDGSY-QYQNLFDALLDALYAALGKAGGSNLKI  264

Query  809   VVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTV  988
             VVSE+GWPSEGG  A+  NA TYYKNLI HV+G  GT ++ G+ IETYLFAMFDEN KT 
Sbjct  265   VVSESGWPSEGGTAATVDNARTYYKNLINHVKG--GTPRKSGA-IETYLFAMFDENQKT-  320

Query  989   KPNNDQTERHFGLFTPDMMSKYNLSFN  1069
                  +TE+HFGLFTP   SKY +SF+
Sbjct  321   ---GLETEKHFGLFTPSQESKYQISFS  344



>dbj|BAC66141.1| beta-1,3-glucanase [Fragaria x ananassa]
 dbj|BAC66184.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 226/335 (67%), Gaps = 16/335 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR G+NLP+ T  I LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAQ  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y L A++N+  A+ AAN +G IK STA  + +LD ++PP +G F   A + + PI+ FL 
Sbjct  137   YLLPAIQNIQNAVKAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLG  196

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVE  781
              N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+E
Sbjct  197   NNGAPLLVNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALE  256

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG  N+ IVVSE+GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFA
Sbjct  257   KAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFA  314

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   MFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  345



>ref|XP_004142554.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Cucumis sativus]
 gb|KGN66700.1| hypothetical protein Csa_1G660200 [Cucumis sativus]
Length=336

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 214/330 (65%), Gaps = 14/330 (4%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LL+  LH+   Q IGVCYG++GNNLP  T  +TL+    I+ +RLY+P+    DALRGS 
Sbjct  15    LLVPNLHLTNAQ-IGVCYGQMGNNLPPQTEVVTLFNQNNIKRMRLYDPNRGSLDALRGSP  73

Query  278   IDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++++ VPN  L  +A+    A  WVQ N+  YPNV F+Y+AVGNEV P  + + + + A
Sbjct  74    IELMLGVPNSDLQRIASSQTEANAWVQNNVKNYPNVRFRYIAVGNEVQPSSSAASFVVPA  133

Query  455   LKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             + N+  AL  A  G IK STA  + ++  +YPP  G  K+E   LM PI++FL  N  PL
Sbjct  134   MVNIQTALNNAGLGKIKVSTAVATSIMADSYPPSRGTIKNEVMPLMNPIIRFLNNNRSPL  193

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSN  799
             L N+YPYF+  G+P  ++L +ALF+  ++   +      NLFDAML++ YAA+EK GG N
Sbjct  194   LLNLYPYFSYIGNPRDIRLDYALFTAPSTVVNDGQYLYQNLFDAMLDALYAALEKVGGGN  253

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             ++IV+SE+GWPS GG   S  NA TY  NLIQHV+   GT +RPG   ETY+FAMFDEN 
Sbjct  254   LEIVISESGWPSAGGTATSINNARTYINNLIQHVK--RGTPRRPGRPTETYIFAMFDENK  311

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             K+      + E+HFGLF P+  SKY ++FN
Sbjct  312   KS-----PELEKHFGLFFPNKQSKYPINFN  336



>ref|XP_006480384.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=378

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 214/323 (66%), Gaps = 13/323 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L  A  + IGVCYGR+ NNLP+    + LY + GI  +R+Y+P+     ALRGSNI++++
Sbjct  60    LTAAQTRPIGVCYGRVANNLPSDQEVVNLYHSNGITKMRIYDPNEPTLQALRGSNIELML  119

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              +PN  L AL+N + A  WVQ NI+ + P+V F+YVAVGNE+ P    + + L A++N++
Sbjct  120   GIPNGDLQALSNPSVASSWVQNNILAFTPDVKFRYVAVGNEISPSDEAASFVLPAMQNIY  179

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ +AN +   K STA  + +L ++YPP  G F D A + + PIVQFL Q   PLLANI
Sbjct  180   NAIASANLQAQTKVSTAIQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANI  239

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYF+  GD   ++L +ALF+   +  ++      NLFDA L++ Y+A+EKAG  +V++V
Sbjct  240   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGAPDVEVV  299

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSETGWPSEGG  A+  NA TYYKN+I HV    GT KRPG  IETYLFAMFDEN K   
Sbjct  300   VSETGWPSEGGDAATVDNANTYYKNMINHVSA--GTPKRPGKVIETYLFAMFDENQKGPA  357

Query  992   PNNDQTERHFGLFTPDMMSKYNL  1060
                 +TERHFGLF+P+   KY L
Sbjct  358   ----ETERHFGLFSPNKQPKYKL  376



>emb|CAH17549.1| beta-1,3-glucanase [Olea europaea]
Length=343

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 217/339 (64%), Gaps = 21/339 (6%)
 Frame = +2

Query  95    LLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             + L+G L +A     V   GVCYGR+GN LP     + LYK  GIR +R+Y+P      A
Sbjct  12    MALVGLLILAILDFTVAQTGVCYGRLGNALPPPPEVVALYKQNGIRRMRIYDPYQPTLQA  71

Query  263   LRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGS-  436
             L GSNI++++ VPN  L  LA N N A  WVQ N+  YPNV FKY+AVGNEV P K+ + 
Sbjct  72    LGGSNIELMLGVPNSDLQRLAANQNNANTWVQNNVRKYPNVRFKYIAVGNEVSPLKSVTS  131

Query  437   ---DYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
                 Y L A++N+  A+ AA  G  IK ST+  +GVL ++YPP  GVF+ E +  +  I+
Sbjct  132   QFVQYVLPAMRNIQTAISAAGLGNQIKVSTSIETGVLGNSYPPSAGVFRSEVQQYLGGII  191

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYA  772
             QFL  N  PLL NIYPYF+R G+P  + L +ALF+     + +     NLFDA+L++ YA
Sbjct  192   QFLVNNRAPLLVNIYPYFSRVGNPQQISLQYALFTSSGIVTPDGTRYQNLFDALLDAVYA  251

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAGGS+V+IVVSE+GWPS GG D S  NA TY  NL++ ++   GT KRPG  IETY
Sbjct  252   ALEKAGGSSVEIVVSESGWPSAGGQDTSIDNARTYNTNLVKSIK--TGTPKRPGRAIETY  309

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             +FAMFDEN K+      + E+ FGLF P+   KY +SFN
Sbjct  310   IFAMFDENQKS-----PEYEKFFGLFRPNKQPKYPISFN  343



>gb|KDP22122.1| hypothetical protein JCGZ_25953 [Jatropha curcas]
Length=333

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 215/330 (65%), Gaps = 14/330 (4%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LLI  L +   QSIGVCYG  GNNLP     + LYK+ GI  +R+Y PD     AL+GSN
Sbjct  10    LLISLLGVIDAQSIGVCYGMNGNNLPPQQEVVDLYKSNGIGRMRIYHPDEATLQALKGSN  69

Query  278   IDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++++ VPND L  +++ +AA  WVQ NIV Y  +V F+YV+VGNEV+PG   +++ L A
Sbjct  70    IELMLAVPNDKLQEVSDASAATTWVQNNIVAYASDVKFRYVSVGNEVHPGDGNANFVLPA  129

Query  455   LKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLP  631
             ++NV  A+ +A  +  IK STA  + ++  ++PP +G+F D A   + PI+ FL +N  P
Sbjct  130   MQNVQNAIASAGLQNQIKVSTAIDTTLIGKSFPPSDGIFSDSASGYIKPIIDFLVKNGAP  189

Query  632   LLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGS  796
             LL N+YPYF+   +   V L +ALF+      ++      NLFDA+L+S YAA+EK+GG 
Sbjct  190   LLVNVYPYFSHINNKQDVSLEYALFTSPGVVVQDGQYGYQNLFDALLDSVYAALEKSGGG  249

Query  797   NVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDEN  976
             ++QIVVSE+GWPSEGG  A+  NA TYYKNLI HV+   GT K+ G  IETYLFA+FDEN
Sbjct  250   SLQIVVSESGWPSEGGDAATPDNAGTYYKNLISHVK--QGTPKKAGQAIETYLFALFDEN  307

Query  977   NKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
              K         E+HFG+F P+   KY +SF
Sbjct  308   QKEAG-----IEQHFGVFLPNKQPKYQISF  332



>ref|XP_008811757.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Phoenix 
dactylifera]
Length=346

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 224/338 (66%), Gaps = 18/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFL--HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +  I L++GFL    + VQSIGVCYG +GNNLP  +  + LYK+  I+ +RLY P+    
Sbjct  9     MVVIALVLGFLIETPSSVQSIGVCYGMVGNNLPQPSDVVNLYKSENIKAMRLYGPNQAAL  68

Query  257   DALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
             DAL+GSNI +I+D PN D+    +N  AA  WVQ+N+  Y P+V+FKY+AVGNEV PG  
Sbjct  69    DALKGSNIQLILDFPNPDLKSVASNPAAANDWVQKNVRAYYPDVSFKYIAVGNEVIPGDH  128

Query  431   GSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A++N+ +AL LA  +  IK STA  +GVL  +YPP  G F   A N + PIV 
Sbjct  129   -AQYVLPAMRNIFSALSLAGLQNQIKVSTAVSTGVLGASYPPSAGEFSSNALNYLRPIVH  187

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA N  PLL N+YPYF+  G+P+ +++ FALF+ + ++  +      NLFDA +++ Y+
Sbjct  188   FLAGNGAPLLVNVYPYFSYVGNPNSIKIEFALFTSLGTFVMDGQHRYQNLFDATVDAVYS  247

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAGGSNV IVVSE+GWPS GG  AS  NA+ Y +NLI+HV   HGT KRPG  IET+
Sbjct  248   ALEKAGGSNVAIVVSESGWPSAGGTAASINNAQIYNQNLIRHV--GHGTPKRPGRAIETF  305

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMF+EN K         E++FGLF P+    Y ++F
Sbjct  306   LFAMFNENQKP-----QGIEKNFGLFYPNKQPVYPINF  338



>ref|XP_010045033.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=339

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 208/324 (64%), Gaps = 14/324 (4%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
              + G QSIGVCYGR G+NLP+    I LYK   I  +R+Y+PD     AL+GSNI++I+ 
Sbjct  22    ELTGAQSIGVCYGRNGDNLPSQAEVIELYKANSIGRMRIYDPDQATLQALKGSNIELILG  81

Query  296   VPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHA  472
             V ND L AL +  AA  WVQ N+V +  +V  KY+AVGNEV PG T + Y L A++N+  
Sbjct  82    VLNDNLQALTDPAAASNWVQNNVVAFSSDVKIKYIAVGNEVPPGDTKAQYVLPAMQNIQN  141

Query  473   ALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIY  649
             AL +AN +G IK STA  S +L  +YPP +G F D A   + PI+ FL  N  PLLANIY
Sbjct  142   ALASANLQGQIKVSTAIDSSLLAVSYPPSSGAFSDPANQFISPIISFLVNNGSPLLANIY  201

Query  650   PYFARTGDPDHVQLPFALFSE-----VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             PY +   +   + L +ALF+       +   +  NLFDA+++S Y+A+EKAGGS++ IVV
Sbjct  202   PYVSYVQNMQSIDLAYALFTSPGVVVTDGSYQYQNLFDALVDSLYSALEKAGGSSLPIVV  261

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEGG  AS  NA TYY NLI HV+   GT K+ G  IE YLFAMFDEN K    
Sbjct  262   SESGWPSEGGTAASPENAGTYYANLISHVK--QGTPKKAGQAIEAYLFAMFDENLKAAG-  318

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
                 TE+HFGLFTP    KY +SF
Sbjct  319   ----TEQHFGLFTPSKQPKYQISF  338



>ref|XP_007015119.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32738.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=352

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 223/344 (65%), Gaps = 22/344 (6%)
 Frame = +2

Query  83    IAAILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A + LL+G     L   G +S+GVCYGRIG+NLP+    + LYK  GI  +R+Y+P+  
Sbjct  14    MAVMFLLLGIFMSSLEFTGAKSVGVCYGRIGDNLPSEQEVLELYKASGIEKMRIYDPNQA  73

Query  251   VFDAL-RGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP  421
                AL    +I++I+ VPN  L ALA + ++A  WVQRNI+PY P  N +Y++VGNEV P
Sbjct  74    TLRALGMFPDIELILGVPNGDLEALATDASSATDWVQRNILPYAPAANIRYISVGNEVRP  133

Query  422   GKTGSDYALAALKNVHAALLAANRG----GIKASTATYSGVLDHTYPPENGVFKDEAKNL  589
                 + + L A++N+  AL +AN       IK ST+  + +L  +YPP  G F D A + 
Sbjct  134   MDPAAQFVLPAMQNICNALESANNAMEVLQIKVSTSVDATLLGSSYPPSAGAFSDSASSY  193

Query  590   MYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAM  754
             + PIVQFLA    PLLANIYPYF+  GDP  + L +ALF+      ++      NLFDA+
Sbjct  194   IIPIVQFLADKGAPLLANIYPYFSYIGDPTSIDLNYALFTSPGVVVQDGAFGYQNLFDAI  253

Query  755   LESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPG  934
             L++FY+A+EKAG SN+++VVSETGWPS+GG  A+  NA TYY+NLI H++  +GT KRPG
Sbjct  254   LDAFYSAIEKAGFSNMEVVVSETGWPSDGGTAATIENASTYYQNLINHIQ--NGTPKRPG  311

Query  935   SHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
                +TY FAMFDEN K       +TERHFGLF+PD   KY +SF
Sbjct  312   QPTQTYRFAMFDENQK----GPAETERHFGLFSPDKQPKYPISF  351



>gb|AES89518.2| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=421

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 215/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  116   HIAGVQ----SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNID  283
             HI+ V     +IGVCYG +GNNLP+    + LYK+ GI  +R+Y PD  V  ALRGSNI+
Sbjct  86    HISQVSVTFSTIGVCYGVLGNNLPSKQEVVDLYKSKGIGKMRIYYPDQEVLQALRGSNIE  145

Query  284   VIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALK  460
             +I+ V  + L +L +   A  WVQ+ + PY  +V  KY+ VGNE+ P    + Y   A++
Sbjct  146   LILGVTKETLSSLTDAGEATNWVQKYVTPYAQDVKIKYITVGNEIKPNDNEAQYIATAMQ  205

Query  461   NVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLL  637
             N+  A+ +AN +G IK STA    ++ ++YPP  GVF D+A + + PI+ FL +N  PLL
Sbjct  206   NIQNAISSANLQGQIKVSTAIDMTLIGNSYPPNAGVFTDQANSYIQPIINFLVKNGAPLL  265

Query  638   ANIYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             AN+YPYFA  G+   + L + LF +  N+    NN+FDAML+S YAA+EK GGSNV+IVV
Sbjct  266   ANVYPYFAYIGNKQSISLDYVLFKQQGNNEVGYNNIFDAMLDSVYAALEKVGGSNVKIVV  325

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPS+GG  AS  NA TYY NLI H++  +GT KRPG+ IETYLFAMFDEN KT   
Sbjct  326   SESGWPSKGGDSASIDNAATYYSNLINHIK--NGTPKRPGAAIETYLFAMFDENQKT---  380

Query  995   NNDQTERHFGLFTPDMMSKYNLS  1063
                 TE+H+GLF PD   KY+++
Sbjct  381   -GATTEQHYGLFNPDKSPKYHVA  402



>gb|KDO61190.1| hypothetical protein CISIN_1g048190mg [Citrus sinensis]
Length=336

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 217/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L  A  + IGVCYGR+ NNLP+    + LY   GI  +R+Y+P+     ALRGSNI++++
Sbjct  18    LTAAQTRPIGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELML  77

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              V N  + AL++ +AA  WVQ NI+ + P+V F+Y+AVGNE+ P    + + L A++N++
Sbjct  78    GVANGDIQALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSDQAASFVLPAMQNIY  137

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+++AN +  IK STA  + +L ++YPP  G F D+A + + PIVQFL Q   PLLAN+
Sbjct  138   NAIVSANLQDQIKVSTAIQTSLLGNSYPPSAGSFADDANSYIGPIVQFLKQTGAPLLANV  197

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYF+  GD   ++L +ALF+   +  ++      NLFDA L++ Y+A+EKAG  ++++V
Sbjct  198   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVV  257

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSETGWPSEGG  A+  NA TYYKN+I HV    GT KRPG  IETYLFAMFDEN K   
Sbjct  258   VSETGWPSEGGEAATVDNASTYYKNVINHVSA--GTPKRPGKVIETYLFAMFDENQKGPA  315

Query  992   PNNDQTERHFGLFTPDMMSKYNL  1060
                 +TERHFGLF+P+  SKY L
Sbjct  316   ----ETERHFGLFSPNKQSKYEL  334



>dbj|BAC66185.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 225/335 (67%), Gaps = 16/335 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR G+NLP+ T  I LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAQ  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y L A++N+  A+ AAN +  IK STA  + +LD ++PP +G F   A + + PI+ FL 
Sbjct  137   YLLPAIQNIQNAVKAANLQSQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLG  196

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVE  781
              N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+E
Sbjct  197   NNGAPLLVNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALE  256

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG  N+ IVVSE+GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFA
Sbjct  257   KAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFA  314

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   MFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  345



>gb|AAX81589.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=320

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 220/325 (68%), Gaps = 13/325 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             + I+G QS GVCYGR G+NLP+ T  + LYK+ GI  +R+YEP+    +ALRGSNI+++V
Sbjct  1     MLISGAQSAGVCYGRNGDNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEALRGSNIELMV  60

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + Y L A++N+ 
Sbjct  61    TILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAQYLLPAIQNIQ  120

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ AAN +G IK STA  + +LD ++PP +G F   A + + PI+ FL  N  PLL NI
Sbjct  121   NAVTAANLQGQIKVSTAVDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLLVNI  180

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+EKAG SN+ IV
Sbjct  181   YPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGASNMAIV  240

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFAMFDEN K   
Sbjct  241   VSEGGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLK---  295

Query  992   PNNDQTERHFGLFTPDMMSKYNLSF  1066
              +  + E HFG+F+P+   KY L+F
Sbjct  296   -DGAEIENHFGIFSPNKQPKYQLTF  319



>dbj|BAC66186.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 225/335 (67%), Gaps = 16/335 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR G+NLP+ T  I LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAQ  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             Y L A++N+  A+ AAN +  IK STA  + +LD ++PP +G F   A + + PI+ FL 
Sbjct  137   YLLPAIQNIQNAVKAANLQSQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLG  196

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVE  781
              N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+E
Sbjct  197   NNGAPLLVNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALE  256

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG  N+ IVVSE+GWPSEG   A++GNA TYY NLI HV+   GT KRP   IETYLFA
Sbjct  257   KAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFA  314

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   MFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  345



>ref|XP_010063513.1| PREDICTED: lichenase [Eucalyptus grandis]
Length=369

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 220/335 (66%), Gaps = 19/335 (6%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LLI     AGVQSIGVCYG +GNNLP+A+  + LYK+ GI  +RLY+P      ALRGSN
Sbjct  22    LLIASFCTAGVQSIGVCYGMLGNNLPSASEVVALYKSRGITQMRLYDPSQAALQALRGSN  81

Query  278   IDVIVDVPNDMLPALANFNA-AYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS----D  439
             I++I+ VPN  L ALA+  A A  WVQRN+  Y P V F+Y+AVGNEV P   G+     
Sbjct  82    IELILGVPNSELQALASNPANANSWVQRNVKNYSPGVRFRYIAVGNEVSPVNGGTAQFAR  141

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             + L A++N+ AAL ++  +  IK STA    ++ ++YPP  G F+ + ++ + PI+ FL 
Sbjct  142   FVLPAMRNIQAALRSSGLQNQIKVSTAIDMTLIGNSYPPSQGAFRGDVRSYLDPIISFLV  201

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSE-----VNSYSEENNLFDAMLESFYAAVE  781
              NN PLLANIY YF+  G+P  + LP+ALF+       +   E  NLFDAML++ Y+A+E
Sbjct  202   SNNSPLLANIYTYFSYVGNPKDISLPYALFTSPSVVVRDGAHEYRNLFDAMLDALYSALE  261

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             +AGG+ +++VVSE+GWPS G   A+  NA TY  NLI+HV+G  GT KRP   IETY+FA
Sbjct  262   RAGGAALRVVVSESGWPSAGAFAATVDNARTYNGNLIKHVKG--GTPKRPNGAIETYIFA  319

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +FDEN K       + E+HFGLF P+   KY LSF
Sbjct  320   LFDENQK-----QPELEKHFGLFFPNKQPKYPLSF  349



>ref|XP_006446183.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
 gb|ESR59423.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
Length=316

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 215/320 (67%), Gaps = 13/320 (4%)
 Frame = +2

Query  122   AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVP  301
             A  + IGVCYGR+ NNLP+    + LY   GI  +R+Y+P+     ALRGSNI++++ V 
Sbjct  1     AQTRPIGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELMLGVA  60

Query  302   NDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
             N  + AL++ +AA  WVQ NI+ + P+V F+Y+AVGNE+ P    + + L A++N++ A+
Sbjct  61    NGDIQALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSDQAASFVLPAMQNIYNAI  120

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
             ++AN +  IK STA  + +L ++YPP  G F D A + + PIVQFL Q   PLLAN+YPY
Sbjct  121   VSANLQDQIKVSTAMQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANVYPY  180

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             F+  GD   ++L +ALF+   +  ++      NLFDA L++ Y+A+EKAG  ++++VVSE
Sbjct  181   FSYIGDTKDIRLDYALFTSQGTLVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVVVSE  240

Query  821   TGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             TGWPSEGG  A+  NA TYYKN+I HV    GT KRPG  IETYLFAMFDEN K      
Sbjct  241   TGWPSEGGEAATVDNASTYYKNVINHVSA--GTPKRPGKVIETYLFAMFDENQKGPA---  295

Query  1001  DQTERHFGLFTPDMMSKYNL  1060
              +TERHFGLF+P+  SKY L
Sbjct  296   -ETERHFGLFSPNKQSKYEL  314



>ref|XP_006470762.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=347

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 217/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L  A  + IGVCYGR+ NNLP+    + LY   GI  +R+Y+P+     ALRGSNI++++
Sbjct  29    LTAAQTRPIGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELML  88

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              V N  + AL++ +AA  WVQ NI+ + P+V F+Y+AVGNE+ P    + + L A++N++
Sbjct  89    GVANGDIQALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSDQAASFVLPAMQNIY  148

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+++AN +  IK STA  + +L ++YPP  G F D+A + + PIVQFL Q   PLLAN+
Sbjct  149   NAIVSANLQDQIKVSTAIQTSLLGNSYPPSAGSFADDANSYIGPIVQFLKQTGAPLLANV  208

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYF+  GD   ++L +ALF+   +  ++      NLFDA L++ Y+A+EKAG  ++++V
Sbjct  209   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVV  268

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSETGWPSEGG  A+  NA TYYKN+I HV    GT KRPG  IETYLFAMFDEN K   
Sbjct  269   VSETGWPSEGGEAATVDNASTYYKNVINHVSA--GTPKRPGKVIETYLFAMFDENQKGPA  326

Query  992   PNNDQTERHFGLFTPDMMSKYNL  1060
                 +TERHFGLF+P+  SKY L
Sbjct  327   ----ETERHFGLFSPNKQSKYEL  345



>gb|KHN05500.1| Glucan endo-1,3-beta-glucosidase, partial [Glycine soja]
Length=316

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 211/321 (66%), Gaps = 10/321 (3%)
 Frame = +2

Query  122   AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVP  301
             A  QSIGVCYG +GNNLP+    + LYK  GI  +R+Y PD     ALRGS I++I+DV 
Sbjct  1     AVAQSIGVCYGVLGNNLPSRQEVVDLYKTNGIGRMRIYYPDEEALQALRGSGIELIMDVA  60

Query  302   NDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
              + L ++ + NAA  WV + +  Y  +VNFKY+AVGNE++P    + Y L+A+ N+  A+
Sbjct  61    KETLQSMTDPNAATDWVNKYVTAYSQDVNFKYIAVGNEIHPNTNEAQYILSAMTNIQNAI  120

Query  479   LAANRGGIKASTATYSG-VLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +AN   IK STA  S  +   +YPP + VF  +A+  + PI+ FL +N  PLLAN+YPY
Sbjct  121   SSANL-QIKVSTAIDSTFIAPPSYPPNDAVFTSDAEPYVKPIIDFLVRNEAPLLANVYPY  179

Query  656   FARTGDPDH-VQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSETGW  829
             FA   D  + + L +ALF++  N+ +   NLFDAML+S YAAVEK G SN+QIVVSE+GW
Sbjct  180   FAYANDQQNSIPLAYALFTQQGNNDAGYQNLFDAMLDSIYAAVEKVGASNLQIVVSESGW  239

Query  830   PSE-GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             PSE GG  AS  NA TY  NLI H  G  GT KRPG  IETYLFAMFDEN K     + +
Sbjct  240   PSEGGGTGASIDNAGTYNANLISHASGGSGTPKRPGGSIETYLFAMFDENQK----QDAE  295

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
             TERHFGLF PD   KY L+FN
Sbjct  296   TERHFGLFRPDKSPKYQLNFN  316



>ref|XP_004171028.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like, 
partial [Cucumis sativus]
Length=312

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 207/317 (65%), Gaps = 13/317 (4%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             IGVCYG++GNNLP  T  +TL+    I+ +RLY+P+    DALRGS I++++ VPN  L 
Sbjct  3     IGVCYGQMGNNLPPQTEVVTLFNQNNIKRMRLYDPNRGSLDALRGSPIELMLGVPNSDLQ  62

Query  317   ALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAANR  493
              +A+    A  WVQ N+  YPNV F+Y+AVGNEV P  + + + + A+ N+  AL  A  
Sbjct  63    RIASSQTEANAWVQNNVKNYPNVRFRYIAVGNEVQPSSSAASFVVPAMVNIQTALNNAGL  122

Query  494   GGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTGD  673
             G IK STA  + ++  +YPP  G  K+E   LM PI++FL  N  PLL N+YPYF+  G+
Sbjct  123   GKIKVSTAVATSIMADSYPPSRGTIKNEVMPLMNPIIRFLNNNRSPLLLNLYPYFSYIGN  182

Query  674   PDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPSE  838
             P  ++L +ALF+  ++   +      NLFDAML++ YAA+EK GG N++IV+SE+GWPS 
Sbjct  183   PRDIRLDYALFTAPSTVVNDGQYLYQNLFDAMLDALYAALEKVGGGNLEIVISESGWPSA  242

Query  839   GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTERH  1018
             GG   S  NA TY  NLIQHV+   GT +RPG   ETY+FAMFDEN K+      + E+H
Sbjct  243   GGTATSINNARTYINNLIQHVK--RGTPRRPGRPTETYIFAMFDENKKS-----PELEKH  295

Query  1019  FGLFTPDMMSKYNLSFN  1069
             FGLF P+  SKY ++FN
Sbjct  296   FGLFFPNKQSKYPINFN  312



>ref|XP_004232306.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Solanum lycopersicum]
Length=345

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 222/331 (67%), Gaps = 12/331 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +A  +LL+  L I GV S+GVCYGR+ +NLP+    +      GI  +R+Y PDTNV++A
Sbjct  17    VALFILLMCGLQITGVYSVGVCYGRMADNLPSEYDVVNHCHANGINKIRIYYPDTNVYNA  76

Query  263   LRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTG-  433
             LRGSNI+V+VDVPN+ +  LA + N A  WV  NI  Y P+V F+Y+AVGNE+ P K   
Sbjct  77    LRGSNIEVLVDVPNEHVKTLAQDPNQARNWVNNNIKAYFPSVKFRYIAVGNEISPIKNVQ  136

Query  434   -SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + +   A++NVH A++ A  +  IK STATYS +L +T+PP+N +F  + +    PIV+
Sbjct  137   LATFVGPAIENVHNAIVEAGLQDQIKVSTATYSALLTNTWPPQNSMFNPDWRGFTDPIVK  196

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEK  784
              L  NNLPLL NIYPYF+   +   + L +ALF++  + S    NLFDA+++S Y A+EK
Sbjct  197   LLRDNNLPLLVNIYPYFSYIYNTKDIPLSYALFTDSGTNSAGYQNLFDALVDSMYYALEK  256

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             +G  NV+IVVSETGWPS G P A+  NA TYY N+I HV GN GT K+PG  IET+LFAM
Sbjct  257   SGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNVINHV-GN-GTPKKPGREIETFLFAM  314

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYN  1057
             FDE  K      D+TERHFGLF PD  SKY+
Sbjct  315   FDERGK----GGDETERHFGLFYPDRNSKYD  341



>ref|XP_004505795.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=339

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 213/334 (64%), Gaps = 12/334 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHI----AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             I  +LLL  F+ +       QS+GVCYG + NNLP A   I L+K  GI  +R+Y PD  
Sbjct  7     IGVLLLLHVFIGLETSKTAAQSVGVCYGIVANNLPPAAEVIDLFKTNGIARMRIYNPDQA  66

Query  251   VFDALRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPG  424
               +ALRGSNI++++ +PN+ + ++AN  ++A  WVQ NI+ Y N V F+Y+ VGNE+ P 
Sbjct  67    TLEALRGSNIELVIGIPNEDMQSIANDVSSATSWVQNNIINYSNNVIFRYIVVGNEINPS  126

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
                S + L A++N++AAL  A+ +  IK STA   G+L  +YPP  G F  +A   + PI
Sbjct  127   DPTSQFVLPAMQNIYAALATADLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPI  186

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAV  778
             V FL  N  PLLAN+YPYFA  G+   + L +ALF++  +      NLFDAML++ YAA 
Sbjct  187   VNFLVTNGAPLLANVYPYFAYIGNEQDIPLEYALFTKQGTTDIGYQNLFDAMLDALYAAA  246

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
              K G SN+QIVVSE+GWPS GG  A+  NA  YY NLI HV   +GT  RPG  IETYLF
Sbjct  247   LKIGASNLQIVVSESGWPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNL  1060
             AMFDEN K        TE++FGLFTPD + KYN+
Sbjct  307   AMFDENQKP----GAATEQYFGLFTPDKLQKYNI  336



>ref|XP_008356363.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 215/324 (66%), Gaps = 12/324 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYGR GNNLP     + LYK+ GI  +R+YEP+     ALRGSNI++ V
Sbjct  29    LQITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTV  88

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              + N  LPAL +  AA  WVQ+N+ PY  +V FKY+AVGNE++         L A++N+H
Sbjct  89    TILNSELPALNDAAAATAWVQKNVQPYSADVRFKYIAVGNEIHHXSAEVGSLLPAIQNIH  148

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A++AAN +G IK STA  + ++ + +PP +GV+ D A   + P++ FL  +  PLL N+
Sbjct  149   SAIVAANLQGQIKVSTAIDTTLVANPFPPSDGVY-DAANQFIXPVIDFLVSSGAPLLVNV  207

Query  647   YPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPYF+   +P  + L +ALF+     V   +   +LFDA+L++ YAA+EKAG  N++IVV
Sbjct  208   YPYFSYXDNPS-IDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNMEIVV  266

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEGG  A+  NA T+Y+NLI HV    GT KRPG  IETYLFAMFDEN K  KP
Sbjct  267   SESGWPSEGGDQATPQNAATFYQNLINHVTSTTGTPKRPGKAIETYLFAMFDENLKDGKP  326

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
                  E+HFG+F+P+   KY L+F
Sbjct  327   ----VEKHFGVFSPNKQPKYQLTF  346



>gb|AAO16642.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=347

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 223/336 (66%), Gaps = 17/336 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR GNNLP+ T  + LYK+ GI  +R+YEP+    +A
Sbjct  17    LLLLVLFMPALQITGAQSAGVCYGRNGNNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEA  76

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  77    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAK  136

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYP-PENGVFKDEAKNLMYPIVQFL  613
             Y L A++N+  A+ AAN +G IK STA  +  L   +  P NG F D A + + PI+ FL
Sbjct  137   YLLPAIQNIQNAVTAANLQGQIKVSTAIDTTFLPPDFVLPSNGAFSDAANSFITPIITFL  196

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
             + N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+
Sbjct  197   SNNGAPLLVNIYPYFAYIGDPVNIKLEYALFTSPGVELQDGSNGYQNIFDALLDTHYSAL  256

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  N+ IVVSE+GWPSEGG  A+ GNA TYY  LI HV+   GT KRP   IETYLF
Sbjct  257   EKAGAPNMAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK--TGTPKRPNGAIETYLF  314

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  315   AMFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  346



>ref|XP_004297245.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 223/336 (66%), Gaps = 17/336 (5%)
 Frame = +2

Query  92    ILLLIGF---LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +LLL+ F   L I G QS GVCYGR GNNLP+ T  + LYK+ GI  +R+YEP+    +A
Sbjct  5     LLLLVLFMPALQITGAQSAGVCYGRNGNNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEA  64

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSD  439
             LRGSNI+++V + N+ L AL +  AA  WVQ+N+ PY  +V FKY+AVGNEV+P    + 
Sbjct  65    LRGSNIELMVTILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPDAAEAK  124

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYP-PENGVFKDEAKNLMYPIVQFL  613
             Y L A++N+  A+ AAN +G IK STA  +  L   +  P NG F D A + + PI+ FL
Sbjct  125   YLLPAIQNIQNAVTAANLQGQIKVSTAIDTTFLLPDFVLPSNGAFSDAANSFITPIITFL  184

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
             + N  PLL NIYPYFA  GDP +++L +ALF+      ++      N+FDA+L++ Y+A+
Sbjct  185   SNNGAPLLVNIYPYFAYIGDPVNIKLEYALFTSPGVELQDGSNGYQNIFDALLDTHYSAL  244

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  N+ IVVSE+GWPSEGG  A+ GNA TYY  LI HV+   GT KRP   IETYLF
Sbjct  245   EKAGAPNMAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK--TGTPKRPNGAIETYLF  302

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K    +  + E+HFG+F+P+   KY L+F
Sbjct  303   AMFDENLK----DGAEVEKHFGIFSPNKQPKYQLTF  334



>gb|AAF44667.2|AF239617_1 beta-1,3-glucanase [Vitis vinifera]
Length=360

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 219/330 (66%), Gaps = 19/330 (6%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
              I GV+S+GVCYG +GNNLP A+  + LYK+  I  +R+Y+P+     ALRGSNI +++ 
Sbjct  16    QITGVKSVGVCYGMLGNNLPPASQVVALYKSRNIDRMRIYDPNQAALQALRGSNIQLMLG  75

Query  296   VPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS----DYALAAL  457
             VPN  L  LA N + A  WVQRN+  Y P V+F+Y+AVGNEV P   G+     + L A+
Sbjct  76    VPNSDLQGLATNPSQAQSWVQRNVRNYWPGVSFRYIAVGNEVSPVNGGTSRFAQFVLPAM  135

Query  458   KNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N+ AAL +A  +  +K STA    +L ++YPP  G F+ + +  + PI++FL  N  PL
Sbjct  136   RNIRAALASAGLQDRVKVSTAIDLTLLGNSYPPSQGAFRGDVRGYLDPIIRFLVDNKSPL  195

Query  635   LANIYPYFARTGDPDHVQLPFALFSE-----VNSYSEENNLFDAMLESFYAAVEKAGGSN  799
             LANIYPYF+ +G+P  + LP+ALF+       +      NLFDAML++ Y+A+E+AGG++
Sbjct  196   LANIYPYFSYSGNPKDISLPYALFTANSVVVWDGQRGYKNLFDAMLDALYSALERAGGAS  255

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             +++V+SE+GWPS GG   +  NA TY  NLI+HV+G  GT KRPG  IETYLFAMFDEN 
Sbjct  256   LEVVLSESGWPSAGGFGTTVDNARTYNSNLIRHVKG--GTPKRPGRAIETYLFAMFDENK  313

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             K       Q E+HFGLF P+   KY+++F+
Sbjct  314   K-----EPQLEKHFGLFFPNKQPKYSINFS  338



>ref|XP_003548789.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=331

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 207/334 (62%), Gaps = 15/334 (4%)
 Frame = +2

Query  83    IAAILLLIGFLH--------IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYE  238
             ++ ILLL+G L          A  Q +G+CYG  GNNLP+    + LYK+ GI  +R+Y 
Sbjct  3     VSTILLLVGILSSIRVLEFTAAQTQVVGICYGVNGNNLPSKQEVVDLYKSKGISRMRIYS  62

Query  239   PDTNVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEV  415
             PD     ALRGSNI++ +DV  + L +L + N A  WV R +  Y  +VNFKY+ VGNEV
Sbjct  63    PDEETLQALRGSNIELTMDVAGETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEV  122

Query  416   YPGKTGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
             +P    + Y L A+ N+  A+ +AN    K STA  + +L ++YPP NGVF  +A   + 
Sbjct  123   HPNYDVAPYILPAMTNIQNAISSANLQ-TKVSTAIDATLLTNSYPPNNGVFTADASPYIG  181

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYA  772
             PI+ FL +N  PLLAN+YPYFA   D   + LP+ALF++  +      NLFDAML+S YA
Sbjct  182   PIINFLVKNGAPLLANVYPYFAYVNDQQDINLPYALFTQQGTNDIGYQNLFDAMLDSIYA  241

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK G  N++IVVSE+GWPS GG  A   NA  YY NLI H     GT KRPG  I+T+
Sbjct  242   ALEKIGAPNLEIVVSESGWPSAGGDGALVENAHAYYYNLINHANSGSGTPKRPGRPIQTF  301

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKY  1054
             LFAMFDEN K       +TERHFGLF PD  SKY
Sbjct  302   LFAMFDENQKP----GAETERHFGLFNPDKSSKY  331



>ref|XP_004154643.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
isoform 2 [Cucumis sativus]
Length=386

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 215/322 (67%), Gaps = 16/322 (5%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             +SIGVCY   GNNLP+A   + LYKN  I+ +R+Y PDT + +ALRGSNI+VIV +PN  
Sbjct  72    ESIGVCYSSAGNNLPDAREVVQLYKNNSIKKMRIYNPDTTILNALRGSNIEVIVGIPNTY  131

Query  311   LPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAA  487
             +  + N ++A  WVQ+NI  Y P VNF+Y+AVGNEV P    + Y L A+ ++++A+ AA
Sbjct  132   IEHIVNLSSAANWVQKNIQAYVPYVNFRYIAVGNEVKPPDAIAQYVLPAMSSIYSAISAA  191

Query  488   N-RGGIKASTA-TYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             N +  IK ST  + S + + ++PP NG F  EA   M PI++FLA+N  PLLAN+YPYF 
Sbjct  192   NLQDQIKVSTVISMSFLSNSSFPPSNGSFSSEAGGFMEPIIKFLAKNGSPLLANVYPYFV  251

Query  662   RTGDPDHVQLPFALFSEVNSYS------EENNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
              T     + L +ALF +  +        + N+LF++M+++ Y A+EK GG+ V IV+SE+
Sbjct  252   YTEINQTISLDYALFMQSPALVISDGNFKYNSLFESMVDALYVALEKLGGAKVSIVISES  311

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA TYY+NLI  V   +GT +RP   IETYLFAMFDEN K++     
Sbjct  312   GWPSGGGNGATIENAGTYYRNLISFVR--NGTPRRPRRAIETYLFAMFDENLKSL-----  364

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + E+HFGLFTPD  SKY LSF+
Sbjct  365   EMEKHFGLFTPDKKSKYQLSFS  386



>ref|XP_007015136.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32755.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=347

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 223/340 (66%), Gaps = 18/340 (5%)
 Frame = +2

Query  83    IAAILLLIGF-----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             + AI LL+        + AG  SIGVC GRI ++LP+    +  YK  GI  +R+Y+P+ 
Sbjct  13    MVAIFLLLAISMSNGQNTAGAPSIGVCNGRIADDLPSEQDVVNFYKINGIGAMRIYDPNQ  72

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPG  424
                 AL+G+NI +I+ +PN  L +L + +AA  +V+RNIV + P V F+Y++VGNEV P 
Sbjct  73    FTLQALKGTNIQLILGIPNAALQSLTDPSAASDFVKRNIVSFSPAVKFRYISVGNEVKPT  132

Query  425   KTGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
                + + L A++N++ AL++AN +G IK ST+    +L ++YPP  G+F + A+  + PI
Sbjct  133   DPEAQFVLPAMRNIYNALVSANLKGQIKVSTSVEPTLLGNSYPPSAGLFSEAARPYIIPI  192

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             ++FLA N  PLLANIY YF+  GD  ++ L FALF+      ++      NLFDA L+S 
Sbjct  193   IKFLASNGSPLLANIYTYFSYIGDTKNIDLGFALFTSPGVVVQDGPSGYQNLFDATLDSL  252

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             Y+A+EK G +N++IVVSE+GWPS GG  A+  NA TYYKNLI+HV+  +GT KRPG  IE
Sbjct  253   YSALEKIGAANLEIVVSESGWPSAGGTAATVENASTYYKNLIKHVK--NGTPKRPGKPIE  310

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TYLFAMFDEN K       +TERHFGLF+P+   KY + F
Sbjct  311   TYLFAMFDENQK----GPAETERHFGLFSPNKQPKYPIKF  346



>ref|XP_002513528.1| Lichenase precursor, putative [Ricinus communis]
 gb|EEF48931.1| Lichenase precursor, putative [Ricinus communis]
Length=343

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 215/328 (66%), Gaps = 14/328 (4%)
 Frame = +2

Query  104   IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNID  283
             I FL I   QSIG CYG+ GNNLP+    ++LY+   I  +R+Y PD     AL+GSNI+
Sbjct  22    ISFLAITDAQSIGACYGKNGNNLPSEQEVVSLYQANRIGRMRIYHPDQPTLQALKGSNIE  81

Query  284   VIVDVPNDMLPALANFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALK  460
             +I+ VPND L  LA+ +AA  WV+ N+V + + V  +Y+AVGNEV PG + + + L A++
Sbjct  82    LILGVPNDNLRDLADASAATNWVRDNVVAFASEVKIRYIAVGNEVPPGDSNAAFVLPAMQ  141

Query  461   NVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLL  637
             N+  A+++AN +G IK STA  + +L  ++PP +G+F D A + + PI+ FL  N  PLL
Sbjct  142   NIQNAIVSANLQGQIKVSTAIDTTLLGKSFPPSDGIFSDNANSYITPIINFLKANGAPLL  201

Query  638   ANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFYAAVEKAGGSNV  802
             AN+Y YF+ T +P  + L +ALF+       ++     NLFDA++++ YAA+EKAG +++
Sbjct  202   ANVYTYFSYTENPQSISLEYALFTSPGVVVTDDPYKYQNLFDALMDALYAALEKAGAADM  261

Query  803   QIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNK  982
             QIVVSE+GWPSEG   A+  NA TYY NLI HV  N GT ++ G  IETYLFAMFDEN K
Sbjct  262   QIVVSESGWPSEGSGAATAQNAGTYYSNLINHV--NQGTPRKSGQAIETYLFAMFDENLK  319

Query  983   TVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
                      E+HFGLF+P    KY ++F
Sbjct  320   EAG-----IEQHFGLFSPSKQPKYKITF  342



>ref|NP_001275613.1| glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like precursor 
[Solanum tuberosum]
 gb|AFU52661.1| beta-1,3-glucanase 28 [Solanum tuberosum]
Length=345

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 219/330 (66%), Gaps = 12/330 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +A  +LL+  + + GV S+GVCYGR+ +NLP+ +  +      GI+ +RLY PDTNV +A
Sbjct  17    VALFVLLMCGIQMTGVHSVGVCYGRMADNLPSESDVVNHCHANGIKKIRLYYPDTNVLNA  76

Query  263   LRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGK--T  430
             LR SNI+V+VDVPN+ +  LA + N A  WV  NI  Y P+V F+Y+AVGNE+ P K   
Sbjct  77    LRESNIEVLVDVPNEHVKTLAQDPNQARNWVNNNIKAYFPSVKFRYIAVGNEISPIKHVE  136

Query  431   GSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + +   A++NVH A++ A  +  IK STATYS +L +T+PP+N +F  + +    PIV+
Sbjct  137   FAPFVGPAIENVHNAIVEAGLQDQIKVSTATYSALLTNTWPPQNSMFNPDWRGFTDPIVK  196

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEK  784
              L  NNLPLL NIYPYF+   +   + L +ALF++    S    NLFDA+++S Y A+EK
Sbjct  197   LLKDNNLPLLVNIYPYFSYIYNMKDIPLSYALFTDSGPNSAGYQNLFDALVDSMYYALEK  256

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             +G  NV+IVVSETGWPS G P A+  NA TYY NLI HV   +GT K+PG  IET+LFAM
Sbjct  257   SGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNLIDHVR--NGTPKKPGRGIETFLFAM  314

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKY  1054
             FDE  K      D+TERHFGLF PD  SKY
Sbjct  315   FDERGK----GGDETERHFGLFYPDRNSKY  340



>ref|XP_004139045.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Cucumis sativus]
 ref|XP_004154642.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
isoform 1 [Cucumis sativus]
Length=392

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 215/322 (67%), Gaps = 16/322 (5%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             +SIGVCY   GNNLP+A   + LYKN  I+ +R+Y PDT + +ALRGSNI+VIV +PN  
Sbjct  78    ESIGVCYSSAGNNLPDAREVVQLYKNNSIKKMRIYNPDTTILNALRGSNIEVIVGIPNTY  137

Query  311   LPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAA  487
             +  + N ++A  WVQ+NI  Y P VNF+Y+AVGNEV P    + Y L A+ ++++A+ AA
Sbjct  138   IEHIVNLSSAANWVQKNIQAYVPYVNFRYIAVGNEVKPPDAIAQYVLPAMSSIYSAISAA  197

Query  488   N-RGGIKASTA-TYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             N +  IK ST  + S + + ++PP NG F  EA   M PI++FLA+N  PLLAN+YPYF 
Sbjct  198   NLQDQIKVSTVISMSFLSNSSFPPSNGSFSSEAGGFMEPIIKFLAKNGSPLLANVYPYFV  257

Query  662   RTGDPDHVQLPFALFSEVNSYS------EENNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
              T     + L +ALF +  +        + N+LF++M+++ Y A+EK GG+ V IV+SE+
Sbjct  258   YTEINQTISLDYALFMQSPALVISDGNFKYNSLFESMVDALYVALEKLGGAKVSIVISES  317

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA TYY+NLI  V   +GT +RP   IETYLFAMFDEN K++     
Sbjct  318   GWPSGGGNGATIENAGTYYRNLISFVR--NGTPRRPRRAIETYLFAMFDENLKSL-----  370

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + E+HFGLFTPD  SKY LSF+
Sbjct  371   EMEKHFGLFTPDKKSKYQLSFS  392



>ref|XP_007035767.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY06693.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=426

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 222/343 (65%), Gaps = 22/343 (6%)
 Frame = +2

Query  83    IAAILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AAI+LL+G     L I G +S+GVCYG +GNNLP+A   I LYK+  IR +RLY+P+  
Sbjct  69    MAAIILLLGLFAANLDITGAESVGVCYGMLGNNLPSAWEVIELYKSRNIRRMRLYDPNPA  128

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGK  427
                ALRGSNI+V++ VPN  L  LAN + A  WVQRN+V Y P+V F+Y+AVGNEV P  
Sbjct  129   ALQALRGSNIEVMLGVPNSDLQNLANPSNAQSWVQRNVVSYWPSVRFRYIAVGNEVSPVN  188

Query  428   TGS----DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLM  592
              G+     + L AL NV  A+ +A     IK S A    ++ ++YPP  G F+ + ++ +
Sbjct  189   GGTAWLAQFVLPALVNVFNAVRSAGLHNDIKVSIAIDMTLIGNSYPPSAGAFRGDVRSYL  248

Query  593   YPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAML  757
              PI+  LA  + PLLANIYPYF+  G+P  + LP+ALF+  +  + +      NLFDAML
Sbjct  249   DPIIGHLAWASTPLLANIYPYFSHAGNPRDISLPYALFTSPSPVAWDQGRGYQNLFDAML  308

Query  758   ESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGS  937
             ++ Y+A+E AG  ++ +VVSE+GWPS GG   S  NA+TY   LI HV+G  GT KRPG 
Sbjct  309   DALYSALENAGQPSLGVVVSESGWPSAGGFATSVENAQTYLSKLIGHVQG--GTPKRPGR  366

Query  938   HIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
              IETYLFA+FDEN K       + E+HFGLF+P+   KY LSF
Sbjct  367   AIETYLFALFDENQK-----EPELEKHFGLFSPNKQPKYPLSF  404



>ref|XP_008223323.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Prunus mume]
Length=369

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 222/330 (67%), Gaps = 18/330 (5%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I GVQS+GVCYG +GNNLP+    I+LYK+  I+ +R+Y+P+ +   ALRGSNI++++
Sbjct  30    LGITGVQSVGVCYGMLGNNLPSHAEVISLYKSNNIKQMRIYDPNQSALQALRGSNIELML  89

Query  293   DVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP--GKTG--SDYALAA  454
              VPN  L  LA N + A  WVQ N++ +  +V FKY+AVGNEV P  G T   + + L A
Sbjct  90    GVPNQDLERLATNPSEAQTWVQTNVLNFRQSVRFKYIAVGNEVSPVYGDTTRLAQFVLPA  149

Query  455   LKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLP  631
             +KN++ A+ +A  +  IK STA  +G++ ++YPP  G F+ + +  + PI+ FL     P
Sbjct  150   MKNIYNAIRSAGLQDQIKVSTAIETGLIGNSYPPSQGAFRGDVRAYLDPIIGFLVYAKSP  209

Query  632   LLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGS  796
             LLANIY YF+  G+P  + LP+ALF+  +  + +      NLFDAML++ Y+AVE+AGG 
Sbjct  210   LLANIYTYFSYIGNPRDISLPYALFTSPSVMAWDGDKGYQNLFDAMLDALYSAVERAGGG  269

Query  797   NVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDEN  976
             ++++VVSE+GWPS G   AS  NA TYY NLI+HV+   GT KRP   IETYLFA+FDEN
Sbjct  270   SLEVVVSESGWPSAGAFGASTDNARTYYSNLIRHVK--EGTPKRPKRSIETYLFAVFDEN  327

Query  977   NKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             NK      ++TERHFG+F P    KYNL+F
Sbjct  328   NKL----GEETERHFGVFFPTKEPKYNLNF  353



>ref|NP_001267896.1| class I beta-1,3-glucanase precursor [Vitis vinifera]
 gb|ABB82365.1| class I beta-1,3-glucanase [Vitis vinifera]
 gb|ADG35963.1| chitinase [Vitis hybrid cultivar]
Length=360

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 217/330 (66%), Gaps = 19/330 (6%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
              I GV+S+GVCYG +GNNLP A+  + LYK+  I  +R+Y+P+     ALRGSNI +++ 
Sbjct  16    QITGVKSVGVCYGMLGNNLPPASQVVALYKSRNIDRMRIYDPNQAALQALRGSNIQLMLG  75

Query  296   VPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS----DYALAAL  457
             VPN  L  LA N + A  WVQRN+  Y P V+F+Y+AVGNEV P   G+     + L A+
Sbjct  76    VPNSDLQGLATNPSQAQSWVQRNVRNYWPGVSFRYIAVGNEVSPVNGGTSRFAQFVLPAM  135

Query  458   KNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N+ AAL +A  +  +K STA    +L ++YPP  G F+ + +  + PI++FL  N  PL
Sbjct  136   RNIRAALASAGLQDRVKVSTAIDLTLLGNSYPPSQGAFRGDVRGYLDPIIRFLVDNKSPL  195

Query  635   LANIYPYFARTGDPDHVQLPFALFSE-----VNSYSEENNLFDAMLESFYAAVEKAGGSN  799
             LANIYPYF  +G+P  + LP+ALF+       +      NLFDAML++ Y+A+ +AGG++
Sbjct  196   LANIYPYFGYSGNPKDISLPYALFTANSVVVWDGQRGYKNLFDAMLDALYSALGRAGGAS  255

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             +++VVSE+GWPS GG   +  NA TY  NLI+HV+G  GT KRPG  IETYLFAMFDEN 
Sbjct  256   LEVVVSESGWPSAGGFGTTVDNARTYNSNLIRHVKG--GTPKRPGRAIETYLFAMFDENK  313

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             K       Q E+HFGLF P+   KY+++F+
Sbjct  314   K-----EPQLEKHFGLFFPNKQPKYSINFS  338



>ref|XP_002459073.1| hypothetical protein SORBIDRAFT_03g045450 [Sorghum bicolor]
 gb|EES04193.1| hypothetical protein SORBIDRAFT_03g045450 [Sorghum bicolor]
Length=336

 Score =   293 bits (751),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 217/322 (67%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GV+SIGVCYG  G+NLP A+  + LY++ GI  +R+Y PDTN  +AL GSNI VI+DVPN
Sbjct  28    GVKSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDTNALNALSGSNIGVIMDVPN  87

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQRN+  +P VNFKY+AVGNEV  G T S   L A++NV++AL 
Sbjct  88    SDLSSLASDPSAAATWVQRNLQAFPGVNFKYIAVGNEVSGGDTNS--ILPAMQNVNSALA  145

Query  482   AANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
              A  GGIK STA  SGV    +PP  G F   ++  M PI Q+L     PLL N+YPYF+
Sbjct  146   NAGLGGIKVSTAVESGVT-QGFPPSQGSF---SQGYMGPIAQYLQSTGAPLLCNVYPYFS  201

Query  662   RTGDPDHVQLPFALFSEVNSYSEEN------NLFDAMLESFYAAVEKAGGSNVQIVVSET  823
              TG+   + L +ALF+   +  +++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  202   YTGNEAQIALSYALFTSPGTVVQDDDGNAYQNLFDALVDTFVSALENAGAGNVGVVVSES  261

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS+GG  A+ GNA+TY +NLI HV    GT KRPG+ IETY+FAMF+E+ KT      
Sbjct  262   GWPSDGGDAATPGNAQTYNQNLINHV--GQGTPKRPGA-IETYIFAMFNEDKKT----GA  314

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             +TERHFGLF PD    Y ++F+
Sbjct  315   ETERHFGLFNPDKSPAYPINFS  336



>gb|ACD45060.1| beta-1,3-glucanase [Vitis riparia]
Length=345

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 219/340 (64%), Gaps = 19/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A +LL+ G L    H+   Q+ GVCYG  G+NLP     + LY  Y IR +RLY+P+  
Sbjct  14    MATLLLVFGLLMASLHLTVAQT-GVCYGMQGDNLPPPGQVVGLYNQYSIRRMRLYDPNQA  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                ALRGSNI++++ VPND L  +A+    A  WVQ NI  Y NV F+YVAVGNEV P  
Sbjct  73    ALQALRGSNIELMIGVPNDALQNIASSQGNANSWVQNNIKNYGNVRFRYVAVGNEVSPTG  132

Query  428   TGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
             + + + L A++N+  A+ AA  G  IK STA  +GVL  +YPP  G FK E  + + PI+
Sbjct  133   STAQFVLPAMRNIFNAISAAGLGNQIKVSTAIDTGVLGTSYPPSQGAFKPEVTSFLNPII  192

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
              FL  N  PLL N+YPYF+  G+   ++L +ALF+      ++      NLFDA+L++ Y
Sbjct  193   SFLVNNRAPLLVNLYPYFSYIGNTRDIRLDYALFTAPGVVVQDGQLGYRNLFDAILDAVY  252

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             +A+EKAGG ++Q+V+SE+GWPS GG   +  NA+TY  NLIQHV+G  GT K+PG  IET
Sbjct  253   SALEKAGGGSLQVVISESGWPSAGGTATTVDNAKTYNSNLIQHVKG--GTPKKPGGPIET  310

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMFDEN K+      + E+H+GLF+P+   KY ++FN
Sbjct  311   YVFAMFDENRKS-----PEYEKHWGLFSPNKQPKYPINFN  345



>ref|XP_008227224.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=386

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 210/321 (65%), Gaps = 14/321 (4%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             +SIGVCYGR+ +NLP     I+LY+  GIR +R+++P+     ALRGSNI++IV V N  
Sbjct  34    ESIGVCYGRVADNLPPDPEVISLYQANGIRRMRIFDPNPPTLQALRGSNIELIVGVRNQD  93

Query  311   LPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             + +L N   AA  WVQ N++ Y P+V F+Y+AVGNE+ P    + Y LAA+KN+  A+ +
Sbjct  94    IQSLGNDVAAATAWVQNNVLNYFPDVKFRYIAVGNEIKPQDAEAIYVLAAMKNIKTAIAS  153

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +  IK STA    +L  +YPP  G F D A + + PI+ FLA N  P LAN+YPYF+
Sbjct  154   ANLQDQIKVSTAIDMSLLGSSYPPSTGSFSDAASSYINPIIAFLASNGSPFLANVYPYFS  213

Query  662   RTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
               GD   + L +ALF+      ++      NLF A +++ Y+A+EKAGGS+V+IVVSETG
Sbjct  214   YIGDTKDISLGYALFAAPGVTVQDGAFGYTNLFAAAVDALYSALEKAGGSSVEIVVSETG  273

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS+GG  A+  NA TYYKNLI  V+G  GT KR G  +ETYLFAMFDEN K       +
Sbjct  274   WPSQGGEGATVENASTYYKNLIDSVKG--GTPKRRGKPVETYLFAMFDENQK----GPAE  327

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
              ERHFGLF+PD   KY + FN
Sbjct  328   IERHFGLFSPDKQPKYQIRFN  348



>gb|AIT56224.1| beta-1,3 glucanase 3 [Musa AB Group]
Length=332

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 220/324 (68%), Gaps = 18/324 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQ+IGVCYGR+G+NLP  +  + LYK+  I  +R+Y+P+ +V +AL+GSNI ++V VPN
Sbjct  18    GVQAIGVCYGRLGDNLPQPSEVVDLYKSNNIGSMRIYDPNHDVLEALQGSNIQLLVGVPN  77

Query  305   DMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
             D L +LA + +AA  WVQ N+V Y P+V+F+Y+AVGNEV PG   + Y L A++NV  AL
Sbjct  78    DQLQSLASDSSAANAWVQSNVVAYWPSVSFRYIAVGNEVIPGDN-APYVLPAMQNVQNAL  136

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +AN +G IK ST+  +GVL  +YPP  G F  +A+  M PIVQFL  N  PLL N+YPY
Sbjct  137   ASANLQGQIKVSTSVSTGVLGVSYPPSEGSFSSDAQTYMNPIVQFLVNNGAPLLLNVYPY  196

Query  656   FARTGDPDHVQLPFALFSEVN------SYSEENNLFDAMLESFYAAVEKAGGSNVQIVVS  817
             F+   +   + L +ALF+  +      SY  + NLFDA++++ YA++EK GGS+V IVVS
Sbjct  197   FSYRDNQAQISLSYALFTSPDVVVNDGSYGYQ-NLFDAIVDATYASLEKVGGSSVAIVVS  255

Query  818   ETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             E+GWPS G  + +  NA TY +NLI HV    GT +RPGS IE Y+FAMF+EN K     
Sbjct  256   ESGWPSAGDVETTIDNARTYNQNLINHV--GQGTPRRPGSAIEAYIFAMFNENQK-----  308

Query  998   NDQTERHFGLFTPDMMSKYNLSFN  1069
             + + ER+FGLF PD    Y ++F+
Sbjct  309   DSELERNFGLFYPDKQPVYLINFS  332



>emb|CDP14184.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 220/340 (65%), Gaps = 20/340 (6%)
 Frame = +2

Query  89    AILLLIGFLHIA-----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             AI++L+G L +A     G Q+ GVCYGR+G+ LP+    + L K   IR +R+Y+P    
Sbjct  10    AIMILLGLLIVATLDFTGAQT-GVCYGRLGSRLPSPADVVALCKQNNIRRMRIYDPHRPT  68

Query  254   FDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKT  430
               AL GSNI++I+ VPN  L  +A   A A  WV  N+  YPNV F Y+AVGNEV P + 
Sbjct  69    LQALGGSNIELILGVPNTDLQNIAASQASANNWVHNNVRNYPNVRFSYIAVGNEVSPLRD  128

Query  431   GSDYA---LAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              + Y    L A++N++ A+ AA  G  +K STA  +G++  +YPP  G+F+ E ++ + P
Sbjct  129   TAQYTRFLLPAMQNIYNAISAAGLGNQVKVSTAVETGLVGQSYPPSAGIFRQEVRSFINP  188

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESF  766
             IVQFLA+N  PLL N+YP+FA TG+P  + L +ALF+     + +     NLFDA++++ 
Sbjct  189   IVQFLARNRAPLLVNVYPFFAYTGNPRDISLQYALFTSSGIVTPDGVRYQNLFDALVDAT  248

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             Y+A+EKAGGS+++IVVSE+GWPS GG   S  NA TY  NLI HV G  GT KRP  +IE
Sbjct  249   YSALEKAGGSSIEIVVSESGWPSAGGQATSIDNARTYNSNLIGHVTGGSGTPKRPRRNIE  308

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FA+FDE+ K+      + E+HFGLF P+   KY ++F
Sbjct  309   TYIFALFDEDQKS-----PEYEKHFGLFLPNRQPKYQITF  343



>emb|CDP14179.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 212/330 (64%), Gaps = 15/330 (5%)
 Frame = +2

Query  104   IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNID  283
             +  L   G Q+ GVCYGR+G+NLP+    + L     I+ +R+Y+P      AL GSNI+
Sbjct  20    VATLDFTGAQT-GVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIE  78

Query  284   VIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYA---LA  451
             VI+ VPN  L  +A   A A  WVQ N+  YPNV F+Y+AVGNEV P    + Y    L 
Sbjct  79    VILGVPNTDLQNVAASQANANNWVQNNVRKYPNVKFRYIAVGNEVSPLTGTAQYTNFLLP  138

Query  452   ALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNL  628
             A++N+  A+ AA  R  IK STA  +G++ + YPP  G F+ +A+N + PIVQFLA N  
Sbjct  139   AIRNIFNAVSAAGLRNQIKVSTAIETGLVANGYPPSAGTFQPQAQNFIKPIVQFLAGNGA  198

Query  629   PLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKAGGS  796
             PLL N+YPYF+ TG+P  + L +ALF+     + +     NLFDA++++ Y+A+EKAGGS
Sbjct  199   PLLVNVYPYFSYTGNPKSIALEYALFTSSGITTPDGVKYQNLFDALVDATYSALEKAGGS  258

Query  797   NVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDEN  976
             +VQIVVSETGWPS GG   S  NA TY  NLI+HV GN GT KRPG  IETY+F +FDE+
Sbjct  259   SVQIVVSETGWPSAGGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYIFDLFDED  318

Query  977   NKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
              K+      + E+HFGLF P+   KY +SF
Sbjct  319   QKS-----PEYEKHFGLFLPNRQPKYPISF  343



>emb|CAA09765.1| beta-1,3-glucanase [Cichorium intybus x Cichorium endivia]
Length=347

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 223/344 (65%), Gaps = 21/344 (6%)
 Frame = +2

Query  83    IAAILLLIGFL---HI-AGVQSIGVCYGRIG--NNLPNATATITLYKNYGIRGLRLYEPD  244
             +A +LLL+G +   HI    Q++GVCYGR+    +LP+  AT+ LY+  GI  +R+Y+P+
Sbjct  9     VAPLLLLLGMVVNFHIFIDAQAVGVCYGRVAVPGSLPSEEATVNLYQQNGITAMRIYDPN  68

Query  245   TNVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPG  424
                  AL+G +I++++DVPN  L +L N  AA  WV+ NI  YP VNF+Y+AVGNEV P 
Sbjct  69    QATLQALQGIDIELMLDVPNSELESLNNPVAATTWVRNNIQNYPGVNFRYIAVGNEVDPN  128

Query  425   KTG-SDYA---LAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNL  589
                 SDY    L A++NVH A++ A+    IK STATY+G+L+++YPP +GVF +  K  
Sbjct  129   NNATSDYVKLVLPAMRNVHQAIVDASLANQIKVSTATYTGLLENSYPPSDGVFHENVKAF  188

Query  590   MYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAM  754
             + PI+ FL QNNLP+LANIYPYFA  G    V L +AL         +N     NLFDAM
Sbjct  189   IEPIIAFLVQNNLPMLANIYPYFAAQGSM-QVNLSYALLQPDAPVVNDNGIMYSNLFDAM  247

Query  755   LESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPG  934
             L++ YAA    GG N++IVVSE+GWPS     A+  NA TYY+NLI HV    GT  +PG
Sbjct  248   LDAHYAAQAPFGGENLEIVVSESGWPSCCDSIATVENAGTYYRNLIGHVTQVGGTSAKPG  307

Query  935   SHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
               IETY FAMFDEN K    + D++E+HFG+F+P+   KY ++F
Sbjct  308   KSIETYQFAMFDENIK----DGDESEKHFGIFSPNQTPKYQVNF  347



>dbj|BAM28606.1| beta-1,3-glucanase [Nepenthes alata]
Length=340

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 212/337 (63%), Gaps = 17/337 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             ++ +L+LI  L       +GVCYGR GNNLP+    ++LY++ GI  +R+Y+PD     A
Sbjct  13    VSMLLVLIVPLIQTADARVGVCYGRNGNNLPSEQQVVSLYQSNGIGRMRMYDPDQAALQA  72

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD  439
             L+GSNID+I+DVPND L +LA+   A  WVQ N+ P+  +VNF  ++VGNEV P  + + 
Sbjct  73    LKGSNIDLILDVPNDSLRSLAS--NASQWVQSNVAPFASDVNFTCISVGNEVEPSDSNAQ  130

Query  440   YALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQ  619
             Y L A++NV  AL AAN G I  STA    +L ++ PP  G F   A + + PI+ FL  
Sbjct  131   YVLPAMQNVRTALNAANLGRIPVSTAIKFDLLGNSNPPSAGSFNSSAVSYITPIINFLKS  190

Query  620   NNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-------NNLFDAMLESFYAAV  778
             N  PLLANIYPYF+   +P  + + +ALF+   +   +        NLFDAM++S YAAV
Sbjct  191   NGAPLLANIYPYFSYVDNPQSININYALFTSPGTVVTDTGNGLKYQNLFDAMVDSVYAAV  250

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
              + G  N+ +VVSE+GWPS+GG  A+  NA TY KNLI HV+G  GT ++P   +ETYLF
Sbjct  251   ARVGAPNLAVVVSESGWPSDGGTAATVDNASTYIKNLINHVKG--GTPRKPRGPLETYLF  308

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             AMFDEN K         E+HFGLF PD   KY +SFN
Sbjct  309   AMFDENQKPAG-----VEQHFGLFNPDGTPKYQISFN  340



>gb|AAQ90286.1| beta-1,3-glucanase, basic [Coffea arabica x Coffea canephora]
Length=343

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 212/330 (64%), Gaps = 15/330 (5%)
 Frame = +2

Query  104   IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNID  283
             +  L   G Q+ GVCYGR+G+NLP+    + L     I+ +R+Y+P      AL GSNI+
Sbjct  20    VATLDFTGAQT-GVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIE  78

Query  284   VIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYA---LA  451
             VI+ VPN  L  +A   A A  WVQ N+  YPNV F+Y+AVGNEV P    + Y    L 
Sbjct  79    VILGVPNTDLQNVAASQANANNWVQINVRKYPNVKFRYIAVGNEVSPLTGTAQYTNFLLP  138

Query  452   ALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNL  628
             A++N+  A+ AA  R  IK STA  +G++ + YPP  G F+ +A+N + PIVQFLA N  
Sbjct  139   AIRNIFNAVSAAGLRNQIKVSTAIETGLVANGYPPSAGTFQPQAQNFIKPIVQFLAGNGA  198

Query  629   PLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKAGGS  796
             PLL N+YPYF+ TG+P  + L +ALF+     + +     NLFDA++++ Y+A+EKAGGS
Sbjct  199   PLLVNVYPYFSYTGNPKSIALEYALFTSSGITTPDGVKYQNLFDALVDATYSALEKAGGS  258

Query  797   NVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDEN  976
             +VQIVVSETGWPS GG   S  NA TY  NLI+HV GN GT KRPG  IETY+F +FDE+
Sbjct  259   SVQIVVSETGWPSAGGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYIFDLFDED  318

Query  977   NKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
              K+      + E+HFGLF P+   KY +SF
Sbjct  319   QKS-----PEYEKHFGLFLPNRQPKYPISF  343



>ref|XP_009363234.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Pyrus x bretschneideri]
Length=345

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 215/330 (65%), Gaps = 15/330 (5%)
 Frame = +2

Query  101   LIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNI  280
             L+      G Q IGVC G IG++LP     I LYK Y I+ +RLY+P+     ALRGSNI
Sbjct  24    LMATFETTGAQ-IGVCNGMIGDDLPTQAEVIALYKTYKIQRMRLYDPNQAALGALRGSNI  82

Query  281   DVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAAL  457
             ++++ VPND L  LA+  A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A+
Sbjct  83    ELLLGVPNDNLQNLASSQANANTWVQINVRNYANVRFKYIAVGNEVKPSDSFARFLVPAM  142

Query  458   KNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N+  A+ +A     IK STA  +GVL   YPP NG FK E  +L+ PI++FL  +  PL
Sbjct  143   RNIQKAISIAGLAKQIKISTAIDTGVLGEAYPPSNGSFKPEYSSLLQPIIRFLVNHKSPL  202

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSN  799
             L N+YPYF+ + +   ++L +ALF+  +   ++     +NLFDA+L+  YAA+EK GG +
Sbjct  203   LVNLYPYFSYSSNARDIRLDYALFTSPSIVVQDGKFGYDNLFDAILDGVYAALEKVGGGS  262

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             ++IVVSETGWPS GG + +  NA+TYY +LIQHV+G  GT +RPG  IETY+FAMFDEN 
Sbjct  263   LEIVVSETGWPSAGGTETTIDNAKTYYSHLIQHVKG--GTPRRPGKPIETYIFAMFDENQ  320

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             KT      + E+H+G+F+P    KY + FN
Sbjct  321   KT-----PELEKHWGVFSPKKQPKYPIIFN  345



>ref|XP_009349227.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Pyrus x bretschneideri]
Length=345

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 215/330 (65%), Gaps = 15/330 (5%)
 Frame = +2

Query  101   LIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNI  280
             L+      G Q IGVC G IG++LP     I LYK Y I+ +RLY+P+     ALRGSNI
Sbjct  24    LMATFETTGAQ-IGVCNGMIGDDLPTQAEVIALYKTYKIQRMRLYDPNQAALGALRGSNI  82

Query  281   DVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAAL  457
             ++++ VPND L  LA+  A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A+
Sbjct  83    ELLLGVPNDNLQNLASSQANANTWVQSNVRNYANVRFKYIAVGNEVKPSDSFARFLVPAM  142

Query  458   KNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             +N+  A+ LA     IK STA  +GVL   YPP NG FK E  +L+ PI++FL  +  PL
Sbjct  143   RNIQKAISLAGLAKQIKISTAIDTGVLGEAYPPSNGSFKPEYSSLLQPIIRFLVNHKSPL  202

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSN  799
             L N+YPYF+ + +   ++L +ALF+  +   ++     +NLFDA+L+  YAA+EK GG +
Sbjct  203   LVNLYPYFSYSSNARDIRLDYALFTSPSIVVQDGKFGYDNLFDAILDGVYAALEKVGGGS  262

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             ++IVVSETGWPS GG + +  NA+TYY +LI+HV+G  GT +RPG  IETY+FAMFDEN 
Sbjct  263   LEIVVSETGWPSAGGTETTIDNAKTYYSHLIEHVKG--GTPRRPGKPIETYIFAMFDENQ  320

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             KT      + E+H+G+F+P    KY + FN
Sbjct  321   KT-----PELEKHWGVFSPKKQPKYPIIFN  345



>gb|AEE81082.1| beta-1,3-glucanase [Musa balbisiana]
Length=339

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 218/322 (68%), Gaps = 16/322 (5%)
 Frame = +2

Query  128   VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPND  307
             VQSIGVCYGR+G+NLP  +  + LYK+Y I  +R+Y+P+++V +ALRGSNI ++VDVPN+
Sbjct  26    VQSIGVCYGRLGDNLPQPSEVVDLYKSYNIGSMRIYDPNSDVLEALRGSNIQLLVDVPNE  85

Query  308   MLPALA-NFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
              L +LA + +AA  WVQ N+V  +P+V+F+Y+AVGNEV      + Y L A++NV  AL 
Sbjct  86    QLESLASDPSAANDWVQSNVVANWPSVSFRYIAVGNEVILVDK-AQYVLPAMQNVQNALA  144

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +AN +G IK ST+  +GVL  +YPP  G F  EA+  M PIVQFL  N  PLL N+YPYF
Sbjct  145   SANLQGQIKVSTSVSTGVLGVSYPPSEGSFSSEAQTYMNPIVQFLVDNGAPLLLNVYPYF  204

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +   +   + L +ALF+  +    +      NLFDA++++ YA++EK GGS+V IVVSE+
Sbjct  205   SYRDNQAQISLSYALFTSPDVVVNDGSYGYQNLFDAIVDATYASMEKVGGSSVAIVVSES  264

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS G  + +  NA TY +NLI HV    GT +RPGS IE Y+FAMF+E+ K     N 
Sbjct  265   GWPSAGDVETTIDNARTYNQNLINHV--GQGTPRRPGSAIEAYIFAMFNEDQK-----NS  317

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + ER+FGLF P+    Y ++F+
Sbjct  318   ELERNFGLFYPNKQPVYLINFS  339



>ref|XP_004505798.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=342

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 206/315 (65%), Gaps = 8/315 (3%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QSIGVCYG + NNLP A   I L+K  GI  +R+Y PD    +ALR SNI++++ VPN+ 
Sbjct  27    QSIGVCYGIVANNLPPAAEVIELFKTNGIAKMRIYNPDQATLEALRRSNIELVIGVPNED  86

Query  311   LPALAN-FNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             + +++N  ++A  WVQ NI+ Y N V F+Y+ VGNE+ P    S + L A++N++AAL  
Sbjct  87    MQSISNDVSSATSWVQNNIINYSNDVIFRYIVVGNEINPNDPTSQFVLPAMQNIYAALAT  146

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +  IK STA   G+L  +YPP  G F  +A   + PIV FL  N  PLLAN+YPYFA
Sbjct  147   ANLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPIVNFLVTNGAPLLANVYPYFA  206

Query  662   RTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPSE  838
               G+   + L +ALF++  +      NLFDAML++ YAA  K G SN+QIVVSE+GWPS 
Sbjct  207   YIGNEADIPLEYALFTQQGTTDIGYQNLFDAMLDALYAAALKIGASNLQIVVSESGWPSA  266

Query  839   GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTERH  1018
             GG  A+  NA  YY NLI HV   +GT  RPG  IETYLFAMFDEN   +KP    +E++
Sbjct  267   GGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDEN---LKP-GAASEQY  322

Query  1019  FGLFTPDMMSKYNLS  1063
             FGLFTPD   KYN++
Sbjct  323   FGLFTPDKSQKYNIA  337



>ref|NP_001268153.1| beta 1-3 glucanase precursor [Vitis vinifera]
 emb|CAB91554.1| beta 1-3 glucanase [Vitis vinifera]
Length=345

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 214/331 (65%), Gaps = 15/331 (5%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LL+  LH+   Q+ GVCYG  G+NLP     + LY  Y IR +RLY+P+     ALRGSN
Sbjct  23    LLMASLHLTVAQT-GVCYGMEGDNLPPPGQVVGLYNQYSIRRMRLYDPNQAALQALRGSN  81

Query  278   IDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++++ VPND L  +A+    A  WVQ NI  Y NV F+YVAVGNEV P    + + L A
Sbjct  82    IELMIGVPNDALQNIASIQGNANSWVQNNIKNYGNVRFRYVAVGNEVSPTGPTAQFVLPA  141

Query  455   LKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLP  631
             ++N+  A+ AA  G  IK STA  +GVL  +YPP  G FK E  + + PI+ FL +N  P
Sbjct  142   MRNIFNAISAAGLGNQIKVSTAIDTGVLGTSYPPSKGAFKPEVTSFLNPIISFLVKNRAP  201

Query  632   LLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGS  796
             LL N+YPYF+  G+   ++L +ALF       ++      NLFDA+L++ Y+A+E+ GG 
Sbjct  202   LLVNLYPYFSYIGNTRDIRLDYALFKAPGVVVQDGQLGYKNLFDAILDAVYSALERVGGG  261

Query  797   NVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDEN  976
             ++Q+V+SE+GWPS GG   + GNA+TY  NLIQHV+G  GT K+PG  IETY+FAMF+EN
Sbjct  262   SLQVVISESGWPSAGGTATTVGNAKTYNSNLIQHVKG--GTPKKPGGPIETYVFAMFNEN  319

Query  977   NKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
              K+      + E+H+GLF P+  +KY ++FN
Sbjct  320   RKS-----PEYEKHWGLFLPNKQAKYPINFN  345



>gb|AGQ89281.1| beta-1,3-glucanase A [Saccharum hybrid cultivar]
 gb|AGR42648.1| beta-1,3-glucanase A [Saccharum hybrid cultivar]
Length=332

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 213/321 (66%), Gaps = 19/321 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GV SIGVCYG  G+NLP+A+  + LY++ GI  +R+Y PDTN  +AL GSNI VI+DVPN
Sbjct  25    GVHSIGVCYGVNGDNLPSASDVVQLYQSNGINLMRIYFPDTNALNALSGSNIGVIMDVPN  84

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P VNFKY+AVGNEV  G T  +  L A+KNV++AL 
Sbjct  85    SDLSSLASDPSAAATWVQSNVQAFPGVNFKYIAVGNEVSGGDT--NNILPAMKNVNSALA  142

Query  482   AANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
              AN G IK STA  SGV    YPP  G F   ++  M PI Q+L     PLL N+YPYF+
Sbjct  143   NANLGSIKVSTAVQSGVT-QGYPPSQGSF---SQGYMGPIAQYLQSTGAPLLCNVYPYFS  198

Query  662   RTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
              TG+   + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+G
Sbjct  199   YTGNEAQIDLSYALFTSSGTVVQDGGNAYQNLFDALVDTFVSALENAGAGNVGVVVSESG  258

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS GG  A+ GNA+TY +NLI HV    GT KRPG+ IETY+FAMF+E+ K       +
Sbjct  259   WPSAGGDAATPGNAQTYNQNLINHV--GQGTPKRPGA-IETYIFAMFNEDQKP----GAE  311

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
             TERHFGLF PD    Y ++F+
Sbjct  312   TERHFGLFNPDKSPAYPINFS  332



>ref|XP_003632274.2| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Vitis vinifera]
Length=331

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 218/337 (65%), Gaps = 19/337 (6%)
 Frame = +2

Query  83    IAAILLLIGFLH--IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +AAI L +G L   I G QS GVCYG + +NLP+A   + L +  GI  +R+++P     
Sbjct  1     MAAIFLFLGLLMPTITGAQSTGVCYGTLADNLPSAPEVVQLCQRRGIDKMRIFDPKPETL  60

Query  257   DALRGSNIDVIVDVPNDMLPALANF-NAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP--G  424
             +ALRGS I +I+ VPN  L ALA+  NAA  WV+ N+V Y  +V+   +AVGNEV P  G
Sbjct  61    EALRGSGIRLILGVPNVNLQALASTPNAATDWVKSNVVTYASDVDIWCIAVGNEVSPING  120

Query  425   KTG--SDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              T   + Y L A++N+ +AL+AA  G IK STA+ + +L  +YPP  G F D A + + P
Sbjct  121   ATSQFAQYVLPAMQNIQSALVAAGLGQIKVSTASSAELLGSSYPPSQGAFSDGASSFIDP  180

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLES  763
             I+ FL  NN   LAN+YPYFA  GDP +VQL +ALF+       +      NLFDAM+++
Sbjct  181   IIGFLVNNNSTFLANVYPYFAHIGDPVNVQLSYALFTSPGVVVHDGQYGYQNLFDAMVDA  240

Query  764   FYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHI  943
             FYAA+EKAGG+ + IV+SE+GWPS+GG  A+  NA+TYY NL+ HV    GT KRP   +
Sbjct  241   FYAALEKAGGTALDIVISESGWPSDGGVAATMENAKTYYTNLVYHVM--RGTPKRPEKAL  298

Query  944   ETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKY  1054
             +TYLFA+FDEN K       ++ERHFGLF P+ + KY
Sbjct  299   DTYLFALFDENQKP----GPESERHFGLFFPNEVPKY  331



>ref|XP_008240769.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=343

 Score =   291 bits (745),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 217/330 (66%), Gaps = 15/330 (5%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LL+      G Q IGVCYG +G+ LP  +  I LYK   I  +RLY+P+     ALRGSN
Sbjct  23    LLVATFETTGAQ-IGVCYGMLGDRLPPPSEVIALYKQNNIGRMRLYDPNQAALAALRGSN  81

Query  278   IDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++++ VPND L +LA+  A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A
Sbjct  82    IELMLGVPNDNLQSLASSQANANTWVQNNVRNYGNVRFKYIAVGNEVKPSDSYAQFLVPA  141

Query  455   LKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             ++N+  A+ +A  G IK STA  +GVL +++PP NG FK E   L+ PI++FL  N  PL
Sbjct  142   MQNIQNAISSAGLG-IKVSTAIDTGVLGNSFPPSNGEFKSEYGALLNPIIRFLVNNRSPL  200

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSN  799
             L N+YPYF+  G+   ++L +ALF+  +   ++      NLFDA+L++ YAA+EKAGG +
Sbjct  201   LVNLYPYFSYIGNTRDIRLDYALFTAPSVVVQDGQRGYRNLFDAILDAVYAALEKAGGGS  260

Query  800   VQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENN  979
             ++IV+SE+GWPS GG   +  NA TY  NLIQHV+G  GT ++PG  IETY+FAMFDEN 
Sbjct  261   LEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG--GTPRKPGRAIETYIFAMFDENR  318

Query  980   KTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             K     N + E+H+GLF+P    KY ++FN
Sbjct  319   K-----NPEFEKHWGLFSPSKQLKYPINFN  343



>gb|KHN03122.1| Glucan endo-1,3-beta-glucosidase, partial [Glycine soja]
Length=316

 Score =   290 bits (743),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 201/321 (63%), Gaps = 7/321 (2%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LL+     A  Q +G+CYG  GNNLP+    + LYK+ GI  +R+Y PD     ALRGSN
Sbjct  1     LLVKCYAAAQTQVVGICYGVNGNNLPSKQEVVDLYKSKGISRMRIYSPDEETLQALRGSN  60

Query  278   IDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++ +DV  + L +L + N A  WV R +  Y  +VNFKY+ VGNEV+P    + Y L A
Sbjct  61    IELTMDVAGETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEVHPNYDVAPYILPA  120

Query  455   LKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPL  634
             + N+  A+ +AN    K STA  + +L ++YPP NGVF  +A   + PI+ FL +N  PL
Sbjct  121   MINIQNAISSANLQ-TKVSTAIDATLLTNSYPPNNGVFTADASPYIGPIINFLVKNGAPL  179

Query  635   LANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAVEKAGGSNVQIV  811
             LAN+YPYFA   D   + LP+ALF++  +      NLFDAML+S YAA+EK G  N++IV
Sbjct  180   LANVYPYFAYVNDQQDINLPYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEIV  239

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPS GG  A   NA  YY NLI H     GT KRPG  I+T+LFAMFDEN K   
Sbjct  240   VSESGWPSAGGDGALVENAHAYYYNLISHANSGSGTPKRPGRPIQTFLFAMFDENQKP--  297

Query  992   PNNDQTERHFGLFTPDMMSKY  1054
                 +TERHFGLF PD  SKY
Sbjct  298   --GAETERHFGLFNPDKSSKY  316



>gb|AEV41413.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=373

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/336 (46%), Positives = 220/336 (65%), Gaps = 19/336 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRG  271
             ++L I  L I   Q +GVCYG +GNNLP A+  I+LYK   I+ +R+Y+P+     ALRG
Sbjct  23    LVLFIASLSITDAQ-VGVCYGMLGNNLPPASQVISLYKQANIKRMRIYDPNQAALQALRG  81

Query  272   SNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYP--GKTGS--  436
             SNI +++ VPN  L +L N + A  W+QRN+   +P+V F+Y+AVGNE+ P  G T S  
Sbjct  82    SNIQLMLGVPNSDLQSLTNPSNANSWIQRNVRAFWPSVRFRYIAVGNEISPVNGGTASLA  141

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
              + L A++N++ A+ +A  +  IK STA    ++ ++YPP  G F+ + ++ + PI+ FL
Sbjct  142   KFVLPAMRNIYNAIRSAGLQDQIKVSTAIDMTLIGNSYPPSAGAFRGDVRSYLDPIIGFL  201

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
             +    PLLANIYPYF+  G+P  + LP+ALF+  +    +      NLFDAML++ Y+A+
Sbjct  202   SSIRSPLLANIYPYFSYAGNPRDISLPYALFTSPSIVVWDGQRGYKNLFDAMLDALYSAL  261

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             E+AGG ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRPG  IETYLF
Sbjct  262   ERAGGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPGRFIETYLF  319

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K       + E+HFGLF P+   KYNL+F
Sbjct  320   AMFDENQK-----QPEFEKHFGLFFPNKQQKYNLNF  350



>ref|XP_008443726.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Cucumis melo]
Length=339

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 216/334 (65%), Gaps = 20/334 (6%)
 Frame = +2

Query  98    LLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSN  277
             LL+  LH+   Q IGVCYG++GNNLP     +TLY    I+ +RLY+P+    DALRGS 
Sbjct  16    LLVQNLHLTSAQ-IGVCYGQMGNNLPPQREVVTLYNQNNIKRMRLYDPNRGSLDALRGST  74

Query  278   IDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAA  454
             I++++ +PN  L  +A+  A A  WVQ NI  Y NV FKY+AVGNEV P  + + + + A
Sbjct  75    IELMLGLPNPDLQRIASSQAEANAWVQNNIKNYQNVRFKYIAVGNEVQPSSSAASFVVPA  134

Query  455   LKNVHAALLAA---NRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNN  625
             ++N+  AL  A   NR  IK STA  + +L  +YPP +G  K+E    M  +++FL  N 
Sbjct  135   MRNIQTALNNAGLVNR--IKVSTAIDTSILAMSYPPSSGTIKNEDMPFMSSVIRFLKDNG  192

Query  626   LPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAG  790
              PLL N+YPYF+  G+P  ++L +ALF+  ++   +      NLFDA+L++ YAA+EK G
Sbjct  193   SPLLVNLYPYFSYIGNPRDIRLDYALFTAPSTVVNDGQFRYQNLFDAILDAVYAALEKVG  252

Query  791   GSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH-IETYLFAMF  967
             G N++IV+SE+GWPS GG  AS  NA TY  NLIQHV+   GT +RPG   IETY+FAMF
Sbjct  253   GGNLEIVISESGWPSAGGTAASIDNARTYINNLIQHVK--RGTPRRPGGRPIETYIFAMF  310

Query  968   DENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             DEN K     N + E+HFGLF P+  SKY ++FN
Sbjct  311   DENQK-----NPEFEKHFGLFFPNKQSKYPVNFN  339



>ref|XP_008231643.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=341

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 219/337 (65%), Gaps = 19/337 (6%)
 Frame = +2

Query  89    AILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +I+ L+G L       G Q IGVCYG +G+ LP  +  I LYK   I  +RLY+P+    
Sbjct  14    SIVFLLGLLMTSFETTGAQ-IGVCYGMLGDRLPPPSEVIALYKQNNIGRMRLYDPNQAAL  72

Query  257   DALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTG  433
              ALRGSNI++I+DVPN  L +LA+  A A  WVQ N+  Y NV FKY+AVGNEV P  + 
Sbjct  73    AALRGSNIELILDVPNGDLQSLASSQANANTWVQNNVRNYGNVRFKYIAVGNEVKPSDSF  132

Query  434   SDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
             + + + A++N+   + +A  G IK STA  +GVL  ++PP NG FK E   L+ PI++FL
Sbjct  133   AQFLVPAMQNIQNGISSAGLG-IKVSTAVDTGVLGKSFPPSNGEFKSEYGALLNPIIRFL  191

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLL N+YPYF+ + +   ++L +ALF+  +   ++      NLFDA+L++ YAA+
Sbjct  192   VNNRSPLLVNLYPYFSYSSNTRDIRLDYALFTAPSVVVQDGQLGYRNLFDAILDAVYAAL  251

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAGG +++IV+SE+GWPS GG   +  NA TY  NLIQHV+G  GT ++PG  IETY+F
Sbjct  252   EKAGGGSLEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG--GTPRKPGRAIETYIF  309

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             AMFDEN K     N + E+H+GLF+P    KY ++FN
Sbjct  310   AMFDENRK-----NPELEKHWGLFSPSKQPKYPINFN  341



>gb|ACZ74626.1| beta-1,3-glucanase form RRII Gln 3 [Hevea brasiliensis]
Length=374

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 220/342 (64%), Gaps = 20/342 (6%)
 Frame = +2

Query  80    PIAAILLL-IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             P+  +L+L I  L I   Q +GVCYG++GNNLP A+  I LYK   I+ +R+Y+P+  V 
Sbjct  19    PVMLLLILYIASLGITDAQ-VGVCYGKLGNNLPPASEVIALYKQSNIKRMRIYDPNQEVL  77

Query  257   DALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTG  433
              ALRGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V  +Y+AVGNE+ P   G
Sbjct  78    QALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRDFWSSVRLRYIAVGNEISPVNGG  137

Query  434   S----DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
             +     + L A++N+H A+ +A  +  IK STA    ++ +TYPP  G F+D+ ++ + P
Sbjct  138   TAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLMGNTYPPSAGAFRDDVRSYLDP  197

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLES  763
             I+ FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L++
Sbjct  198   IIGFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDA  257

Query  764   FYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHI  943
              Y+A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   I
Sbjct  258   LYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPDRAI  315

Query  944   ETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             ETYLFAMFDEN K       + E+HFGLF PD   KYNL+F+
Sbjct  316   ETYLFAMFDENQK-----QPEVEKHFGLFFPDKRPKYNLNFS  352



>gb|AIR93912.1| glucanase [Cicer arietinum]
Length=575

 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 207/318 (65%), Gaps = 8/318 (3%)
 Frame = +2

Query  122   AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVP  301
             A  QS+GVCYG + NNLP A   I L+K  GI  +R+Y PD    +ALRGSNI++++ +P
Sbjct  259   ATAQSVGVCYGIVANNLPPAAEVIDLFKTNGIARMRIYNPDQATLEALRGSNIELVIGIP  318

Query  302   NDMLPALAN-FNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
             N+ + ++AN  ++A  WVQ NI+ Y N V F+Y+ VGNE+ P    S + L A++N++AA
Sbjct  319   NEDMQSIANDVSSATSWVQNNIINYSNNVIFRYIVVGNEINPSDPTSQFVLPAMQNIYAA  378

Query  476   LLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYP  652
             L  A+ +  IK STA   G+L  +YPP  G F  +A   + PIV FL  N  PLLAN+YP
Sbjct  379   LATADLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPIVNFLVTNGAPLLANVYP  438

Query  653   YFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAVEKAGGSNVQIVVSETGW  829
             YFA  G+   + L +ALF++  +      NLFDAML++ YAA  K G SN+QIVVSE+GW
Sbjct  439   YFAYIGNEQDIPLEYALFTKQGTTDIGYQNLFDAMLDALYAAALKIGASNLQIVVSESGW  498

Query  830   PSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQT  1009
             PS GG  A+  NA  YY NLI HV   +GT  RPG  IETYLFAMFDEN K        T
Sbjct  499   PSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDENQKP----GAAT  554

Query  1010  ERHFGLFTPDMMSKYNLS  1063
             E++FGLFTPD + KYN++
Sbjct  555   EQYFGLFTPDKLQKYNIA  572


 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 163/257 (63%), Gaps = 6/257 (2%)
 Frame = +2

Query  224  LRLYEPDTNVFDALRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVPYPN-VNFKYV  397
            +R+Y P+    +ALRGSNI++ + V N+ + ++AN  ++A  WVQ NI+ Y N V F+Y+
Sbjct  1    MRIYNPNQATLEALRGSNIELAIGVSNEDIQSIANDISSATSWVQINIINYANDVIFRYI  60

Query  398  AVGNEVYPGKTGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDE  577
             VGNE+      S + L A++N++ AL    +  IK ST     +L  +YPP  G F  +
Sbjct  61   IVGNEISHNDPTSQFVLRAMQNIYGAL-GNLQNQIKISTTIQLSLLGSSYPPSQGEFSPD  119

Query  578  AKNLMYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSE--ENNLFDA  751
            A   + PIV FLA N  PLLAN+YPYFA   D   + L +A F++   Y++    NLFDA
Sbjct  120  AIPYITPIVNFLASNGAPLLANVYPYFAYISDQKDISLEYATFTQ-QGYTDIGYQNLFDA  178

Query  752  MLESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRP  931
            ML++ YAA+ K G S++QIVVSE+GWPS GG  A+  NA  YY NLI HV   +GT  RP
Sbjct  179  MLDALYAAILKTGASDLQIVVSESGWPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRP  238

Query  932  GSHIETYLFAMFDENNK  982
            G  IETYLFAMFDEN K
Sbjct  239  GQPIETYLFAMFDENLK  255



>ref|XP_008240767.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform isoform 
X2 [Prunus mume]
Length=350

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/344 (45%), Positives = 219/344 (64%), Gaps = 21/344 (6%)
 Frame = +2

Query  80    PIAAILLLIGFLHIAGVQS-------IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYE  238
             P+ +I+LL+G L +A + +       IGVC G +G++LP     + LYK   I  +RLY+
Sbjct  14    PLISIVLLLGQLVVASLATKQHTGSPIGVCNGMLGDDLPPQAEVVALYKTNNIPRMRLYD  73

Query  239   PDTNVFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEV  415
             P+    +ALRGSNI +++ VPN+ L  +A+  A A  WVQ N+  Y NV FKY+AVGNEV
Sbjct  74    PNPAALEALRGSNIKLLLGVPNENLQYIASSQASANAWVQNNVRNYANVKFKYIAVGNEV  133

Query  416   YPGKTGSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLM  592
              P  + + + + A++ +  A+ LA     IK STA  +GVL  T+PP  G FK E   L+
Sbjct  134   KPSDSFAQFLVPAMRKIQKAISLAGLAKKIKVSTAIDTGVLGETFPPSIGSFKSEYDALL  193

Query  593   YPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAML  757
             +PI++FL  +  PLL N+YPYFA +G+   ++L +ALF+  +   ++      NLFDAML
Sbjct  194   HPIIRFLVNHKAPLLVNLYPYFAYSGNTQDIRLDYALFTAPSVVVQDGNFGYRNLFDAML  253

Query  758   ESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGS  937
             +  YAA+EKAGG ++++V+SETGWPS  G   +  NA TY  NLIQHV+   GT +RPG 
Sbjct  254   DGVYAALEKAGGGSLKVVISETGWPSAAGTATTIDNARTYISNLIQHVK--EGTPRRPGR  311

Query  938   HIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
              IETY+FAMFDEN KT      + E+H+GLF+P    KY +SFN
Sbjct  312   PIETYIFAMFDENRKT-----PELEKHWGLFSPTKQPKYQISFN  350



>ref|XP_008811754.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=340

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 218/334 (65%), Gaps = 15/334 (4%)
 Frame = +2

Query  89    AILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALR  268
             A+LL I      GVQSIGVCYG +GNNLP  +  + LYK+  I  +R+Y P+ +V  AL+
Sbjct  13    ALLLGIVITIPTGVQSIGVCYGMVGNNLPQPSEVVELYKSKRIGQMRIYGPNADVLKALK  72

Query  269   GSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDY  442
             GSNI++I+DVP + L  LA + +AA  W+Q N+  Y P+V+F+Y+AVGNEV PG   + Y
Sbjct  73    GSNIELILDVPKEDLQRLASDTSAARNWIQNNVKSYLPDVSFRYIAVGNEVIPGNF-AQY  131

Query  443   ALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQ  619
              L A+ N+HAAL A+  +  IK ST+   GVL  +YPP +G F  +A   + PIV+FLA 
Sbjct  132   VLPAMNNIHAALSASGLQNQIKVSTSVSQGVLGKSYPPSSGTFSSDASRYLGPIVKFLAS  191

Query  620   NNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEK  784
             N  PLL N+YPYF+  GD   +++ +ALF+   +   +      NLFDA++++ Y+A+EK
Sbjct  192   NGSPLLVNVYPYFSYIGDMKDIKIEYALFTSRGTVVSDPPYGYQNLFDALVDAIYSALEK  251

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
               GSN+ +VVSE+GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IE Y+FAM
Sbjct  252   MEGSNIPVVVSESGWPSAGGTAATMDNAKTYNQNLINHVR--QGTPKRPGKAIEAYIFAM  309

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             F+EN K  KP     E +FGLF P+    Y ++F
Sbjct  310   FNENQK--KP--PGIENNFGLFNPNKAPVYPINF  339



>ref|XP_010273332.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010273334.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Nelumbo 
nucifera]
Length=355

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 216/337 (64%), Gaps = 16/337 (5%)
 Frame = +2

Query  95    LLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGS  274
             +LL+   +I G Q IGVCYG +GNNLP+ +  + LY+   I+ +R+Y P+   F AL+GS
Sbjct  23    VLLMAISNITGAQRIGVCYGMLGNNLPSKSEVVALYEANNIQRMRVYAPNQEAFQALKGS  82

Query  275   NIDVIVDVPNDMLPALA--NFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYA  445
             NI+V++ VPN  L  +A  +   AY +V  N+V   + +NF Y+ VGNEV        Y 
Sbjct  83    NIEVMLGVPNQDLQRIAGSDLTPAYDFVYGNVVANKDTINFNYILVGNEV--DLKYFQYV  140

Query  446   LAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQN  622
             L A+KN+ +A+  A  +  +K +TAT+SGVLD TYPP N VF+ E    M PI+ FLA+ 
Sbjct  141   LPAMKNIQSAVETAGLQDRVKVTTATHSGVLDKTYPPSNSVFRSEYLQFMRPIIGFLAEK  200

Query  623   NLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFYAAVEKA  787
               PL ANIYPYFA  G+P  ++L +ALF+   +   ++     NLFDA+L+SFYAAVEK 
Sbjct  201   GSPLCANIYPYFAYIGNPSSIRLDYALFTAPEAVVSDDQLNYHNLFDALLDSFYAAVEKE  260

Query  788   GGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMF  967
             GG +V+IVVSETGWP+ G   A+  NA+TY   LIQHV+G  GT +RP   IE Y+FAMF
Sbjct  261   GGGSVKIVVSETGWPNAGESAATTANAQTYLNGLIQHVKG--GTPRRPNGPIEAYIFAMF  318

Query  968   DENNK---TVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             DEN K     +     TERH+GLF P+   KY +SF+
Sbjct  319   DENEKPPLKTETEAMTTERHYGLFNPNQNPKYQISFS  355



>ref|XP_007226561.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
 gb|EMJ27760.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
Length=335

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 220/326 (67%), Gaps = 18/326 (6%)
 Frame = +2

Query  128   VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPND  307
             VQS+GVCYG +GNNLP+    I+LYK+  I+ +R+Y+P+ +   AL+GSNI++++ VPN 
Sbjct  1     VQSVGVCYGMLGNNLPSHAEVISLYKSNNIKQMRIYDPNQSALQALQGSNIELMLGVPNQ  60

Query  308   MLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP--GKTG--SDYALAALKNVH  469
              L  LA N + A  WVQ N++ +  +V FKY+AVGNEV P  G T   + + L A+KN++
Sbjct  61    DLERLATNPSEAQTWVQTNVLNFRQSVRFKYIAVGNEVSPVYGDTTRLAQFVLPAMKNIY  120

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              A+ +A  +  IK STA  +G++ ++YPP  G F+ + +  + PI+ FL     PLLANI
Sbjct  121   NAIRSAGLQDQIKVSTAIETGLIGNSYPPSQGAFRGDVRAYLDPIIGFLVYAKSPLLANI  180

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             Y YF+  G+P  + LP+ALF+  +  + +      NLFDAML++ Y+AVE+AGG ++++V
Sbjct  181   YTYFSYIGNPRDISLPYALFTSPSVMAWDGDKGYQNLFDAMLDALYSAVERAGGGSLEVV  240

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPS G   AS  NA TYY NLI+HV+   GT KRP   IETYLFAMFDENNK   
Sbjct  241   VSESGWPSAGAFGASTDNARTYYSNLIRHVK--EGTPKRPKRSIETYLFAMFDENNKL--  296

Query  992   PNNDQTERHFGLFTPDMMSKYNLSFN  1069
                ++TERHFG+F P    KYNL+F+
Sbjct  297   --GEETERHFGVFFPTKEPKYNLNFD  320



>gb|AAA34078.1| beta(1,3)-glucanase regulator [Nicotiana plumbaginifolia]
Length=370

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 225/342 (66%), Gaps = 21/342 (6%)
 Frame = +2

Query  83    IAAILLL---IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             +AAI+LL   +    I G QS+GVCYG +GNNLP A+  + LYK+  IR +RLY+P+   
Sbjct  12    MAAIILLGLLVSSTEIVGAQSVGVCYGMLGNNLPPASQVVQLYKSKNIRRMRLYDPNQAA  71

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
               ALRGSNI+V++ VPN D+    AN + A  WVQRN+   +P V F+Y+AVGNEV P  
Sbjct  72    LQALRGSNIEVMLGVPNSDLQNIAANPSNANNWVQRNVRNFWPAVKFRYIAVGNEVSPVT  131

Query  428   TGSD---YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
               S    Y L A++N+  A+ +A  +  IK ST+    ++ +++PP  G F+++ ++ + 
Sbjct  132   GTSSLTRYLLPAMRNIRNAISSAGLQNNIKVSTSVDMTLIGNSFPPSQGSFRNDVRSFID  191

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PI+ F+   N PLL NIYPYF+  G+P  + LP+ALF+  N   ++      NLFDAML+
Sbjct  192   PIIGFVRGINSPLLVNIYPYFSYAGNPRDISLPYALFTAPNVVVQDGSLGYRNLFDAMLD  251

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             + YAA+ +AGG +++IVVSE+GWPS G   A+  NA TYYKNLIQHV+   G+ +RP   
Sbjct  252   AVYAALSRAGGGSIEIVVSESGWPSAGAFAATTNNAATYYKNLIQHVK--RGSPRRPNKV  309

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETYLFAMFDENNK     N + E+HFGLF+P+   KY LSF
Sbjct  310   IETYLFAMFDENNK-----NPELEKHFGLFSPNKQPKYPLSF  346



>ref|XP_009414139.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 223/338 (66%), Gaps = 17/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHI-AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             + A  LLI  L +   VQ+IGVCYGR+G+NLP  +  + LYK+  I  +R+Y+P+ +V +
Sbjct  9     VIATALLISVLALPTSVQAIGVCYGRLGDNLPQPSEVVDLYKSNNIGSMRIYDPNHDVLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTG  433
             ALRGSNI ++V VPND L +LA + +AA  WVQ N+V Y P+V+F+Y+AVGNEV PG   
Sbjct  69    ALRGSNIQLLVGVPNDQLQSLASDSSAANAWVQSNVVAYWPSVSFRYIAVGNEVIPGDD-  127

Query  434   SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQF  610
             + Y L A++NV  AL +AN +G IK ST+  + VL  +YPP  G F  + +  M PIVQF
Sbjct  128   APYVLPAMQNVQNALASANLQGQIKVSTSVSTRVLGVSYPPSEGSFSSDTQADMNPIVQF  187

Query  611   LAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAA  775
             L  N  PLL N+YPYF+   +   + L +ALF+  +    +      NLFDA++++ YA+
Sbjct  188   LVNNGAPLLLNVYPYFSYKYNQAQISLSYALFTSPDVVVNDGPYGYQNLFDAIVDAAYAS  247

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             +EK GGS+V+IVVSE+GWPS G  + +  NA TY +NLI HV    GT +RPGS IE Y+
Sbjct  248   LEKVGGSSVEIVVSESGWPSAGDVETTIDNAGTYNQNLINHV--GQGTPRRPGSAIEAYI  305

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FAMF+EN K     + + ER+FGLF P+    Y++ F+
Sbjct  306   FAMFNENQK-----DSELERNFGLFYPNKQPVYSIHFS  338



>emb|CDP09619.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 212/327 (65%), Gaps = 13/327 (4%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
              I+G Q IG+ YG  GN+LP+    I LY   GI  +R+Y P   V +ALRG+NI+++VD
Sbjct  16    RISGAQYIGISYGLNGNSLPSKQDVINLYNRIGIHRMRIYAPVPEVLNALRGTNIELLVD  75

Query  296   VPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
             V N+ + ++A N +AA  WVQ N+  Y P V F+Y++VG+EV      + Y   A++ + 
Sbjct  76    VANEDIQSIATNPSAAVNWVQNNVKKYSPAVKFRYISVGSEVPLSSNIAQYVGPAMEKIQ  135

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
              AL +A  +  IK ST+  +G+L  +YPP  G+F +EAK  + PI+  L +NN PLL N+
Sbjct  136   NALASAGLQNQIKVSTSISAGLLSVSYPPSQGLFSNEAKPFIKPIIDLLVRNNAPLLVNV  195

Query  647   YPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIV  811
             YPYF+  GDP  + L +ALF+      ++      N+FDA+L++ YAA+EK GGS+V IV
Sbjct  196   YPYFSYIGDPVDISLDYALFTSRGIVVQDGSFGYQNIFDAILDAHYAALEKEGGSSVNIV  255

Query  812   VSETGWPSEGGPD-ASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTV  988
             VSETGWPS+G P  AS  NA TYY N+I HV+   GT +RPG  IETYLFAMFDEN K  
Sbjct  256   VSETGWPSDGNPPAASFANAGTYYWNVISHVKSGKGTPRRPGRGIETYLFAMFDENQKP-  314

Query  989   KPNNDQTERHFGLFTPDMMSKYNLSFN  1069
                  QTERHFGLF PD  +KY ++F+
Sbjct  315   ---GAQTERHFGLFFPDQQTKYGITFD  338



>ref|XP_008373020.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score =   289 bits (739),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 214/324 (66%), Gaps = 12/324 (4%)
 Frame = +2

Query  113   LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIV  292
             L I G QS+GVCYGR GNNLP     + LYK+ GI  +R+YEP+     ALRGSNI++ V
Sbjct  29    LQITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTV  88

Query  293   DVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVH  469
              + N  L AL +  AA  WVQ+N+ PY  +V FKY+AVGNE++         L A++N+H
Sbjct  89    TILNXELXALNDAAAATAWVQKNVQPYSADVXFKYIAVGNEIHHXSAEVGSLLPAIQNIH  148

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             +A++AAN +G IK STA  + ++ + +PP +GV+ D A   + P++ FL  +  PLL N+
Sbjct  149   SAIVAANLQGQIKVSTAIDTTLVANPFPPSDGVY-DAANQFIXPVIDFLVSSGAPLLVNV  207

Query  647   YPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVV  814
             YPYF+   +P  + L +ALF+     V   +   +LFDA+L++ YAA+EKAG  N++IVV
Sbjct  208   YPYFSYXDNPS-IDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNMEIVV  266

Query  815   SETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKP  994
             SE+GWPSEGG  A+  NA T+Y+NLI HV    GT KRPG  IETYLFAMFDEN K  KP
Sbjct  267   SESGWPSEGGDQATPQNAATFYQNLINHVTSTTGTPKRPGKAIETYLFAMFDENLKDGKP  326

Query  995   NNDQTERHFGLFTPDMMSKYNLSF  1066
                  E+HFG+F+P+   KY L+F
Sbjct  327   ----VEKHFGVFSPNKQPKYQLTF  346



>ref|XP_009391471.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=340

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 217/333 (65%), Gaps = 18/333 (5%)
 Frame = +2

Query  98    LLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRG  271
             LL+  L    A V +IGVCYGR+GNNLP     + LYK   I  +R+Y+P+  V  ALRG
Sbjct  15    LLVSVLTAVPASVSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVLQALRG  74

Query  272   SNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYA  445
             SNI ++V VPN+ L +LA + +AA  WVQ+N+V + P+V+F+Y+AVGNEV PG   + Y 
Sbjct  75    SNIQLVVGVPNENLQSLASDPSAASNWVQKNVVAFRPSVSFRYIAVGNEVIPGGL-AQYV  133

Query  446   LAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQN  622
             L A++NV  AL +A  +  IK ST+  + VL  +YPP  G F   A+  M PIVQFLA+N
Sbjct  134   LPAMQNVQKALSSAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTHMNPIVQFLARN  193

Query  623   NLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKA  787
               PLL N+YPYF+   + + +   +ALF+      ++      NLFDAM+++ YAA+EK 
Sbjct  194   GAPLLVNVYPYFSYKDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYAAMEKV  253

Query  788   GGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMF  967
             GGSNV IVVSE+GWPS G   A+  NA+TY +NLI+HV    GT +R G+ IETY+FAMF
Sbjct  254   GGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRRSGAPIETYIFAMF  311

Query  968   DENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +EN K     N + E+HFGLF P+    Y +SF
Sbjct  312   NENQK-----NPELEKHFGLFNPNKQPVYPISF  339



>sp|P27666.1|E13F_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform GLB; AltName: Full=(1->3)-beta-glucan endohydrolase; 
Short=(1->3)-beta-glucanase; AltName: Full=Beta-1,3-endoglucanase, 
basic; AltName: Full=Glucanase GLB; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAA63540.1| glucan-1,3-beta-glucosidase [Nicotiana tabacum]
Length=370

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASTIEIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+    PI
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFTDPI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  347



>ref|XP_002459074.1| hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor]
 gb|EES04194.1| hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor]
Length=332

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 215/321 (67%), Gaps = 19/321 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQ+IGVCYG  G+NLP+A+  + LY++ GI  +R+Y  DTN  +AL GSNI VI+DVPN
Sbjct  25    GVQAIGVCYGVNGDNLPSASDVVKLYQSNGINLMRIYFADTNALNALSGSNIGVIMDVPN  84

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WV+ N+  +P VNFKY+AVGNEV  G T  +  L A+KNV++AL 
Sbjct  85    TDLSSLASDPSAAATWVKSNVQAFPGVNFKYIAVGNEVSGGDT--NNILPAMKNVNSALS  142

Query  482   AANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
              A  G IK STA  SGV    YPP  G F   +++ M PI Q+L     PLL N+YPYF+
Sbjct  143   NAGLGKIKVSTAVQSGVT-QGYPPSQGSF---SQSYMAPIAQYLQSTGAPLLCNVYPYFS  198

Query  662   RTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
              TG+   + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+G
Sbjct  199   YTGNEAQIALSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVGVVVSESG  258

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS GG  A+ GNA+TY +NLI HV    GT KRPG+ IETY+FAMF+E+ KT      +
Sbjct  259   WPSAGGDAATPGNAQTYNQNLINHV--GKGTPKRPGA-IETYIFAMFNEDKKT----GAE  311

Query  1007  TERHFGLFTPDMMSKYNLSFN  1069
             TERHFGLF PD    Y+++F+
Sbjct  312   TERHFGLFNPDKSPAYSINFS  332



>ref|XP_006365201.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Solanum tuberosum]
Length=333

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 205/327 (63%), Gaps = 12/327 (4%)
 Frame = +2

Query  110   FLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVI  289
             F   A VQ +GVCYGR GNNLP A   + LYK+ GI  +R+Y+P     +AL+ SN+ ++
Sbjct  11    FFDNAEVQCVGVCYGRNGNNLPLAEDVVNLYKSNGITSMRVYDPIPETLNALKDSNLQIM  70

Query  290   VDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----YALAA  454
             + +PND L AL +   AY WV  N++ Y   V  +Y++VGNE+ P    S     + L A
Sbjct  71    LCIPNDKLQALTDPKEAYNWVVANVINYIKQVRIRYISVGNEISPLIARSSQFVPFLLPA  130

Query  455   LKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLP  631
             ++NV   + +      +K STA   G+L +TYPP    F+ +  + + PI++FL QNN P
Sbjct  131   MENVQRVITSFRLNDRVKISTAIEMGLLANTYPPSQSTFRGDVTSFIKPIIEFLKQNNAP  190

Query  632   LLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSN-VQ  805
             LLANIYPYFA  GDP+HV L +A+F++    S    NLFDAML+S Y A+ K  G N V+
Sbjct  191   LLANIYPYFAYIGDPEHVSLSYAIFAQPEPDSSGYTNLFDAMLDSIYYAIGKVIGENKVE  250

Query  806   IVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKT  985
             IVVSE+GWPSEGG   S G A  YY+NLI H +   GT  +PG  IETYLFAMFDEN K 
Sbjct  251   IVVSESGWPSEGGFGGSMGIATIYYRNLIGHAKSKAGTIHKPGKPIETYLFAMFDENLKI  310

Query  986   VKPNNDQTERHFGLFTPDMMSKYNLSF  1066
                   +TERHFG+F PD   KYNL+F
Sbjct  311   ----GAETERHFGVFHPDKTQKYNLTF  333



>gb|ACD45061.1| beta-1,3-glucanase [Vitis vinifera]
Length=345

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 215/340 (63%), Gaps = 19/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A +LL+ G L    H+ G Q+ GVCYG  G+NLP     + LY  Y IR +RLY+P+  
Sbjct  14    MATLLLVFGLLMASLHLTGAQT-GVCYGMZGDNLPPPGEVVXLYNQYXIRRMRLYDPNQA  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                ALRGSNI+++  VPND L  +A+    A  WVQ NI  Y NV F+YVAVGNEV P  
Sbjct  73    ALQALRGSNIELMXGVPNDALQNIASXQGNANSWVQNNIKNYXNVRFRYVAVGNEVSPTG  132

Query  428   TGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
             + + + L A++N+  A+ AA  G  IK STA  +GVL  +YPP  G FK E  + +  I+
Sbjct  133   STAQFVLPAMRNIFNAISAAGLGNQIKVSTAIDTGVLGTSYPPSQGAFKXEVTSFLXXII  192

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
              FL  N  PLL N+YPYF+  G+   ++L +ALF       ++      NLFDA L++ Y
Sbjct  193   XFLVNNRAPLLVNLYPYFSYIGNTRDIRLDYALFXAPGVVVQDGQLGYRNLFDAXLDAVY  252

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             +A+E AGG ++Q+V+SE+GWPS GG   +  NA+TY  NLIQHV+G  GT K+PG  IET
Sbjct  253   SALEXAGGGSLQVVISESGWPSAGGTATTVDNAKTYNSNLIQHVKG--GTPKKPGGPIET  310

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMFDEN K+      + E+H+GLF P+  +KY ++FN
Sbjct  311   YVFAMFDENRKS-----PEYEKHWGLFLPNKQAKYPINFN  345



>gb|KHN05498.1| Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform [Glycine 
soja]
Length=345

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 204/310 (66%), Gaps = 10/310 (3%)
 Frame = +2

Query  122   AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVP  301
             A  QS+GVCYG  GNNLP   A + LYK+  I  +RLY PD     ALRGSNI+VI+ VP
Sbjct  22    AQFQSVGVCYGGKGNNLPKMQAVVDLYKSNRIDKIRLYHPDEGALQALRGSNIEVILGVP  81

Query  302   NDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
             ND L +L N   A  WV + +  Y  NV FKY+AVGNE++PG + +   L AL+N+  A+
Sbjct  82    NDQLQSLINVANATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGSVLPALENIQNAI  141

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              AAN +  +K STA  + +L ++YPP +GVF   A + + PIV FLA+N  PLLAN+YPY
Sbjct  142   SAANLQCQVKVSTAIDTTLLGYSYPPNDGVFSSSASSYIRPIVNFLARNGAPLLANVYPY  201

Query  656   FARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSETGWP  832
             FA   +P ++ L +ALF++  N+     NLFDAML+S YAA+EK G  NV +VVSE+GWP
Sbjct  202   FAYVNNPQNIALDYALFTKQGNNVVGYQNLFDAMLDSVYAALEKVGAPNVTVVVSESGWP  261

Query  833   SEGGP-DASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQT  1009
             SEGG   A+  NA TYY+NLI H +G  GT KRP   IE YL+AMFDEN K       + 
Sbjct  262   SEGGAVAATVQNAGTYYRNLISHAKG--GTPKRPNGPIEIYLYAMFDENQK----QGQEI  315

Query  1010  ERHFGLFTPD  1039
             ++HFGLF  D
Sbjct  316   QQHFGLFRLD  325



>gb|ACF93731.1| basic beta-1,3-glucanase [Nicotiana tabacum]
Length=370

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 225/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+  + PI
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFVDPI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN++F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNINF  347



>ref|XP_009760304.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
GGIB50 isoform X1 [Nicotiana sylvestris]
 emb|CAA37669.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
 gb|AAA63539.1| glucan beta-1,3-glucanase [Nicotiana tabacum]
Length=370

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 225/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+  + PI
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFVDPI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN++F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNINF  347



>ref|XP_008240766.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform isoform 
X1 [Prunus mume]
Length=354

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 219/348 (63%), Gaps = 25/348 (7%)
 Frame = +2

Query  80    PIAAILLLIGFLHIAGVQS-----------IGVCYGRIGNNLPNATATITLYKNYGIRGL  226
             P+ +I+LL+G L +A + +           IGVC G +G++LP     + LYK   I  +
Sbjct  14    PLISIVLLLGQLVVASLATKQHTGMHVGSPIGVCNGMLGDDLPPQAEVVALYKTNNIPRM  73

Query  227   RLYEPDTNVFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAV  403
             RLY+P+    +ALRGSNI +++ VPN+ L  +A+  A A  WVQ N+  Y NV FKY+AV
Sbjct  74    RLYDPNPAALEALRGSNIKLLLGVPNENLQYIASSQASANAWVQNNVRNYANVKFKYIAV  133

Query  404   GNEVYPGKTGSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEA  580
             GNEV P  + + + + A++ +  A+ LA     IK STA  +GVL  T+PP  G FK E 
Sbjct  134   GNEVKPSDSFAQFLVPAMRKIQKAISLAGLAKKIKVSTAIDTGVLGETFPPSIGSFKSEY  193

Query  581   KNLMYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLF  745
               L++PI++FL  +  PLL N+YPYFA +G+   ++L +ALF+  +   ++      NLF
Sbjct  194   DALLHPIIRFLVNHKAPLLVNLYPYFAYSGNTQDIRLDYALFTAPSVVVQDGNFGYRNLF  253

Query  746   DAMLESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRK  925
             DAML+  YAA+EKAGG ++++V+SETGWPS  G   +  NA TY  NLIQHV+   GT +
Sbjct  254   DAMLDGVYAALEKAGGGSLKVVISETGWPSAAGTATTIDNARTYISNLIQHVK--EGTPR  311

Query  926   RPGSHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             RPG  IETY+FAMFDEN KT      + E+H+GLF+P    KY +SFN
Sbjct  312   RPGRPIETYIFAMFDENRKT-----PELEKHWGLFSPTKQPKYQISFN  354



>ref|XP_008811753.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=338

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 223/338 (66%), Gaps = 17/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +AAI LL+G L +    VQSIGVCYGR+GNNLP  +  + LYK+  I  +R+Y+P +   
Sbjct  9     MAAITLLLGVLIVFPTSVQSIGVCYGRLGNNLPQPSDVVALYKSNNIGQMRIYDPFSPTL  68

Query  257   DALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTG  433
              AL+G+NI +IVDVPND L  LA + +AA  WVQ NI  Y +V+F+Y+AVGNEV PG + 
Sbjct  69    QALQGTNIQLIVDVPNDGLQNLASDASAANDWVQNNIQAYSDVSFRYIAVGNEVIPGDS-  127

Query  434   SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQF  610
             + Y L A+KN+++AL AA  +  IK ST+  + VL  +YPP +G F  +A N + PI+QF
Sbjct  128   AQYVLPAMKNIYSALSAAGLQNQIKVSTSVATVVLGVSYPPSHGAFSSDALNTLGPIIQF  187

Query  611   LAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAA  775
             L +N  PLL N+YPYF+   +   + + +ALF+   +  ++      NLFDAM+++ YAA
Sbjct  188   LNENGAPLLVNVYPYFSYVDNQGSIDINYALFTSSGTVVQDGQYSYQNLFDAMVDAVYAA  247

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             +E  GGSNV IVVSE+GWPS G   A+  NA+TY +NLI HV    GT +R G  +ETY+
Sbjct  248   LENVGGSNVAIVVSESGWPSAGDTVATISNAQTYNQNLINHV--GQGTPRRSGKALETYI  305

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             F+MF+EN K+        E+++GLF P+    Y ++F+
Sbjct  306   FSMFNENGKSAG-----IEQNWGLFYPNEQPVYPINFS  338



>ref|XP_009626316.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
GLB isoform X1 [Nicotiana tomentosiformis]
Length=370

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASTIEIAGAQSIGVCYGMLGNNLPNHLEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+    PI
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFTDPI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP+++F+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSIFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  347



>emb|CAA30261.1| beta-glucanase precursor [Nicotiana plumbaginifolia]
Length=362

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 225/342 (66%), Gaps = 21/342 (6%)
 Frame = +2

Query  83    IAAILLL---IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             +AAI+LL   +    I G QS+GVCYG +GNNLP A+  + LYK+  IR +RLY+P+   
Sbjct  4     MAAIILLGLLVSSTEIVGAQSVGVCYGMLGNNLPPASQVVQLYKSKNIRRMRLYDPNQAA  63

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
               ALRGSNI+V++ VPN D+    AN + A  WVQRN+   +P V F+Y+AVGNEV P  
Sbjct  64    LQALRGSNIEVMLGVPNSDLQNIAANPSNANNWVQRNVRNFWPAVKFRYIAVGNEVSPVT  123

Query  428   TGSD---YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
               S    Y L A++N+  A+ +A  +  IK S++    ++ +++PP  G F+++ ++ + 
Sbjct  124   GTSSLTRYLLPAMRNIRNAISSAGLQNNIKVSSSVDMTLIGNSFPPSQGSFRNDVRSFID  183

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PI+ F+ + N PLL NIYPYF+  G+P  + LP+ALF+  N   ++      NLFDAM +
Sbjct  184   PIIGFVRRINSPLLVNIYPYFSYAGNPRDISLPYALFTAPNVVVQDGSLGYRNLFDAMSD  243

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             + YAA+ +AGG +++IVVSE+GWPS G   A+  NA TYYKNLIQHV+   G+ +RP   
Sbjct  244   AVYAALSRAGGGSIEIVVSESGWPSAGAFAATTNNAATYYKNLIQHVK--RGSPRRPNKV  301

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETYLFAMFDENNK     N + E+HFGLF+P+   KY LSF
Sbjct  302   IETYLFAMFDENNK-----NPELEKHFGLFSPNKQPKYPLSF  338



>gb|AAL30426.1|AF435089_1 beta-1,3-glucanase [Prunus persica]
Length=343

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 221/339 (65%), Gaps = 19/339 (6%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             + +I+ L+G L       G Q IGVCYG +G+ LP  +  I LYK   IR +RLY+P+  
Sbjct  14    MISIVFLLGLLMASFETTGAQ-IGVCYGMLGDRLPPPSEVIALYKQNNIRRMRLYDPNQA  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                AL+GS I++++ VPND L +LA+  A A  WVQ N+  Y NV FKY+AVGNEV P  
Sbjct  73    ALAALKGSYIELMLGVPNDNLQSLASSQANANTWVQNNVRNYGNVRFKYIAVGNEVKPSD  132

Query  428   TGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
             + + + + A++N+  A+ +A  G IK STA  +GVL +++PP  G FK E   L+ PI++
Sbjct  133   SYAQFLVPAMQNIQNAISSAGLG-IKVSTAVDTGVLGNSFPPSKGEFKSEYGALLNPIIR  191

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL  N  PLL N+YPYF+ + +   ++L +ALF+  +   ++      NLFDA+L++ YA
Sbjct  192   FLVNNRSPLLVNLYPYFSYSSNTHDIRLDYALFTAPSVVVQDGQRGYRNLFDAILDAVYA  251

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAGG +++IV+SE+GWPS GG   +  NA TY  NLIQHV+G  GT ++PG  IETY
Sbjct  252   ALEKAGGGSLEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG--GTPRKPGRAIETY  309

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             +FAMFDEN K     N + E+H+GLF+P    KY ++FN
Sbjct  310   IFAMFDENRK-----NPELEKHWGLFSPSKQPKYPINFN  343



>ref|XP_007212652.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
 gb|EMJ13851.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
Length=337

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 206/319 (65%), Gaps = 14/319 (4%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             +SIGVCYGR+ NNLP     I+LY+  GI  +R+++P+     AL+GSNI++IV V N  
Sbjct  2     ESIGVCYGRVANNLPPDPEVISLYQANGITRMRIFDPNPPTLQALKGSNIELIVGVRNQD  61

Query  311   LPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             + +L N   AA  WVQ N++ Y P+V F+Y+AVGNE+ P    + Y LAA+KN+  A+ +
Sbjct  62    IQSLGNDVAAATAWVQNNVLNYFPDVKFRYIAVGNEIKPQDAEAKYVLAAMKNIKTAIAS  121

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +  IK STA    +L  +YPP  G F   A + + PI+ FLA N  P LAN+YPYF+
Sbjct  122   ANLQDQIKVSTAIDMSLLGSSYPPSTGSFSAAASSYINPIIAFLASNGSPFLANVYPYFS  181

Query  662   RTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
                D   + L +ALF+      ++      NLF A +++ Y+A+EKAGGS+V+IVVSETG
Sbjct  182   YISDTKDISLGYALFAAPGVTVQDGAFGYTNLFAAAVDALYSALEKAGGSSVEIVVSETG  241

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPSEGG  A+  NA TYYKNLI  V+G  GT KR G  +ETYLFAMFDEN K       +
Sbjct  242   WPSEGGEGATVENASTYYKNLIDSVKG--GTPKRRGKPVETYLFAMFDENQK----GPAE  295

Query  1007  TERHFGLFTPDMMSKYNLS  1063
              ERHFGLF+PD   KY +S
Sbjct  296   IERHFGLFSPDKQPKYQIS  314



>emb|CAN71821.1| hypothetical protein VITISV_027077 [Vitis vinifera]
Length=335

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 215/332 (65%), Gaps = 19/332 (6%)
 Frame = +2

Query  83    IAAILLLIGFLH--IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +AAI L +G L   I G QS GVCYG + +NLP+A   + L +  GI  +R+++P     
Sbjct  4     MAAIFLFLGLLMPTITGAQSTGVCYGTLADNLPSAPEVVQLCQRRGIDKMRIFDPKPETL  63

Query  257   DALRGSNIDVIVDVPNDMLPALANF-NAAYYWVQRNIVPY-PNVNFKYVAVGNEVYP--G  424
             +ALRGS I +I+ VPN  L ALA+  NAA  WV+ N+V Y  +V+   +AVGNEV P  G
Sbjct  64    EALRGSGIRLILGVPNVNLQALASTPNAATDWVKSNVVTYASDVDIWCIAVGNEVSPING  123

Query  425   KTG--SDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              T   + Y L A++N+ +AL+AA  G IK STA+ + +L  +YPP  G F D A + + P
Sbjct  124   ATSQFAQYVLPAMQNIQSALVAAGLGQIKVSTASSAELLGSSYPPSQGAFSDGASSFIDP  183

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLES  763
             I+ FL  NN   LAN+YPYFA  GDP +VQL +ALF+       +      NLFDAM+++
Sbjct  184   IIGFLVNNNSTFLANVYPYFAHIGDPVNVQLSYALFTSPGVVVHDGQYGYQNLFDAMVDA  243

Query  764   FYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHI  943
             FYAA+EKAGG+ + IV+SE+GWPS+GG  A+  NA+TYY NL+ HV    GT KRP   +
Sbjct  244   FYAALEKAGGTALDIVISESGWPSDGGVAATMENAKTYYTNLVYHVM--RGTPKRPEKAL  301

Query  944   ETYLFAMFDENNKTVKPNNDQTERHFGLFTPD  1039
             +TYLFA+FDEN K       ++ERHFGLF P+
Sbjct  302   DTYLFALFDENQKP----GPESERHFGLFFPN  329



>sp|P23431.1|E13B_NICPL RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
basic; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAA38540.1| precusor b-1,3-glucanse [Nicotiana plumbaginifolia]
Length=365

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 222/340 (65%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG +SIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASSIEIAGAESIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+  + PI
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFVDPI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY KNLIQH +     + RP   IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLKNLIQHAKEGSPRKPRP---IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  347



>sp|P52396.1|E13I_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
PR-N; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
partial [Nicotiana tabacum]
 gb|AAA34105.1| PRN, partial [Nicotiana tabacum]
Length=275

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 201/279 (72%), Gaps = 9/279 (3%)
 Frame = +2

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIV-PYPNVNFKYVAVGNEVYPG  424
             NVF+ALRGSNI++I+DVP   L +L + + A  WVQ NI+  +P+V FKY+AVGN+V PG
Sbjct  1     NVFNALRGSNIEIILDVPLQDLQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNKVSPG  60

Query  425   KTG--SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
               G  + +   A++NV+ AL AA  +  IK STATYSG+L +TYPP++ +F+ E  + + 
Sbjct  61    NNGQYAPFVAPAMQNVYNALAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFIN  120

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSY-SEENNLFDAMLESFYA  772
             PI+QFL Q+NLPLLAN+YPYF    +   V L +ALF++  +  +   NLFDA+L+S Y 
Sbjct  121   PIIQFLVQHNLPLLANVYPYFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYF  180

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             AVEKAGG NV+I+VSE+GWPSEG   A+  NA+TYY+NLI HV+   GT K+PG  IETY
Sbjct  181   AVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGKAIETY  240

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             LFAMFDENNK      D TE+HFGLF+PD  +KY L+FN
Sbjct  241   LFAMFDENNKE----GDITEKHFGLFSPDQRAKYQLNFN  275



>sp|P15797.2|E13B_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
basic; Flags: Precursor [Nicotiana tabacum]
Length=371

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  18    LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  77

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  78    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  136

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+    PI
Sbjct  137   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFTDPI  196

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  197   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  256

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  257   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  313

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN++F
Sbjct  314   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNINF  348



>gb|ABD85024.1| beta-1,3-glucanase [Lilium hybrid division VII]
Length=337

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 217/334 (65%), Gaps = 15/334 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +A++L+++  +   GV+SIGVC G  G+NLP     + LYK+  I G+RLY PD     A
Sbjct  12    MASLLVVLSAIP-RGVESIGVCNGMDGDNLPQPADVVNLYKSNNIAGMRLYRPDQATLQA  70

Query  263   LRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSD  439
             L+GSNI +I+DVPN  L  +A + +AA  WVQ N+  YPNV F+Y+AVGNEV PG   + 
Sbjct  71    LQGSNIYLILDVPNSDLQNIASDQSAATNWVQTNVQAYPNVAFRYIAVGNEVIPGGQ-AQ  129

Query  440   YALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQ  619
             Y L A+ N+ +AL +A    IK ST+   GV+  +YPP  G F  +A + + PI+QFLA 
Sbjct  130   YVLPAMNNIQSALSSAGLQNIKVSTSVSFGVVGTSYPPSAGSFSSDASSTLGPIIQFLAS  189

Query  620   NNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEK  784
             N  PLLANIYPY +  G+   + L +ALF+   +  ++     NNLFDAM+++ Y+A+E 
Sbjct  190   NGSPLLANIYPYLSYAGNSGSIDLSYALFTASGTVVQDGSYAYNNLFDAMVDALYSALES  249

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             AGG NV +VVSE+GWPS GG  A+  NA+TY  NLI HV    GT KRPG+ IETY+FAM
Sbjct  250   AGGPNVPVVVSESGWPSAGGTAATVSNAQTYNSNLINHV--GQGTPKRPGA-IETYIFAM  306

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             F+E+ K  +P     E +FGLF P+    Y++SF
Sbjct  307   FNEDQK--QPQG--IENNFGLFYPNEQPVYSISF  336



>sp|P07979.3|GUB_NICPL RecName: Full=Lichenase; AltName: Full=Endo-beta-1,3-1,4 glucanase; 
Flags: Precursor [Nicotiana plumbaginifolia]
 gb|AAA51643.3| beta-glucanase precursor [Nicotiana plumbaginifolia]
Length=370

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 225/342 (66%), Gaps = 21/342 (6%)
 Frame = +2

Query  83    IAAILLL---IGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             +AAI+LL   +    I G QS+GVCYG +GNNLP A+  + LYK+  IR +RLY+P+   
Sbjct  12    MAAIILLGLLVSSTEIVGAQSVGVCYGMLGNNLPPASQVVQLYKSKNIRRMRLYDPNQAA  71

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
               ALRGSNI+V++ VPN D+    AN + A  WVQRN+   +P V F+Y+AVGNEV P  
Sbjct  72    LQALRGSNIEVMLGVPNSDLQNIAANPSNANNWVQRNVRNFWPAVKFRYIAVGNEVSPVT  131

Query  428   TGSD---YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
               S    Y L A++N+  A+ +A  +  IK S++    ++ +++PP  G F+++ ++ + 
Sbjct  132   GTSSLTRYLLPAMRNIRNAISSAGLQNNIKVSSSVDMTLIGNSFPPSQGSFRNDVRSFID  191

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PI+ F+ + N PLL NIYPYF+  G+P  + LP+ALF+  N   ++      NLFDAM +
Sbjct  192   PIIGFVRRINSPLLVNIYPYFSYAGNPRDISLPYALFTAPNVVVQDGSLGYRNLFDAMSD  251

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             + YAA+ +AGG +++IVVSE+GWPS G   A+  NA TYYKNLIQHV+   G+ +RP   
Sbjct  252   AVYAALSRAGGGSIEIVVSESGWPSAGAFAATTNNAATYYKNLIQHVK--RGSPRRPNKV  309

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETYLFAMFDENNK     N + E+HFGLF+P+   KY LSF
Sbjct  310   IETYLFAMFDENNK-----NPELEKHFGLFSPNKQPKYPLSF  346



>ref|XP_010273331.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273333.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Nelumbo 
nucifera]
Length=356

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 217/338 (64%), Gaps = 17/338 (5%)
 Frame = +2

Query  95    LLLIGFLHI-AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRG  271
             +LL+   +I AG Q IGVCYG +GNNLP+ +  + LY+   I+ +R+Y P+   F AL+G
Sbjct  23    VLLMAISNITAGAQRIGVCYGMLGNNLPSKSEVVALYEANNIQRMRVYAPNQEAFQALKG  82

Query  272   SNIDVIVDVPNDMLPALA--NFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDY  442
             SNI+V++ VPN  L  +A  +   AY +V  N+V   + +NF Y+ VGNEV        Y
Sbjct  83    SNIEVMLGVPNQDLQRIAGSDLTPAYDFVYGNVVANKDTINFNYILVGNEV--DLKYFQY  140

Query  443   ALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQ  619
              L A+KN+ +A+  A  +  +K +TAT+SGVLD TYPP N VF+ E    M PI+ FLA+
Sbjct  141   VLPAMKNIQSAVETAGLQDRVKVTTATHSGVLDKTYPPSNSVFRSEYLQFMRPIIGFLAE  200

Query  620   NNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFYAAVEK  784
                PL ANIYPYFA  G+P  ++L +ALF+   +   ++     NLFDA+L+SFYAAVEK
Sbjct  201   KGSPLCANIYPYFAYIGNPSSIRLDYALFTAPEAVVSDDQLNYHNLFDALLDSFYAAVEK  260

Query  785   AGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
              GG +V+IVVSETGWP+ G   A+  NA+TY   LIQHV+G  GT +RP   IE Y+FAM
Sbjct  261   EGGGSVKIVVSETGWPNAGESAATTANAQTYLNGLIQHVKG--GTPRRPNGPIEAYIFAM  318

Query  965   FDENNK---TVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             FDEN K     +     TERH+GLF P+   KY +SF+
Sbjct  319   FDENEKPPLKTETEAMTTERHYGLFNPNQNPKYQISFS  356



>ref|XP_010279591.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=348

 Score =   286 bits (733),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 213/324 (66%), Gaps = 17/324 (5%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G QSIGVCYG +GNNLP +   + L+K   I+ +RLY+P+ +   AL+GSNI+V++ VPN
Sbjct  33    GAQSIGVCYGMLGNNLPPSNEVVDLFKANNIQMVRLYDPNRDALQALKGSNIEVMLGVPN  92

Query  305   DMLPALA--NFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
               L   A  +   A+ +V  N+V     + FKY+ VGNEV        Y L A++NV  A
Sbjct  93    SDLQRFAGGDLTPAFNFVYGNVVDNRDTIKFKYIVVGNEV--SLEDFKYVLPAMRNVQRA  150

Query  476   LLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYP  652
             +  A  +  +K +TATYSGVLD+T+PP N VF+ E    M PI+ FLA+   PL ANIYP
Sbjct  151   VEQAGLQNLVKVTTATYSGVLDNTFPPSNSVFRAEYLQYMQPIIGFLAEKGSPLCANIYP  210

Query  653   YFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVS  817
             YF+ +G+P  ++L +ALF+  +  +E+      NLFDA+L+S YAAVEKAGG +V+IVVS
Sbjct  211   YFSYSGNPASIRLDYALFTAQSDVAEDGQLRYRNLFDALLDSMYAAVEKAGGGSVKIVVS  270

Query  818   ETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             E+GWP+ G   A+  NA+TY   LIQHV+G  GT +RP   IETY+FAMFDEN K     
Sbjct  271   ESGWPNAGESAATTPNAQTYLNGLIQHVKG--GTPRRPNGPIETYIFAMFDENTKP----  324

Query  998   NDQTERHFGLFTPDMMSKYNLSFN  1069
               +TERHFGLF+P+   KY ++FN
Sbjct  325   GAETERHFGLFSPNKQPKYQINFN  348



>ref|NP_001234805.1| glucan endo-1,3-beta-glucosidase B precursor [Solanum lycopersicum]
 ref|XP_004229005.1| PREDICTED: glucan endo-1,3-beta-glucosidase B [Solanum lycopersicum]
 sp|Q01413.1|E13B_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase B; AltName: Full=(1->3)-beta-glucan 
endohydrolase B; Short=(1->3)-beta-glucanase 
B; AltName: Full=Basic beta-1,3-glucanase; AltName: Full=Beta-1,3-endoglucanase 
B; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03618.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=360

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 223/342 (65%), Gaps = 25/342 (7%)
 Frame = +2

Query  89    AILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             AI++L+G L     HI   Q IGVCYG +GNNLP+ +  I LYK+  IR LRLY+P+   
Sbjct  7     AIIVLLGLLVATNIHITEAQ-IGVCYGMMGNNLPSHSEVIQLYKSRNIRRLRLYDPNHGA  65

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGK  427
              +ALRGSNI+VI+ +PN D+    +    A +WVQ+N+   +P+V  KY+AVGNE+ P  
Sbjct  66    LNALRGSNIEVILGLPNVDVKHISSGMEHARWWVQKNVRDFWPHVKIKYIAVGNEISPVT  125

Query  428   TGSDYA---LAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
               S+ A   + AL N++ A+  A  G  IK ST+    ++ ++YPP  G F+++ +    
Sbjct  126   GTSNLAPFQVPALVNIYKAIGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTD  185

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PIV FL     PLL NIYPYF+ +G+P  + LP+ALF+  N   ++      NLFDAML+
Sbjct  186   PIVGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLD  245

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             S YAA+++ GG +V IVVSE+GWPS G   A+H NA+TY +NLIQH +   G+ ++PG  
Sbjct  246   SVYAAMDRTGGGSVGIVVSESGWPSAGAFGATHENAQTYLRNLIQHAK--EGSPRKPGP-  302

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETY+FAMFDENNK     N + E+HFG+F+P+   KYNL+F
Sbjct  303   IETYIFAMFDENNK-----NPELEKHFGMFSPNKQPKYNLNF  339



>ref|XP_004251356.2| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N 
[Solanum lycopersicum]
Length=339

 Score =   286 bits (732),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 209/332 (63%), Gaps = 12/332 (4%)
 Frame = +2

Query  95    LLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGS  274
             +L++ +L I   Q IGVCYG+ GN+LP+    ++LY    I  ++ Y+P      AL+GS
Sbjct  12    MLVLTYLQIIDAQGIGVCYGKNGNDLPSTIDVVSLYLANNITKMKTYDPINETLPALKGS  71

Query  275   NIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----  439
              I+VI+D+PN  L +L +   A  WV  N+V Y   V  KY+ VGNEV P   G+     
Sbjct  72    EIEVILDIPNSQLQSLGDPQQADSWVTSNVVNYVQQVKIKYINVGNEVSPVNNGTSQFVP  131

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
             + L AL NV  ++  +  +  +K +TA  +G+L  TYPP    F+++    + PI++ L 
Sbjct  132   FLLPALTNVQQSITKSGLQDQVKVTTAIETGLLATTYPPSESAFREDTIGFIKPIIELLK  191

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFS-EVNSYSEENNLFDAMLESFYAAVEKA-G  790
             QNN PL ANIYPYF   GDP HV LP+ALF+ E    S   NLFDAML+S Y A++KA G
Sbjct  192   QNNAPLQANIYPYFGYIGDPAHVTLPYALFTQEQPDPSGYTNLFDAMLDSVYYAIDKAIG  251

Query  791   GSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFD  970
              +N++IVVSE+GWPSEGG  A+  NA T+Y  LI+H + N+GT  RPG  I+TYLFAMFD
Sbjct  252   ENNIEIVVSESGWPSEGGLGATVENAATFYTKLIEHAKSNNGTLHRPGKPIQTYLFAMFD  311

Query  971   ENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             EN K       +TE+HFG+F P+   KYN++F
Sbjct  312   ENLKI----GAETEKHFGVFHPNKTQKYNITF  339



>dbj|BAA77783.1| beta 1,3-glucanase [Oryza sativa]
 dbj|BAB85418.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 gb|EAY77171.1| hypothetical protein OsI_05141 [Oryza sativa Indica Group]
 dbj|BAG97001.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63911.1| hypothetical protein OsJ_18736 [Oryza sativa Japonica Group]
Length=330

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 220/338 (65%), Gaps = 23/338 (7%)
 Frame = +2

Query  83    IAAILLLIGFLHIAG----VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A++L L   L +A     VQSIGVCYG IGNNLP+ +  + LYK+ GI  +R+Y P ++
Sbjct  6     VASVLTLALVLGVAAIPTVVQSIGVCYGVIGNNLPSPSDVVQLYKSNGIDSMRIYFPRSD  65

Query  251   VFDALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
             +  AL GS+I + +DV ND L +LA + +AA  +VQ NI  +P VNF+Y+ VGNEV  G 
Sbjct  66    ILQALSGSSIALTMDVGNDQLGSLASDPSAAAAFVQNNIQAFPGVNFRYITVGNEVSGGD  125

Query  428   TGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
             T     L A++N+++AL AA  G IK ST+   GV    +PP  G F   + + M PI Q
Sbjct  126   T--QNILPAMQNMNSALSAAGLGNIKVSTSVSQGV-TAGFPPSAGTF---SASHMGPIAQ  179

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             +LA    PLLAN+YPYFA  G+   + + +ALF+   +  ++      NLFDA++++FY+
Sbjct  180   YLASTGAPLLANVYPYFAYVGNQAQIDINYALFTSPGTVVQDGGNAYQNLFDAIVDTFYS  239

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E AG  +V IVVSE+GWPS GG  AS GNA+TY +NLI HV    GT KRPGS IETY
Sbjct  240   ALESAGAGSVPIVVSESGWPSAGGTAASAGNAQTYNQNLINHV--GQGTPKRPGS-IETY  296

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +FAMF+EN K      D+TERHFGLF PD    Y+++F
Sbjct  297   IFAMFNENQK----GGDETERHFGLFNPDQSPAYSINF  330



>ref|XP_002277446.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=340

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 217/340 (64%), Gaps = 24/340 (7%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +AA+LLL G L     I G Q IGVCYGR GNNLP     + LY  Y IR +RLY+   +
Sbjct  14    MAAMLLLFGLLMASLEITGAQ-IGVCYGRNGNNLPAPGEVVALYNQYNIRRMRLYDTRQD  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                AL GSNI++I+ VPND L  +A+  A A  WVQ NI  + NV F+Y+AVGNEV P  
Sbjct  73    ALQALGGSNIELILGVPNDNLQNIASSQANADSWVQDNIKNHLNVKFRYIAVGNEVSPSG  132

Query  428   TGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               + + L A++N++ A+ +A  G  IK STA  +GVL  +YPP +G FK    + +  I+
Sbjct  133   AQAQFVLPAMQNINNAISSAGLGNQIKVSTAIDTGVLGVSYPPSSGSFKSGVLSFLTSII  192

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
              FL +NN PLL N+YPYF+     D   L +ALF+      ++      NLFDA+L++ Y
Sbjct  193   SFLVKNNAPLLVNLYPYFS-----DLSNLNYALFTAPGVVVQDGQLGYKNLFDAILDAVY  247

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             +A+E+AGGS+++IVVSE+GWPS GG   +  NA TY  NLIQHV+G  GT KRP   IET
Sbjct  248   SALERAGGSSLKIVVSESGWPSAGGTQTTVDNARTYNSNLIQHVKG--GTPKRPTGPIET  305

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMFDE+NKT      + E+H+GLF P+   KY ++FN
Sbjct  306   YVFAMFDEDNKT-----PELEKHWGLFLPNKQPKYTINFN  340



>dbj|BAF95876.1| beta 1-3 glucanase [Vitis hybrid cultivar]
Length=345

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 216/340 (64%), Gaps = 19/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A +LL+ G L    H+   Q+ GVCYG  G+NLP     + LY  Y IR +RLY+P+  
Sbjct  14    MATLLLVFGLLMASLHLTVAQT-GVCYGMQGDNLPPPGQVVGLYNQYSIRRMRLYDPNQA  72

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                ALRGSNI++++ VPND L  +A+    A  WVQ NI  Y NV F+YVAVGNEV P  
Sbjct  73    ALQALRGSNIELMIGVPNDALQNIASSQGNANSWVQNNIKNYGNVRFRYVAVGNEVSPTG  132

Query  428   TGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
               + + L A++N+  A+ AA  G  IK STA  + VL  +YPP  G FK E  + + PI+
Sbjct  133   PTAQFVLPAMRNIFNAISAAGLGNQIKVSTAIDTRVLGTSYPPSKGAFKPEVTSFLNPII  192

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
              FL  N  PLL N+YPYF+  G+   ++L +ALF       ++      NLFDA+L++ Y
Sbjct  193   SFLVNNRAPLLVNLYPYFSYIGNTRDIRLDYALFKAPGVVVQDGQLGYRNLFDAILDAVY  252

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             +A+E+AGG ++Q+V+SE+GWPS GG   +  NA+TY  NLIQHV+G  GT K+PG  IET
Sbjct  253   SALERAGGGSLQVVISESGWPSAGGTATTVDNAKTYNSNLIQHVKG--GTPKKPGGPIET  310

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMF+EN K+      + E+H+GLF+P+   KY ++FN
Sbjct  311   YVFAMFNENRKS-----PEYEKHWGLFSPNKQPKYPINFN  345



>ref|XP_003607328.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AES89525.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=361

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 209/319 (66%), Gaps = 15/319 (5%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QS+GVCYGR+ NNLP+A   I LYK  GI  +R+Y+PD    +ALRGSNI++++ V N+ 
Sbjct  20    QSLGVCYGRVANNLPSAEEVIDLYKINGIGRMRIYDPDQATLEALRGSNIELVIGVRNED  79

Query  311   LPALA-NFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTG-SDYALAALKNVHAALL  481
             + ++A + ++A  WVQ NI+ Y  +V F+Y+ VGNE+ P     S + L A++N++ AL 
Sbjct  80    IQSIAYSVSSATNWVQNNILKYSQDVKFRYIVVGNEINPSNDATSKFVLLAMQNIYTALA  139

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             ++N +  IK STA    +L  +YPP  GVF   + + + PIV+FL  N  PLLAN+Y YF
Sbjct  140   SSNLQNQIKVSTAIQMNLLGSSYPPSQGVFSPSSISYIIPIVKFLVDNEAPLLANVYTYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +   D   + L FALF+       +      NLFDA L + YAA+EK GG+N+++VVSE+
Sbjct  200   SYISDTKDIDLSFALFTSTTIKVHDGQYAYQNLFDATLGALYAALEKIGGANLEVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS+GG  AS  NA+ Y++NLI+HV    GT  RP   +ETYLFAMFDENNK      D
Sbjct  260   GWPSDGGVAASIENAQIYHENLIKHVI--TGTPNRPNQALETYLFAMFDENNK----GPD  313

Query  1004  QTERHFGLFTPDMMSKYNL  1060
             +TERH+GLFTPD   KY +
Sbjct  314   ETERHYGLFTPDKQIKYQI  332



>ref|XP_007015137.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32756.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=347

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 211/324 (65%), Gaps = 13/324 (4%)
 Frame = +2

Query  119   IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDV  298
             I G  +IGVC G I +NLPN    + LY + GI  +R+Y+P+     ALRG+NI++I+ V
Sbjct  30    ITGAGAIGVCNGGIADNLPNEQEVVDLYTSNGIGKMRIYDPNQATLQALRGTNIELILGV  89

Query  299   PNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
             PN  L ++A  +AA  WVQ+N+V + P+V F+Y+AVGNEV P    + + L A+ N++ A
Sbjct  90    PNGDLQSVATASAANDWVQKNVVAFSPDVRFRYIAVGNEVKPTDAAAQFVLPAMMNIYNA  149

Query  476   LLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYP  652
             L++A   G +K ST+  + +L ++YPP  G F   A + + PI+ FLA    PLLANIY 
Sbjct  150   LVSAKLDGQMKVSTSVDTTLLGNSYPPSAGSFSASASSYITPIINFLASTGAPLLANIYT  209

Query  653   YFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVS  817
             YFA   DP  +   +ALF+   +  ++      NLFDA L++FY+AVE A G+NV+IVVS
Sbjct  210   YFAYISDPKTIDPSYALFTAQGTVVQDGALGYQNLFDATLDAFYSAVEAAEGANVEIVVS  269

Query  818   ETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             E+GWPS G   A+  NA TYYKNL+ HV  N GT KRPG  IETYLFAMFDEN K     
Sbjct  270   ESGWPSAGETAATVDNASTYYKNLVDHV--NKGTPKRPGKPIETYLFAMFDENQK----G  323

Query  998   NDQTERHFGLFTPDMMSKYNLSFN  1069
               +TERHFGLF+P+   KY +SF+
Sbjct  324   PAETERHFGLFSPNKQPKYKISFS  347



>ref|XP_006599939.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=587

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 207/334 (62%), Gaps = 15/334 (4%)
 Frame = +2

Query  83    IAAILLLIGFLH--------IAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYE  238
             ++AILLL+G L          A  Q +G+CYG  GNNLP+    + LYK+ GI  +R+Y 
Sbjct  259   VSAILLLVGILSSIRVLEFTAAQTQVVGICYGVNGNNLPSKQEVVDLYKSKGIPRMRIYS  318

Query  239   PDTNVFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEV  415
             PD     ALRGSNI++ +DV  + L +L + N A  WV R +  Y  +VNFKY+ VGNEV
Sbjct  319   PDEETLQALRGSNIELTMDVTGETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEV  378

Query  416   YPGKTGSDYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
             +P    + Y L A+ N+  A+ +AN    K STA  + ++  +YPP NGVF  +A   + 
Sbjct  379   HPNYDVAPYILPAMTNIQNAISSANLQ-TKVSTAIDTTLVTDSYPPNNGVFTADASPYIG  437

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYA  772
             PI+ FL  N  PLLAN+YPYFA   +   + LP+ALF++  +      NLFDAML+S YA
Sbjct  438   PIINFLVNNGAPLLANVYPYFAYVNNQQDISLPYALFTQQGTNDIGYQNLFDAMLDSIYA  497

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK G  N++IVVSE+GWPS GG  A   NA  YY NL+ H  G  GT KRPG  I+T+
Sbjct  498   ALEKIGAPNLEIVVSESGWPSAGGDGALVDNARIYYYNLLNHANGEIGTPKRPGRPIQTF  557

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKY  1054
             LFAMFDEN K       +TERHFGLF PD  SKY
Sbjct  558   LFAMFDENQKP----GAETERHFGLFNPDKSSKY  587



>ref|XP_010921891.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 211/322 (66%), Gaps = 16/322 (5%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GV+SIGVCYG  GNNLP  +A + LYK+  I  +RLY+P+     AL+GSNI +I+DVPN
Sbjct  25    GVKSIGVCYGMNGNNLPQPSAVVNLYKSKNINAMRLYDPNQAALQALKGSNIQLILDVPN  84

Query  305   DMLPALANF-NAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
               L +LA+  +AA  WVQ+N+  Y + V+FKY+AVGNEV PG   + Y L A++N+++AL
Sbjct  85    TRLQSLASSPSAANNWVQQNVKAYSSGVSFKYIAVGNEVIPGAE-AQYVLPAMRNIYSAL  143

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK STA  + VL  ++PP  G F   A   + PIVQFLA N  PLL N+YPY
Sbjct  144   SSAGLQNQIKVSTAVATSVLGKSFPPSQGAFSSAAMTYLSPIVQFLASNGAPLLVNVYPY  203

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             F+   +P+ + + +ALF+   +   +      NLFDA++++ YAA+EK GGSNV IVVSE
Sbjct  204   FSYVNNPNQINIEYALFTSPGTVVTDGQYKYQNLFDAIVDAIYAALEKVGGSNVAIVVSE  263

Query  821   TGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             +GWPS GG  A+  NA+TY +NLI HV    GT +R G  IE Y+F MF+EN K+     
Sbjct  264   SGWPSAGGTAATINNAKTYNQNLINHV--GQGTPRRSGKAIEAYIFEMFNENLKS-----  316

Query  1001  DQTERHFGLFTPDMMSKYNLSF  1066
                E++FGLF P+M   Y ++F
Sbjct  317   SGIEQNFGLFYPNMQPVYPINF  338



>gb|AHW57401.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 218/338 (64%), Gaps = 18/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             I +  LL+  L    A V +IGVCYGR+GNNLP     + LYK   I  +R+Y+P+  V 
Sbjct  10    IYSTALLVSVLTAVPASVSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVL  69

Query  257   DALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
              ALRGSNI ++VDVPN D+    ++ +AA  WVQRN+V + P+V+F+Y+AVGNEV PG  
Sbjct  70    QALRGSNIQLVVDVPNEDLQSLASDASAASKWVQRNVVAFRPSVSFRYIAVGNEVIPGGL  129

Query  431   GSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A++NV  A+ AA  +  IK ST+  + VL  +YPP  G F   A+  M PIVQ
Sbjct  130   -AQYVLPAMQNVQKAVSAAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTYMNPIVQ  188

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA+N  PLL N+YPYF+   + + +   +ALF+      ++      NLFDAM+++ YA
Sbjct  189   FLAKNGAPLLVNVYPYFSYRDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYA  248

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK GGSNV IVVSE+GWPS G   A+  NA+TY +NLI+HV    GT ++ G+ IETY
Sbjct  249   AMEKVGGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRKSGAPIETY  306

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +FAMF+EN K     N + E+HFGLF P+    Y +SF
Sbjct  307   IFAMFNENQK-----NPELEKHFGLFNPNKQPVYPISF  339



>gb|AAD28732.1|AF112965_1 beta-1,3-glucanase precursor [Triticum aestivum]
Length=334

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 213/335 (64%), Gaps = 17/335 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +A  L+L+ F     V SIGVC G IGNNLP  +  + LY+  GI  +R+Y P++NV  A
Sbjct  10    LAVALVLVAFASFPAVHSIGVCNGVIGNNLPAPSDVVKLYQTKGIDAMRIYAPESNVLKA  69

Query  263   LRGSNIDVIVDVPNDMLPALANF-NAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSD  439
             L G+ I +++DV N  L +LAN  +AA  WV+ N+ P+P V+F+Y+AVGNEV     G  
Sbjct  70    LSGTGISLLMDVGNGALTSLANDPSAAPAWVKANVQPFPGVSFRYIAVGNEVT-DSAGQK  128

Query  440   YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
               L A+KN+  AL AA   G IK ST+    V+++T PP NGVF D +   M PI+ FLA
Sbjct  129   TILPAIKNIQTALAAAGLSGSIKVSTSLRFDVVNNTSPPSNGVFADTS--FMGPILDFLA  186

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEEN-----NLFDAMLESFYAAVE  781
                 PLL N+YPYFA  GD  +++L FA F   ++   +N     NLFDAM++S YAA+E
Sbjct  187   STGAPLLVNVYPYFAYKGDQQNIKLDFATFVPGSTTVTDNGLTYSNLFDAMVDSIYAALE  246

Query  782   KAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFA  961
             KAG  +V++V+SE+GWPS GG  A+  NA  Y + LI HV G  GT K+P S +ETY+FA
Sbjct  247   KAGKPDVKVVISESGWPSAGGVGATAQNARAYNQGLINHVRG--GTPKKP-SLLETYIFA  303

Query  962   MFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             MF+EN KT     D TE +FGLF PD    Y+++F
Sbjct  304   MFNENQKT----GDPTENNFGLFNPDKSPAYSVTF  334



>ref|XP_010921893.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 217/338 (64%), Gaps = 18/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHIA--GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +A I L++G L      VQSIGVCYG +GNNLP  +  + LYK+  I  +RLY P     
Sbjct  9     MAVIALVLGVLIATPTRVQSIGVCYGMVGNNLPKPSDVVNLYKSENIDAMRLYGPSQAAL  68

Query  257   DALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
              AL+ SNI +I+D PN  L + A N +AA  WVQ+N+  Y P V+FKY++VGNEV PG  
Sbjct  69    QALKDSNIQLILDAPNPDLRSFASNPSAANDWVQKNVKAYYPGVSFKYISVGNEVIPGDH  128

Query  431   GSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A++N+ +AL LA  +  IK STA  +GVL  +YPP  G F   A N + PI+ 
Sbjct  129   -AQYVLPAMRNIFSALCLAGLQDQIKVSTAVATGVLGTSYPPSAGAFSSNALNYLRPILG  187

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA +  PLL N+YPYF+  G+P+++ + FALF+ + ++  +      NLFDA++++ Y+
Sbjct  188   FLASSGAPLLVNVYPYFSYVGNPNNINIEFALFTSLGTFVMDGQHRYQNLFDAIVDAVYS  247

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK GGSNV IVVSETGWPS GG  AS  NA+ Y +NLI HV    GT KRPG  +ET+
Sbjct  248   AMEKEGGSNVPIVVSETGWPSAGGVAASINNAKIYNQNLIWHV--GQGTPKRPGRAVETF  305

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMF+EN K      +  E++FGLF P     Y ++F
Sbjct  306   LFAMFNENQKP-----EGIEKNFGLFYPSKQPVYPINF  338



>gb|AAA63541.1| basic beta-1,3-glucanase [Nicotiana tabacum]
Length=359

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  6     LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  65

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  66    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  124

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+  +  I
Sbjct  125   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFVDAI  184

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  185   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  244

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  245   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  301

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN++F
Sbjct  302   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNINF  336



>sp|P23546.1|E13E_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform GGIB50; AltName: Full=(1->3)-beta-glucan endohydrolase; 
Short=(1->3)-beta-glucanase; AltName: Full=Beta-1,3-endoglucanase, 
basic; AltName: Full=Glucanase GLA; Flags: Precursor 
[Nicotiana tabacum]
Length=370

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 224/340 (66%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  17    LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  76

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  77    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  135

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+  +  I
Sbjct  136   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFVDAI  195

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  196   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  255

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY +NLIQH +   G+ ++PG  IE
Sbjct  256   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK--EGSPRKPGP-IE  312

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN++F
Sbjct  313   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNINF  347



>ref|XP_011083774.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Sesamum indicum]
Length=343

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 215/340 (63%), Gaps = 21/340 (6%)
 Frame = +2

Query  92    ILLLIGFLHIA----GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ++ ++G L +      V   GVCYGR+GNNLP+++  + LY    IR +R+Y+P      
Sbjct  11    VMFILGLLIMVSLDFAVAQTGVCYGRLGNNLPSSSDVVALYNQNNIRRMRIYDPHQPTLQ  70

Query  260   ALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYP--GKT  430
             ALRGSNI++++ VPN  L  +A   A A  WVQ N+  YPNV F+Y+AVGNEV P  G T
Sbjct  71    ALRGSNIELMLGVPNTDLQNVAASQANANTWVQNNVRNYPNVRFRYIAVGNEVSPLRGDT  130

Query  431   GS--DYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
                  + L AL+N+  A+ AA  G  IK STA  +GVL + YPP +GVF+ +    +  I
Sbjct  131   SQYVQFVLPALQNIQNAISAAGLGNQIKVSTAVETGVLGNAYPPADGVFRPKVAQYLNGI  190

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE----VNSYSEENNLFDAMLESFY  769
             ++FL  N  PLL NIYPYF+   +   + L +ALF+     V       NLF A+L++ Y
Sbjct  191   IRFLVNNRAPLLVNIYPYFSYISNKAQISLQYALFTSDGVVVPGGIRYQNLFYAILDAMY  250

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             AA+EK+GGS+++IVVSE+GWPS GG   S  NA TY  NLIQ V+  +GT KRPG  IET
Sbjct  251   AALEKSGGSSLEIVVSESGWPSAGGDSTSIDNARTYNTNLIQRVK--NGTPKRPGRAIET  308

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMFDEN K     N + E+HFG+F+PD  +KY ++FN
Sbjct  309   YIFAMFDENQK-----NPEYEKHFGIFSPDRRAKYPINFN  343



>emb|CBH32608.1| glucan endo-1,3-beta-glucosidase GII precursor,putative, expressed 
[Triticum aestivum]
 emb|CDM86334.1| unnamed protein product [Triticum aestivum]
Length=337

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 213/333 (64%), Gaps = 17/333 (5%)
 Frame = +2

Query  89    AILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALR  268
             A+ +L+        QSIGVC G IGNNLP  +  + LYK+ GI  +R+YEP++NV  AL 
Sbjct  15    ALFVLVALAAFPAAQSIGVCNGVIGNNLPAPSDVVKLYKSKGINAMRIYEPESNVLKALS  74

Query  269   GSNIDVIVDVPNDMLPALANF-NAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYA  445
             G+ I +++DV N  L +LAN  +AA  WV+ N+ PYP V+F+Y+AVGNEV     G    
Sbjct  75    GTGIGLLMDVGNGALTSLANDPSAAPAWVKANVQPYPGVSFRYIAVGNEVM-DSAGQKTI  133

Query  446   LAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNN  625
             L A+KNV AAL AA  G IK ST+    V+ +T+PP NGVF D   + M PI+  LA   
Sbjct  134   LPAMKNVQAALTAAGLGSIKVSTSLRFDVVTNTFPPSNGVFAD--LDYMGPILDSLASTG  191

Query  626   LPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE------NNLFDAMLESFYAAVEKA  787
              PLLAN+YPYFA  GDP +++L +A F    + +++       NLFDAM++S YAA+E A
Sbjct  192   APLLANVYPYFAYKGDPQNIKLNYATFVPGTTVNDDGNGLTYTNLFDAMVDSIYAALEDA  251

Query  788   GGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMF  967
                 +++VVSE+GWPS  G  A+  NA+ Y + LI+HV   +GT KR G  +ETYLFAMF
Sbjct  252   DKPGMKVVVSESGWPSASGFGATAQNAQAYNQGLIKHV--GNGTPKRSGP-LETYLFAMF  308

Query  968   DENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +EN KT +P    TE HFGLF PD    Y++SF
Sbjct  309   NENLKTGEP----TENHFGLFNPDKSPAYSISF  337



>ref|XP_011090470.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=404

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 211/322 (66%), Gaps = 21/322 (7%)
 Frame = +2

Query  134   SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDML  313
             SIGVC GR+G++LP     + LYK  GI+ +R+Y+P+     AL+GS I++++DVPN  L
Sbjct  8     SIGVCNGRLGSDLPPEQEVVELYKTSGIKRMRIYDPNQATLTALQGSGIELVLDVPNADL  67

Query  314   PALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYA---LAALKNVHAALL  481
              +L +   A +WVQ N+V Y P    +Y+AVGNEV P K  S +    L A++N++ AL 
Sbjct  68    ESLQS--DATHWVQTNVVQYFPATRIRYIAVGNEVDPEKETSGFVPLVLPAMQNIYKALS  125

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
                 +  IK STATYS +L +T PP N +FKD A   M PI+ FLAQ   PLLANIYPYF
Sbjct  126   QFGLQDQIKVSTATYSALLMNTSPPSNAIFKDMA--FMEPIISFLAQTRAPLLANIYPYF  183

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             A       V+LP+ALF+      ++      NLFDAM++  Y+A+EKAGG +V++VVSE+
Sbjct  184   AYIYS-QGVELPYALFTAPGVVVQDGPYGYQNLFDAMVDGVYSALEKAGGGDVEVVVSES  242

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS+GG  A+  NAETYY+NLI HV+   G+ KRPG  IETYLFAMFDENNK      +
Sbjct  243   GWPSDGGVAATRENAETYYRNLIDHVK--RGSPKRPGKAIETYLFAMFDENNKP----GE  296

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++E+HFGLF P+   KY    N
Sbjct  297   KSEQHFGLFYPNKQPKYQFILN  318



>gb|ADW08742.1| 1,3-beta-D-glucanase GH17_39 [Populus tremula x Populus tremuloides]
Length=338

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 218/336 (65%), Gaps = 18/336 (5%)
 Frame = +2

Query  92    ILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ILLL G     L ++  QSIGVCYG+ GNNLP+    ++L +   IR +R+Y+P+ +  +
Sbjct  9     ILLLFGLMISRLTLSDAQSIGVCYGKNGNNLPSDQEVVSLSQTMAIRRMRIYDPNRDTLE  68

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             ALRGSNI+VI+ VPND L +L + +AA  WVQ N+V Y  NV F+Y+AVGNEV PG   +
Sbjct  69    ALRGSNIEVILGVPNDKLQSLTDASAATTWVQDNVVAYSSNVRFRYIAVGNEVPPGDANA  128

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
                L A++N+H A+ +AN +  IK STA  + +L  +YPP  G F   A + + PI+ FL
Sbjct  129   QSVLPAMQNIHNAIASANLQDQIKVSTAIDTTLLGSSYPPSAGSFSAGASSFINPIINFL  188

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
               N  PLLAN+YPYF    DP ++ L +ALF+      ++      NLFDA+L++ YAA+
Sbjct  189   RTNGSPLLANVYPYFGYRDDPQNIDLSYALFTSPGVVVQDGQYGYQNLFDALLDALYAAL  248

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             EKAG  ++ IVVSE+GWPSEGG   +  NA T+Y+NLI H +   GT +R G  IETYLF
Sbjct  249   EKAGAPDLNIVVSESGWPSEGGTATTVENAGTFYRNLINHAK--QGTPRRSGQAIETYLF  306

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN   +KP     E+HFGLF P+   KY L+F
Sbjct  307   AMFDEN---LKPAG--IEQHFGLFLPNKQPKYQLTF  337



>gb|AFJ97274.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 217/338 (64%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLLI F    G+    +GVCYG  GNNLP+ +  I LYK   I+ +R+Y+P+  V +AL
Sbjct  21    MLLLIFFTASLGITDAQVGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDPNRAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEISPVNGGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDKIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+ +  PLLANIYPYF    +P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSSRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



>gb|AIS22073.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 218/338 (64%), Gaps = 18/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             I +  LL+  L    A V +IGVCYGR+GNNLP     + LYK   I  +R+Y+P+  V 
Sbjct  10    IYSTALLVSVLTAVPASVSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVL  69

Query  257   DALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
              ALRGSNI ++VDVPN D+    ++ +AA  WVQ+N+V + P+V+F+Y+AVGNEV PG  
Sbjct  70    QALRGSNIQLVVDVPNEDLQSLASDASAASKWVQKNVVAFRPSVSFRYIAVGNEVIPGGL  129

Query  431   GSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A++NV  A+ AA  +  IK ST+  + VL  +YPP  G F   A+  M PIVQ
Sbjct  130   -AQYVLPAMQNVQKAVSAAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTYMNPIVQ  188

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA+N  PLL N+YPYF+   + + +   +ALF+      ++      NLFDAM+++ YA
Sbjct  189   FLAKNGAPLLVNVYPYFSYRDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYA  248

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK GGSNV IVVSE+GWPS G   A+  NA+TY +NLI+HV    GT ++ G+ IETY
Sbjct  249   AMEKVGGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRKSGAPIETY  306

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +FAMF+EN K     N + E+HFGLF P+    Y +SF
Sbjct  307   IFAMFNENQK-----NPELEKHFGLFNPNKQPVYPISF  339



>ref|XP_002277193.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform [Vitis 
vinifera]
Length=334

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 218/339 (64%), Gaps = 18/339 (5%)
 Frame = +2

Query  83    IAAILL---LIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             +AA+LL   L+   HI G  + GVCYG +G+NLP     I LYK   I+ +R+Y P   V
Sbjct  2     VAAMLLFGLLVATFHITGANT-GVCYGLLGDNLPPPHEVIDLYKRNNIQKMRIYAPAPEV  60

Query  254   FDALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKT  430
               ALRGSNI+++V V N+ L ++A +   AY WVQ NI  Y NVNF+Y+AVGNE+ P   
Sbjct  61    LQALRGSNIELMVGVANEDLHSIATDMAKAYSWVQNNIRSYANVNFRYIAVGNEINPPAW  120

Query  431   GSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              ++Y L A+KN+H A+  A  G  IK ST   + VL  +YPP  G F+ +  + + PI+ 
Sbjct  121   EANYLLGAMKNIHQAITEAGLGNQIKVSTPFSAMVLGESYPPSKGSFRPDFGSFINPIIS  180

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA    P L N+YPYF+ +G+  ++ L +ALF+      ++      N+FDAML++ Y+
Sbjct  181   FLADTRAPFLFNMYPYFSYSGNTQYISLEYALFTSPGVMEQDGQFGYQNIFDAMLDAGYS  240

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EKAGG++++I+VSETGWP+ GG   +  NA TY  NL++HV+G  GT KRPG  I+TY
Sbjct  241   ALEKAGGASLEIIVSETGWPTAGGTATTIENARTYITNLLRHVKG--GTPKRPGKPIQTY  298

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             +FAMF+ENNK     N + E+H+GLF P+  S Y + F+
Sbjct  299   IFAMFNENNK-----NLELEKHWGLFYPNKQSVYQIEFS  332



>gb|ABG49448.1| beta-1,3-glucanase [Hevea brasiliensis]
 gb|ABN03965.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 216/338 (64%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLLI F    G+    +GVCYG  GNNLP+ +  I LYK   I+ +R+Y+P+  V +AL
Sbjct  21    MLLLIFFTASLGITDAQVGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEISPVNGGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF    +P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYADNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



>ref|XP_007203676.1| hypothetical protein PRUPE_ppa026579mg, partial [Prunus persica]
 gb|EMJ04875.1| hypothetical protein PRUPE_ppa026579mg, partial [Prunus persica]
Length=313

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 205/318 (64%), Gaps = 14/318 (4%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             IGVC G +G++LP     + LYK   I  +RLY+P+    +ALRGSNI +++ VPN+ L 
Sbjct  3     IGVCNGMVGDDLPPQAEVVALYKTNNIPRMRLYDPNPAALEALRGSNIKLLLGVPNENLQ  62

Query  317   ALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL-LAAN  490
              +A   A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A++N+  A+ LA  
Sbjct  63    YIALSQANANAWVQNNVRNYANVKFKYIAVGNEVKPSDSFAQFLVPAMRNIQEAISLAGL  122

Query  491   RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTG  670
                IK STA  +GVL  T+PP  G FK E   L+YPI++FL  +  PLL N+YPYFA +G
Sbjct  123   AKKIKVSTAIDTGVLGETFPPSIGSFKSEYNALLYPIIRFLVSHQSPLLVNLYPYFAYSG  182

Query  671   DPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPS  835
             +   ++L +ALF+  +   ++      NLFDAML+  YAA+EKAGG ++++V+SETGWPS
Sbjct  183   NTQDIRLDYALFTAPSVVVQDGNFGYRNLFDAMLDGVYAALEKAGGGSLKVVISETGWPS  242

Query  836   EGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTER  1015
               G   +  NA T+  NLIQHV+   GT +RPG  IETY+FAMFDEN KT      + E+
Sbjct  243   AAGTATTIDNARTFISNLIQHVK--EGTPRRPGRPIETYIFAMFDENRKT-----PELEK  295

Query  1016  HFGLFTPDMMSKYNLSFN  1069
             H+GLF+P    KY +SFN
Sbjct  296   HWGLFSPTKQPKYQISFN  313



>ref|XP_010921866.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=340

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 222/338 (66%), Gaps = 17/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             ++A +LL+G +     GVQSIGVCYG +GNNLP  +  + LYK+  I  +R+Y P+ +V 
Sbjct  9     MSATILLLGIVITIPTGVQSIGVCYGMVGNNLPQPSEVVELYKSKTIGRMRIYGPNADVL  68

Query  257   DALRGSNIDVIVDVPNDMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT  430
              AL+GSNI +I+DVP + L  LA + +AA  WVQ +I  Y P+V+F+Y+AVGNEV PG  
Sbjct  69    QALKGSNIGLILDVPKEDLQRLASDRSAASNWVQNHIKSYLPDVSFRYIAVGNEVIPGNY  128

Query  431   GSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + Y L A+ N+H+AL A+  +  IK ST+   GVL  +YPP +G F  +A   + PIV 
Sbjct  129   -AQYVLPAMNNIHSALSASGLQNQIKVSTSVSQGVLGTSYPPSSGTFSSDASKYLGPIVN  187

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FLA N  PLL N+YPYF+  G+   +++ +ALF+   +   +      NLFDA++++ Y+
Sbjct  188   FLASNGSPLLVNVYPYFSYIGNMKDIKIEYALFTSPGTVVNDPPYGYQNLFDALVDAIYS  247

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+EK  GSN+ IVVSE+GWPS  G  A+  NA+TY +NLI HV  + GT KRPG  IE Y
Sbjct  248   ALEKMKGSNIPIVVSESGWPSANGTAATMDNAKTYNQNLINHV--SRGTPKRPGKVIEAY  305

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             +FAMF+EN K  KP+   TE +FGLF P+    Y ++F
Sbjct  306   VFAMFNENEK--KPSG--TENNFGLFYPNKTPVYPINF  339



>ref|XP_006365200.1| PREDICTED: uncharacterized protein LOC102593111 [Solanum tuberosum]
Length=671

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 208/336 (62%), Gaps = 12/336 (4%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +A    + G       Q IGVCYG  GN+LP+    + LYK   I  +R Y+P T    A
Sbjct  340   LAGFRRVFGCCQSGDAQVIGVCYGMNGNDLPSPIDVVALYKANNITKMRTYDPITETLPA  399

Query  263   LRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD  439
             L+GS I+VI+D+PN  L +L +   A  WV  N++ Y   V  +Y+ VGNE+ P   G+ 
Sbjct  400   LKGSEIEVILDIPNSKLQSLGDPQEADNWVTTNVMSYAKEVKIRYINVGNEISPVNNGTS  459

Query  440   ----YALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
                 + L AL NV  ++  +  +  +K STA  +G+L +TYPP    F+++    + PI+
Sbjct  460   QFVPFLLPALTNVQQSITKSGLQDQVKVSTAIETGLLANTYPPSQSAFREDTMGFIKPII  519

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFS-EVNSYSEENNLFDAMLESFYAAVE  781
             +FL QNN PL ANIYPYF   GDP+HVQLP+ALF+ E    S   NLFDAML+S Y A++
Sbjct  520   EFLKQNNAPLQANIYPYFGYIGDPEHVQLPYALFTQEQPDPSGYTNLFDAMLDSVYYAID  579

Query  782   KA-GGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             KA G +NV+IVVSE+GWPS+GG  AS  NA TYYKNL+ H +   GT  RPG  IETYLF
Sbjct  580   KAIGENNVEIVVSESGWPSDGGVGASVENAATYYKNLMDHAKSTKGTIYRPGKPIETYLF  639

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K        TE+HFG+F PD   KYNL+F
Sbjct  640   AMFDENLKI----GADTEKHFGVFHPDKTQKYNLTF  671



>gb|AAP87281.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 216/338 (64%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLLI F    G+    +GVCYG  GNNLP  +  I LYK   I+ +R+Y+P+  V +AL
Sbjct  21    MLLLIFFTASLGITDAQVGVCYGMQGNNLPPVSEVIALYKQSNIKRMRIYDPNRAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVLFRYIAVGNEISPVNGGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



>sp|P52408.1|E13B_PRUPE RecName: Full=Glucan endo-1,3-beta-glucosidase, basic isoform; 
AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; AltName: 
Full=PpGns1; Flags: Precursor [Prunus persica]
 gb|AAA92013.1| beta-1,3-glucanase [Prunus persica]
Length=350

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 205/318 (64%), Gaps = 14/318 (4%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             IGVC G +G++LP     + LYK   I  +RLY+P+    +ALRGSNI +++ VPN+ L 
Sbjct  40    IGVCNGMVGDDLPPQAEVVALYKTNNIPRMRLYDPNPAALEALRGSNIKLLLGVPNENLQ  99

Query  317   ALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL-LAAN  490
              +A   A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A++N+  A+ LA  
Sbjct  100   YIALSQANANAWVQNNVRNYANVKFKYIAVGNEVKPSDSFAQFLVPAMRNIQEAISLAGL  159

Query  491   RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTG  670
                IK STA  +GVL  T+PP  G FK E   L+YPI++FL  +  PLL N+YPYFA +G
Sbjct  160   AKKIKVSTAIDTGVLGETFPPSIGSFKSEYNALLYPIIRFLVSHQSPLLVNLYPYFAYSG  219

Query  671   DPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPS  835
             +   ++L +ALF+  +   ++      NLFDAML+  YAA+EKAGG ++++V+SETGWPS
Sbjct  220   NTQDIRLDYALFTAPSVVVQDGNFGYRNLFDAMLDGVYAALEKAGGGSLKVVISETGWPS  279

Query  836   EGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTER  1015
               G   +  NA T+  NLIQHV+   GT +RPG  IETY+FAMFDEN KT      + E+
Sbjct  280   AAGTATTIDNARTFISNLIQHVK--EGTPRRPGRPIETYIFAMFDENRKT-----PELEK  332

Query  1016  HFGLFTPDMMSKYNLSFN  1069
             H+GLF+P    KY +SFN
Sbjct  333   HWGLFSPTKQPKYQISFN  350



>gb|ABN03966.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 215/339 (63%), Gaps = 20/339 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLL  F    G+    +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +AL
Sbjct  21    MLLLFFFTASVGITDAQVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI++
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVRNSYPPSAGAFRDDVRSYLNPIIR  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+   GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPKRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             LFAMFDEN K       + E+HFGLF P+   KYNL+F+
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPNKWQKYNLNFS  352



>ref|XP_007203263.1| hypothetical protein PRUPE_ppa025430mg [Prunus persica]
 gb|AAL30425.1|AF435088_1 beta-1,3-glucanase [Prunus persica]
 gb|EMJ04462.1| hypothetical protein PRUPE_ppa025430mg [Prunus persica]
Length=350

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 205/318 (64%), Gaps = 14/318 (4%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             +GVC G +G++LP     + LYK   I  +RLY+P+    +ALRGSNI +++ VPN+ L 
Sbjct  40    VGVCNGMVGDDLPPQAEVVALYKTNNIPRMRLYDPNPAALEALRGSNIKLLLGVPNENLQ  99

Query  317   ALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL-LAAN  490
              +A   A A  WVQ N+  Y NV FKY+AVGNEV P  + + + + A++N+  A+ LA  
Sbjct  100   YIALSQANANAWVQNNVRNYANVKFKYIAVGNEVKPSDSFAQFLVPAMRNIQEAISLAGL  159

Query  491   RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTG  670
                IK STA  +GVL  T+PP  G FK E   L+YPI++FL  +  PLL N+YPYFA +G
Sbjct  160   AKKIKVSTAIDTGVLGETFPPSIGSFKSEYNALLYPIIRFLVSHQSPLLVNLYPYFAYSG  219

Query  671   DPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPS  835
             +   ++L +ALF+  +   ++      NLFDAML+  YAA+EKAGG ++++V+SETGWPS
Sbjct  220   NTQDIRLDYALFTAPSVVVQDGNFGYRNLFDAMLDGVYAALEKAGGGSLKVVISETGWPS  279

Query  836   EGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTER  1015
               G   +  NA T+  NLIQHV+   GT +RPG  IETY+FAMFDEN KT      + E+
Sbjct  280   AAGTATTIDNARTFISNLIQHVK--EGTPRRPGRPIETYIFAMFDENRKT-----PELEK  332

Query  1016  HFGLFTPDMMSKYNLSFN  1069
             H+GLF+P    KY +SFN
Sbjct  333   HWGLFSPTKQPKYQISFN  350



>gb|ACY91851.1| beta-1,3-glucanase form RRII Gln 2 [Hevea brasiliensis]
Length=374

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 215/339 (63%), Gaps = 20/339 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLL  F    G+    +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +AL
Sbjct  21    MLLLFFFTASVGITDAQVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI++
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIR  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+   GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPKRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             LFAMFDEN K       + E+HFGLF P+   KYNL+F+
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPNKWQKYNLNFS  352



>gb|ABN09655.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 215/339 (63%), Gaps = 20/339 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLL  F    G+    +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +AL
Sbjct  21    MLLLFFFTASVGITDAQVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI++
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIR  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+   GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPKRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             LFAMFDEN K       + E+HFGLF P+   KYNL+F+
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPNKWQKYNLNFS  352



>ref|XP_006358202.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform 2-like 
[Solanum tuberosum]
Length=363

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 221/342 (65%), Gaps = 25/342 (7%)
 Frame = +2

Query  89    AILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             A+++L+G L     HI   Q +GVCYG +GNNLP+ +  I LYK+  I  LRLY+P+   
Sbjct  7     AVIVLLGLLVATNIHITEAQ-LGVCYGMMGNNLPSHSEVIQLYKSRNIGRLRLYDPNHGA  65

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYP--  421
              +ALRGSNI+VI+ +PN D+    +    A +WVQ+N+   +P+V  KY+AVGNE+ P  
Sbjct  66    LNALRGSNIEVILGLPNVDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISPVT  125

Query  422   -GKTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
                + + + + AL N++ A+  A  G  IK ST+    ++ ++YPP  G F+++ +    
Sbjct  126   GTSSLTSFQVPALVNIYKAVGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTD  185

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PIV FL     PLL NIYPYF+ +G+P  + LP+ALF+  N   ++      NLFDAML+
Sbjct  186   PIVGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLD  245

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             S YAA+E+ GG +V IVVSE+GWPS G   A+  NAETY +NLIQH +   G+ ++PG  
Sbjct  246   SVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAETYLRNLIQHAK--EGSPRKPGP-  302

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  303   IETYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  339



>gb|ABB04443.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  SGV    +PP  G F    +  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSGVT-QGFPPSQGTFL---QGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ABN09654.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 217/338 (64%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLLI F    G+    +GVCYG  GNNLP+ +  I LYK   I+ +R+Y+P+  V +AL
Sbjct  21    MLLLIFFTASLGITDAQVGVCYGMQGNNLPSVSEVIALYKKSNIKRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEISPVNGGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+ +  PLLANIYPYF    +P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSSXSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



>ref|XP_010434858.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=347

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 156/341 (46%), Positives = 217/341 (64%), Gaps = 17/341 (5%)
 Frame = +2

Query  89    AILLLIGF----LHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             AI LLI F    L     + +GVCYG +GNNLP+   TITL+K   IR +RLY+P+    
Sbjct  7     AIFLLIAFFTTILTPTCGEPVGVCYGMMGNNLPSKPDTITLFKEKNIRRVRLYDPNQAAL  66

Query  257   DALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTG  433
             +AL+ + I+VIV VPN  L +L N ++A  WVQ N++  YP V+FKY+AVGNEV PG  G
Sbjct  67    NALKNTGIEVIVGVPNPDLRSLTNPSSAKSWVQNNVLNFYPAVSFKYIAVGNEVSPGN-G  125

Query  434   SDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQF  610
              D  L A++NV+ AL  AN +  IK STA    ++ +++PP  G F+ + +    PI+ F
Sbjct  126   GDLVLPAMRNVYDALRGANLQDRIKVSTAVDMTLIGNSFPPSLGEFRGDVRWYTDPIIGF  185

Query  611   LAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAA  775
             L   N  LLANIYPYF+   +P  + L +ALF+  +    +      NLFDA+++  Y+A
Sbjct  186   LTSTNSALLANIYPYFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALIDVVYSA  245

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             VE++GG ++ +VVSE+GWPS GG  AS  NA  YY NL   V  N GT KRPG  +ETYL
Sbjct  246   VERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYL  305

Query  956   FAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN*VQ  1078
             FAMFDEN K+      + E++FGLF+P+  SK+ ++F+ V+
Sbjct  306   FAMFDENQKS-----PEIEKNFGLFSPNKQSKFPITFSAVR  341



>ref|XP_010907249.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 207/322 (64%), Gaps = 16/322 (5%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GV+SIGVCYG  GNNLP  +  + LYK+  I+ +RLY+PD     AL+ SNI +I+DVPN
Sbjct  25    GVKSIGVCYGMNGNNLPQPSTVVNLYKSKNIKAMRLYDPDQAALQALKSSNIQLILDVPN  84

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
               L +LA N +AA  WVQ+N+  Y + V+FKY+AVGNEV PG   + Y L A++N+++AL
Sbjct  85    TALQSLASNTSAANDWVQQNVKAYSSSVSFKYIAVGNEVIPGAQ-AQYVLPAMRNIYSAL  143

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK ST+  + VL  + PP +GVF   A   + PIVQFLA N  PLL N+YPY
Sbjct  144   SSAGLQNQIKVSTSVATSVLAESSPPSHGVFSSAALTYLRPIVQFLASNGAPLLVNVYPY  203

Query  656   FARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             F+       + + +ALF+   +   +      NLFDA++++ YAA+EK GGSNV IVVSE
Sbjct  204   FSYVDSQGTININYALFTSSGTVVTDGQYKYQNLFDAIVDAVYAALEKVGGSNVTIVVSE  263

Query  821   TGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             +GWPS GG  A+  NA+TY +NLI HV    GT +RPG  IE Y+F MF+EN K+     
Sbjct  264   SGWPSAGGYAATINNAKTYNQNLINHV--GQGTPRRPGKTIEAYIFEMFNENQKSAG---  318

Query  1001  DQTERHFGLFTPDMMSKYNLSF  1066
                E++FGLF P     Y ++F
Sbjct  319   --VEQNFGLFYPSTQPVYTINF  338



>ref|XP_006365202.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Solanum tuberosum]
Length=380

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 202/321 (63%), Gaps = 12/321 (4%)
 Frame = +2

Query  128   VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPND  307
             VQ +GVCYGR GNNLP A   + LYK  GI  +R+Y+P     +AL+ SNI +++ +PND
Sbjct  64    VQCVGVCYGRNGNNLPLAEDVVNLYKANGITSMRVYDPILETLNALKDSNIQIMLCIPND  123

Query  308   MLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSD----YALAALKNVHA  472
              L AL +   AY WV  N++ Y   V  +Y++VGNE+ P   GS     + L A++NV  
Sbjct  124   KLQALTDPKEAYNWVVANVINYIKQVRIRYISVGNEISPLIAGSSQFIPFLLPAMENVQR  183

Query  473   ALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIY  649
              + +      +K STA  +G+L +TYPP    F  +  + +  I++FL QNN+PLLANIY
Sbjct  184   VITSFRLNDRVKISTAIETGLLANTYPPSQSTFHGDVTSFIKSIIEFLKQNNVPLLANIY  243

Query  650   PYFARTGDPDHVQLPFALFSEVNSYSEE-NNLFDAMLESFYAAVEKAGGSN-VQIVVSET  823
             PYFA  GDPDHV L +A+F++    S    NLFDAML+S Y A+ KA G N V+IVVSE+
Sbjct  244   PYFAYIGDPDHVSLSYAIFAQPEPDSSGYTNLFDAMLDSIYYAIGKAIGENKVEIVVSES  303

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWP +G    S G A  YY+NLI H +   GT  +PG  IETYLFAMFDEN K       
Sbjct  304   GWPPDGDFGGSMGIATIYYRNLIGHAKSKAGTIHKPGKPIETYLFAMFDENLKI----GA  359

Query  1004  QTERHFGLFTPDMMSKYNLSF  1066
             +TE+HFG+F PD   KYNL+F
Sbjct  360   ETEKHFGVFYPDKTQKYNLTF  380



>gb|KEH41572.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=407

 Score =   283 bits (725),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 211/324 (65%), Gaps = 17/324 (5%)
 Frame = +2

Query  125   GVQS--IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDV  298
             G QS  IGVCYGR+ NNLP +   I LYK  GI  +R+Y+PD    +ALRGSNI++++ V
Sbjct  26    GAQSVGIGVCYGRVANNLPPSEEVIDLYKANGIGRMRIYDPDQATLEALRGSNIELVIGV  85

Query  299   PNDMLPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT-GSDYALAALKNVH  469
             PN+ + ++AN  ++A YWVQ NI+ Y  +V F+Y+ VGNE+ P     S + L A+ N++
Sbjct  86    PNENIESIANSVSSATYWVQNNILNYSKDVKFRYIVVGNEIDPSNDPTSTFVLPAMLNIN  145

Query  470   AALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANI  646
             AAL +AN +  IK STA    +L  +YPP +G F   +   + PIV FL +N  PLLAN+
Sbjct  146   AALTSANLQHQIKVSTAIQMNLLGSSYPPSSGAFSTSSILYITPIVNFLVENEAPLLANV  205

Query  647   YPYFARTGDPDHVQLPFALFSEVN-----SYSEENNLFDAMLESFYAAVEKAGGSNVQIV  811
             Y YF+   DP  + L FALF+  N       +E  NLFDA L + YAA+EK GG+N+++V
Sbjct  206   YTYFSYINDPKSIDLSFALFTSPNVKVRDEKNEYQNLFDATLGALYAALEKVGGANLKVV  265

Query  812   VSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVK  991
             VSE+GWPS G   AS  NA+ Y++NLI+HV  + GT  RP   +ETYLFAMFDEN K   
Sbjct  266   VSESGWPSHGDVGASVENAQIYHENLIKHV--SVGTPNRPNQALETYLFAMFDENQK---  320

Query  992   PNNDQTERHFGLFTPDMMSKYNLS  1063
                 +TER++GLFTPD   KY +S
Sbjct  321   -GPAETERYYGLFTPDKQLKYQIS  343



>gb|EMS67695.1| Glucan endo-1,3-beta-glucosidase GIII [Triticum urartu]
Length=337

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 210/320 (66%), Gaps = 18/320 (6%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QSIGVC G IGNNLP  +  + LYK+ GI  +R+YEP++NV  AL G+ I +++DV N  
Sbjct  28    QSIGVCNGVIGNNLPAPSDVVKLYKSKGINAMRIYEPESNVLKALSGTGIGLLMDVGNGA  87

Query  311   LPALANF-NAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAA  487
             L +LAN  +AA  WV+ N+ PYP V+F+Y+AVGNEV     G    L A+KNV AAL+AA
Sbjct  88    LTSLANDPSAAPAWVKANVQPYPGVSFRYIAVGNEVM-DSAGQKTILPAMKNVQAALVAA  146

Query  488   NRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFAR  664
               GG +K ST+    V+  TYPP NGVF D   + M PIV FLA    PLLAN+YPYFA 
Sbjct  147   GLGGSVKVSTSLRFDVVIDTYPPSNGVFAD--LDYMGPIVDFLASTGAPLLANVYPYFAY  204

Query  665   TGDPDHVQLPFALFSEVNSYSEE------NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
              GDP +++L +A F    + +++       NLF AM++S YAA+E A    V++VVSE+G
Sbjct  205   KGDPQNIKLNYATFMPGTTVNDDGNGLTYTNLFYAMVDSIYAALEDANKPGVKVVVSESG  264

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS  G  A+  NA+ Y + LI+HV   +GT KRPG  +ETY+FAMF+EN KT +P    
Sbjct  265   WPSASGFGATMQNAQAYNQGLIKHV--GNGTPKRPGP-LETYVFAMFNENLKTGEP----  317

Query  1007  TERHFGLFTPDMMSKYNLSF  1066
             TE HFGLF PD    Y++SF
Sbjct  318   TENHFGLFNPDKSPAYSISF  337



>ref|XP_010921890.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 16/322 (5%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GV+SIGVCYG  GNNLP  +A + LYK+  I  +RLY P+ +   AL+GSNI +I+DVP 
Sbjct  25    GVKSIGVCYGMNGNNLPQPSAVVNLYKSKSINAMRLYGPNQDALQALKGSNIQLILDVPK  84

Query  305   DMLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAAL  478
             + L +LA N +AA  WVQ+N+  Y P+V+FKY+AVGNEV  G   + Y L A++N+++AL
Sbjct  85    NDLQSLASNPSAANDWVQQNVKAYSPDVSFKYIAVGNEVITGDY-AQYVLPAMRNIYSAL  143

Query  479   LAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
              +A  +  IK STA  + VL+ + PP +GVF  +A   + PIVQFLA N  PLL N+YPY
Sbjct  144   SSAGLQNQIKVSTAVATSVLEKSSPPSDGVFSSDALTYLSPIVQFLASNGAPLLVNVYPY  203

Query  656   FARTGDPDHVQLPFALF--SEVNSYSEE---NNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             F+   +   + + FALF  SE+  +  +    NLFDA++++ YAA+EK GGS V IVVSE
Sbjct  204   FSYVDNQGQIDINFALFTSSEIVVHDGQYNYQNLFDAIVDAVYAALEKVGGSTVPIVVSE  263

Query  821   TGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             +GWPS  G  A+  NA+TY +NLI HV    GT +RPG  IETY+F MF+EN K      
Sbjct  264   SGWPSADGTAATINNAQTYNQNLINHV--GQGTPRRPGKAIETYIFEMFNENQK-----Q  316

Query  1001  DQTERHFGLFTPDMMSKYNLSF  1066
                E++FGLF P M   Y ++F
Sbjct  317   PPVEQNFGLFYPSMQPVYPINF  338



>emb|CDP14183.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 213/334 (64%), Gaps = 17/334 (5%)
 Frame = +2

Query  95    LLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGS  274
             LLL+  L   G Q+ GVCYGR+G+NLP+    + L     I+ +R+Y+PD +   AL GS
Sbjct  17    LLLLAALDYTGAQT-GVCYGRLGSNLPSPADVVALCNQNNIKRMRIYDPDQSTLQALGGS  75

Query  275   NIDVIVDVPN-DMLPALANFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYP--GKTG--SD  439
             NI+VI+ VPN D+    A+ + A  WVQ N+  YPNV F+Y+AVGNEV P  G T   ++
Sbjct  76    NIEVILGVPNTDLQNVAASQDNANTWVQNNVRNYPNVKFRYIAVGNEVSPIKGDTAQYAN  135

Query  440   YALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQ  619
             + L A++N+  A+ AA  G IK STA  + ++ + +PP  G FK E +N + PIVQFLA 
Sbjct  136   FLLPAIQNIFNAISAAGLG-IKVSTAVETELVGNNFPPSGGTFKPEVQNFINPIVQFLAS  194

Query  620   NNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE----NNLFDAMLESFYAAVEKA  787
                PLL N+YPYFA   +   + L +ALF+     + +     NL DA+L++ Y+A+E+A
Sbjct  195   KGAPLLVNVYPYFAYIFNSQSIALEYALFTSSGITTPDGVKYQNLLDALLDATYSALERA  254

Query  788   GGSNVQIVVSETGWPSEGGPDA-SHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAM  964
             GG +V+IVVSETGWPS+GG  A S  NA TY  NLI HV GN GT KRPG  IETY+F +
Sbjct  255   GGQSVEIVVSETGWPSDGGGQATSIDNARTYNTNLIGHVNGNSGTPKRPGRAIETYIFDL  314

Query  965   FDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             FDE+ K+        E+HFGLF P+   KY +SF
Sbjct  315   FDEDQKS-----PDYEKHFGLFLPNRQPKYPISF  343



>prf||1410344A glucan endoglucosidase
Length=359

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 221/340 (65%), Gaps = 21/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDA  262
             +  +LL+   + IAG QSIGVCYG +GNNLPN    I LYK+  I  LRLY+P+     A
Sbjct  6     LLGLLLVASSIDIAGAQSIGVCYGMLGNNLPNHWEVIQLYKSRNIGRLRLYDPNHGALQA  65

Query  263   LRGSNIDVIVDVPNDMLPALAN-FNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS  436
             L+GSNI+V++ +PN  +  +A+    A +WVQ+N+   +P+V  KY+AVGNE+ P  TG+
Sbjct  66    LKGSNIEVMLGLPNSDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISP-VTGT  124

Query  437   DYALA----ALKNVHAALLAANRG-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              Y  +    A+ N++ A+  A  G  IK ST+    ++ ++YPP  G F+++A+    PI
Sbjct  125   SYLTSFLTPAMVNIYKAIGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFXDPI  184

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             V FL     PLL NIYPYF+ +G+P  + LP++LF+  N   ++      NLFDAML+S 
Sbjct  185   VGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSV  244

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             YAA+E++GG++V IVVSE+GWPS G   A++ NA TY + LI H +   G+ ++PG  IE
Sbjct  245   YAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRXLIXHAK--EGSPRKPGP-IE  301

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TY+FAMFDENNK     N + E+HFGLF+P+   KYN +F
Sbjct  302   TYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNXNF  336



>ref|XP_006414372.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
 gb|ESQ55825.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
Length=345

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/336 (45%), Positives = 212/336 (63%), Gaps = 13/336 (4%)
 Frame = +2

Query  80    PIAAILLLIGFLHIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             P+  + L    L+    + +GVCYG +GNNLP+ + TI L++   IR +RLY+P+    +
Sbjct  6     PLFLLALFTTILNPISGEPVGVCYGMLGNNLPSQSETIALFRQNNIRRIRLYDPNQAALN  65

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGS  436
             AL+ S I+VIV VPN  L +L N ++A  W+Q N++ Y P VNFKY+AVGNEV P   G 
Sbjct  66    ALKNSGIEVIVGVPNSDLRSLTNPSSARSWLQNNVLNYYPAVNFKYIAVGNEVVP-SNGG  124

Query  437   DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFL  613
             D  L A++NV+ AL  AN    IK STA    ++ +++PP +G F+ + ++   PI+ FL
Sbjct  125   DLVLPAMRNVYDALRGANLHDRIKVSTAVDMTLIGNSFPPSSGEFRGDVRSYTDPIIGFL  184

Query  614   AQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAV  778
                N  LLANIYPYF+  G+P  + L +ALF+  +    +      NLFDA+L+  Y+AV
Sbjct  185   TSTNSALLANIYPYFSYIGNPRDISLSYALFTSSSVVVWDGSRGYQNLFDALLDVIYSAV  244

Query  779   EKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLF  958
             E++GG ++ +VVSE+GWPS GG  AS  NA  YY NL   V  N GT KRPG  +ETYLF
Sbjct  245   ERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLF  304

Query  959   AMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             AMFDEN K+      + E++FGLF P+   K+ ++F
Sbjct  305   AMFDENQKS-----PEIEKNFGLFFPNKQPKFPITF  335



>gb|ACJ62652.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62630.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62679.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62698.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>pdb|4HPG|A Chain A, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|B Chain B, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|C Chain C, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|D Chain D, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4IIS|A Chain A, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|B Chain B, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|C Chain C, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|D Chain D, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
Length=316

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 208/322 (65%), Gaps = 18/322 (6%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +ALRGSNI++I+ VPN  L 
Sbjct  2     VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQ  61

Query  317   ALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS----DYALAALKNVHAALL  481
             +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+     + L A++N+H A+ 
Sbjct  62    SLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIR  121

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI++FL+    PLLANIYPYF
Sbjct  122   SAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYF  181

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
                G+P  + LP+ALF+  +    +      NLFDA L++ Y+A+E+A G ++++VVSE+
Sbjct  182   TYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSES  241

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS G   A+  N  TY  NLIQHV+   GT KRP   IETYLFAMFDEN K       
Sbjct  242   GWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPKRAIETYLFAMFDENKK-----QP  294

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             + E+HFGLF P+   KYNL+F+
Sbjct  295   EVEKHFGLFFPNKWQKYNLNFS  316



>gb|KDP26103.1| hypothetical protein JCGZ_21136 [Jatropha curcas]
Length=344

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 207/318 (65%), Gaps = 14/318 (4%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             IGVCYG +GNNLP     I+L+   GIR +R+Y PD    +AL GSNI++I+ +PN  L 
Sbjct  34    IGVCYGMLGNNLPPPPEVISLFNQNGIRRMRIYAPDQAAQEALEGSNIELILGLPNSDLQ  93

Query  317   ALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAANR  493
              +A+  A A  WVQ N+  YPNV F+Y++VGNEV+P  + + + + A+ N   ALL+A  
Sbjct  94    RVASSQAEANTWVQNNVQRYPNVKFRYISVGNEVHPSDSFAQFLVPAMMNTRNALLSAGL  153

Query  494   G-GIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTG  670
             G  IK STA  +GVL  +YPP  G FK E + ++ P++QFL  N  PLL NIYPYF+   
Sbjct  154   GDAIKVSTAIDTGVLAESYPPSIGSFKQEYRPILDPLIQFLVANGSPLLVNIYPYFSYIE  213

Query  671   DPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETGWPS  835
             +   ++L +ALF+  ++   +      NLFDA+L++ YAA+EK+GG ++ IVV+E+GWP+
Sbjct  214   NSGDIRLDYALFTAPSTVVSDPPLSYQNLFDAILDAVYAALEKSGGRSLDIVVAESGWPT  273

Query  836   EGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQTER  1015
              GG   S  NA TY  NLIQHV+   GT +RPG  IETY+FAMFDEN K+        E+
Sbjct  274   AGGKATSVENARTYNNNLIQHVK--KGTPRRPGKAIETYIFAMFDENQKS-----PDYEK  326

Query  1016  HFGLFTPDMMSKYNLSFN  1069
             ++GLF P+   KY ++FN
Sbjct  327   YWGLFLPNKQPKYEVNFN  344



>ref|XP_010269788.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Nelumbo nucifera]
Length=334

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 213/338 (63%), Gaps = 17/338 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             + + +LL+G L    +IA  Q IGVCYG +GNNLP+    + LYK   I+ +RLY+P+  
Sbjct  3     VFSAVLLLGLLMASSNIADAQQIGVCYGMLGNNLPSKNEVVELYKINNIQRMRLYDPNRE  62

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFN--AAYYWVQRNI-VPYPNVNFKYVAVGNEVYP  421
                AL GSNI+++V +PN+ L  +A+ +  AAY WV  ++ +   +V FKY+ VGNEV  
Sbjct  63    ALQALNGSNIELMVGIPNEQLQLMASSDPTAAYSWVFEHVFLNRDDVKFKYIVVGNEVSF  122

Query  422   GKTGSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYP  598
              +    Y L A++N+++AL LA  +  IK STA +SG +  TYPP N VF  + +  M  
Sbjct  123   AEF--KYILPAMRNIYSALELADLQNQIKVSTAVFSGHISETYPPRNSVFNSQIRPFMRE  180

Query  599   IVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSE--VNSYSEENNLFDAMLESFYA  772
             IV FL +   PLLAN+YP+FA   +   +   +  F+   VN    +N LFDAML+ FY 
Sbjct  181   IVAFLLEKQAPLLANVYPFFAYLSNQXQIPSEYVFFTSPTVNEIGYQN-LFDAMLDGFYY  239

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
              +EK GGS+++IVVSETGWP+ G   ++  NA+ YY NLI+HV    GT KRPG  IETY
Sbjct  240   XLEKEGGSSLEIVVSETGWPNAGDSISTTENAQKYYSNLIRHVNSGKGTPKRPGKPIETY  299

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K      D+ E+HFGLF+P+   KY +SF
Sbjct  300   LFAMFDENQKL----GDEREKHFGLFSPNKKPKYQISF  333



>gb|ACJ62694.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSVGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04452.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62651.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62636.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A +GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGQGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|AAX76839.1| beta-1,3-glucanase [Brassica rapa subsp. chinensis]
Length=363

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 203/322 (63%), Gaps = 14/322 (4%)
 Frame = +2

Query  134   SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDML  313
              IGVC+G++GNN+P  +  + ++K Y I  +R+Y P+ +  +ALRGSNI+ I+DVPN  L
Sbjct  46    QIGVCFGQMGNNIPKPSEVVAMFKQYSIPRMRMYGPNPDALNALRGSNIEFILDVPNGDL  105

Query  314   PALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLAAN  490
               LA+  A A  WV+ N+  Y +V FKY++VGNEV PG+ G+   + A++N+  AL AA 
Sbjct  106   KRLADSQAEANTWVRDNVQKYNDVRFKYISVGNEVKPGEPGAAALIQAMQNIDRALSAAG  165

Query  491   RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFARTG  670
                IK ST T+ G    TYPP  G FKDE +N + P++ FL     PLL NIY YF    
Sbjct  166   LSNIKVSTTTFMGAFADTYPPSRGRFKDEYRNFLQPVIGFLVNKRSPLLVNIYTYFGYMN  225

Query  671   DPDHVQLPFAL--------FSEVNSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
                 V L FAL        F++ N+     N FDA L+S YAA+EK+GG ++ +VVSE+G
Sbjct  226   --RDVSLQFALLQPNSNNEFTDPNNQLRYLNFFDANLDSVYAALEKSGGGSLDVVVSESG  283

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WP++GGP AS  NAE Y  NL  HV  N G+ KRPG  IETY+FAMFDEN K   P ND+
Sbjct  284   WPTQGGPGASVPNAEAYVNNLRLHVNKN-GSPKRPGKAIETYIFAMFDENGKQTSP-NDE  341

Query  1007  TERHFGLFTPDMMS-KYNLSFN  1069
              E+++G+F+P     KY + FN
Sbjct  342   YEKYWGMFSPTTRQLKYGVKFN  363



>gb|ABJ74161.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=321

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 208/321 (65%), Gaps = 18/321 (6%)
 Frame = +2

Query  137   IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDMLP  316
             +GVCYG  GNNLP  +  I LYK   I+ +R+Y+P+  V +ALRGSNI++I+ VPN  L 
Sbjct  2     VGVCYGMQGNNLPPVSEVIALYKQSNIKRMRIYDPNRAVLEALRGSNIELILGVPNSDLQ  61

Query  317   ALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS----DYALAALKNVHAALL  481
             +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+     + L A++N+H A+ 
Sbjct  62    SLTNPSNANSWVQKNVRGFWSSVLFRYIAVGNEISPVNGGTAWLAQFVLPAMRNIHDAIR  121

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ FL+    PLLANIYPYF
Sbjct  122   SAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIGFLSSIRSPLLANIYPYF  181

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
                G+P  + LP+ALF+  +    +      NLFDA L++ Y+A+E+A G ++++VVSE+
Sbjct  182   TYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSES  241

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETYLFAMFDEN K       
Sbjct  242   GWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETYLFAMFDENKK-----QP  294

Query  1004  QTERHFGLFTPDMMSKYNLSF  1066
             + E+HFGLF PD   KYNL+F
Sbjct  295   EVEKHFGLFFPDKRPKYNLNF  315



>dbj|BAJ33717.1| unnamed protein product [Thellungiella halophila]
Length=341

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 216/340 (64%), Gaps = 17/340 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A++ +L+G      H A  Q +GVCYGR G+NLP+   TI L+K   IR +RLY PD +
Sbjct  6     LASLTILLGLFFVNSHTAAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHD  65

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPY-PNVNFKYVAVGNEVYPG  424
             V  ALRGS+I+V++ +PN  L  +A+  + A  WVQ N+  Y  +V F+YV+VGNEV   
Sbjct  66    VLAALRGSDIEVMLGLPNQDLQRIASSQSEADTWVQNNVNNYVDDVKFRYVSVGNEVKIF  125

Query  425   KTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              + S + + A++N+  A+L +  GG IK STA   GVL  +YPP  G FK E   LM PI
Sbjct  126   DSYSQFLVPAMENIDRAVLGSGLGGRIKVSTAIDMGVLGESYPPSKGSFKGEVMVLMEPI  185

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             ++FL     PL  N+Y YF+  G+PD ++L +ALF+       +      NLFDAML++ 
Sbjct  186   IRFLVNKKSPLHLNLYTYFSYAGNPDQIRLDYALFTASPGTVSDPPRSYQNLFDAMLDAV  245

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             ++A+E++GG ++ +VVSETGWP+EGG + +  NA  Y  NLI HV+  +GT KRPG  IE
Sbjct  246   HSALERSGGESLDVVVSETGWPTEGGTETNLENARIYSNNLINHVK--NGTPKRPGKEIE  303

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TYLFAM+DEN K   P+    E+ +GLF P+   KY ++F
Sbjct  304   TYLFAMYDENKKPTPPD---VEKFWGLFHPNKQPKYEVNF  340



>ref|NP_001274869.1| glucan endo-1,3-beta-glucosidase, basic isoform 2 precursor [Solanum 
tuberosum]
 sp|P52401.1|E132_SOLTU RecName: Full=Glucan endo-1,3-beta-glucosidase, basic isoform 
2; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: 
Precursor [Solanum tuberosum]
 gb|AAA18928.1| 1,3-beta-D-glucan glucanohydrolase; endo-1,3-beta-D-glucanase; 
1,3-beta-glucanase (basic, class I) [Solanum tuberosum]
Length=363

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 219/342 (64%), Gaps = 25/342 (7%)
 Frame = +2

Query  89    AILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             A+++L+G L     HI   Q +GVCYG +GNNLP+ +  I LYK+  I  LRLY+P+   
Sbjct  7     AVIVLLGLLVATNIHITEAQ-LGVCYGMMGNNLPSHSEVIQLYKSRNIGRLRLYDPNQGA  65

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYP--  421
              +ALRGSNI+VI+ +PN D+    +    A +WVQ+N+   +P+V  KY+AVGNE+ P  
Sbjct  66    LNALRGSNIEVILGLPNVDVKHIASGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISPVT  125

Query  422   -GKTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
                + + + + AL N++ A+  A  G  IK ST+    ++ ++YPP  G F+++ +    
Sbjct  126   GTSSLTSFQVPALVNIYKAVGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTD  185

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PIV FL     PLL NIYPYF+ +G+P  + LP+ALF+  N   ++      NLFDAML+
Sbjct  186   PIVGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLD  245

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             S YAA+E+ GG +V IVVSE GWPS G   A+  NA TY +NLIQH +   G+ ++PG  
Sbjct  246   SVYAAMERTGGGSVGIVVSECGWPSAGAFGATQDNAATYLRNLIQHAK--EGSPRKPGP-  302

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  303   IETYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  339



>ref|XP_004962627.1| PREDICTED: glucan endo-1,3-beta-glucosidase GII-like [Setaria 
italica]
Length=331

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 209/325 (64%), Gaps = 26/325 (8%)
 Frame = +2

Query  83    IAAILLLIGFLHI--AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVF  256
             +AA  LLIG L      V SIGVCYG  G+ LP+A   + LY++ GI  +R+Y PD  + 
Sbjct  10    LAATALLIGILASIPTAVHSIGVCYGTHGDGLPSAADVVQLYRSNGINRMRIYSPDATIL  69

Query  257   DALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTG  433
              ALRGS IDVIVD   D+   L++   A  WVQ N++PY + V FKY+AVGNEV     G
Sbjct  70    KALRGSGIDVIVD-ETDLNALLSD---ASVWVQANVLPYKDDVKFKYIAVGNEV----EG  121

Query  434   SDYA--LAALKNVHAALLAANRGGIKASTATYSGVLDH-TYPPENGVFKDEAKNLMYPIV  604
             SD    L A++ ++AAL AA    IK STA    VLD  + PP NGVF D +  +M PIV
Sbjct  122   SDTQKILPAMQKLNAALSAAGLSNIKVSTAVKMSVLDTPSSPPSNGVFADPS--IMGPIV  179

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS---EENNLFDAMLESFYAA  775
             QFLA    PLLANIYPYFA  G   ++ L +ALF      S   E  NLFDAM ++ Y A
Sbjct  180   QFLASTGSPLLANIYPYFAYKGADGNIDLNYALFKPSPPTSNGPEYTNLFDAMTDAMYTA  239

Query  776   VEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYL  955
             +EK GGSNV IVVSE+GWPS+GG  AS  NA+TY +NLI HV    GT KRPG+ +ETY+
Sbjct  240   MEKVGGSNVPIVVSESGWPSDGGFGASVQNAQTYNQNLIHHV--GKGTPKRPGA-LETYI  296

Query  956   FAMFDENNKTVKPNNDQTERHFGLF  1030
             FAMF+EN KT     D+TE+HFGLF
Sbjct  297   FAMFNENKKT----GDETEKHFGLF  317



>gb|AIT56226.1| beta-1,3 glucanase 6 [Musa AB Group]
Length=339

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 213/321 (66%), Gaps = 15/321 (5%)
 Frame = +2

Query  128   VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPND  307
             VQSIGVCYG IGNNLP  +  ++LYK+  I  +RLY+P+     ALR SNI V++DVP  
Sbjct  26    VQSIGVCYGMIGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRS  85

Query  308   MLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
              + +LA N +AA  W++RN+V Y P+V+F+Y+AVGNE+ PG   + Y L A++N++ AL 
Sbjct  86    DVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALS  145

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +A  +  IK STA  +GVL  +YPP  G F   A+  + PIVQFLA N  PLL N+YPYF
Sbjct  146   SAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYF  205

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + LP+ALF       ++      NLFDA++++ +AA+E+ GG+NV +VVSE+
Sbjct  206   SYIGNPGQISLPYALFMASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSES  265

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG +AS  NA TY +NLI+HV G  GT +RPG  IE Y+F MF+EN K       
Sbjct  266   GWPSAGGTEASTSNARTYNQNLIRHVGG--GTPRRPGKEIEAYIFEMFNENQKA-----G  318

Query  1004  QTERHFGLFTPDMMSKYNLSF  1066
               E++FGLF P+    Y +SF
Sbjct  319   GIEQNFGLFYPNKQPVYQISF  339



>gb|AFU52655.1| beta-1,3-glucanase 22 [Solanum tuberosum]
Length=363

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 220/342 (64%), Gaps = 25/342 (7%)
 Frame = +2

Query  89    AILLLIGFL-----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             A+++L+G L     HI   Q +GVCYG +GNNLP+ +  I LYK+  I  LRLY+P+   
Sbjct  7     AVIVLLGLLVATNIHITEAQ-LGVCYGMMGNNLPSHSEVIQLYKSRNIGRLRLYDPNHGA  65

Query  254   FDALRGSNIDVIVDVPN-DMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYP--  421
              +ALRGSNI+VI+ +PN D+    +    A +WVQ+N+   +P+V  KY+AVGNE+ P  
Sbjct  66    LNALRGSNIEVILGLPNVDVKHISSGMEHARWWVQKNVKDFWPDVKIKYIAVGNEISPVT  125

Query  422   -GKTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
                + + + + AL N++ A+  A  G  IK ST+    ++ ++YPP  G F+++ +    
Sbjct  126   GTSSLTSFQVPALVNIYKAIGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTD  185

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             PIV FL     PLL NIYPYF+ +G+P  + LP+ALF+  N   ++      NLFDAML+
Sbjct  186   PIVGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLD  245

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             S YAA+E+ GG +V IVVSE+GWPS G   A+  NA TY +NLIQH +   G+ ++PG  
Sbjct  246   SVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK--EGSPRKPGP-  302

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             IETY+FAMFDENNK     N + E+HFGLF+P+   KYNL+F
Sbjct  303   IETYIFAMFDENNK-----NPELEKHFGLFSPNKQPKYNLNF  339



>ref|XP_004516619.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like, partial [Cicer 
arietinum]
Length=343

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 210/319 (66%), Gaps = 14/319 (4%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QSIGVCYGR+ +NLP A   I L K+  I+ +R+Y+PD     ALRGSNI++++ VPN+ 
Sbjct  22    QSIGVCYGRVADNLPPANEVIDLLKSNNIKRMRIYDPDEATLQALRGSNIELVIGVPNEN  81

Query  311   LPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             +  +A   ++A YWVQ  I+ Y  +V F+Y+ VGNE+ P    S + L A++N++A L++
Sbjct  82    IQTIATGVSSASYWVQNYILKYSKDVKFRYIVVGNEINPNDPTSQFILPAMQNINAVLIS  141

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +  IK STA     L  +YPP  G F   + + +  IVQFL Q++ PLLAN+Y YF+
Sbjct  142   ANLQNKIKVSTAIQLDFLGSSYPPSTGAFSSSSNSYISSIVQFLLQSDAPLLANVYTYFS  201

Query  662   RTGDPDHVQLPFALFS----EVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
                 P  ++L FAL +    +VN    +  NLFDA L + Y+A+EK GG+N+++VVSE+G
Sbjct  202   YISAPKEIELSFALLNSPTVQVNDGEYKYTNLFDATLGALYSALEKVGGANLEVVVSESG  261

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS+GG  A+  NA+ YY NLI+HV  ++GT KRP   +ETYLFAMFDEN K       +
Sbjct  262   WPSDGGVAATVENAQAYYSNLIKHV--SNGTPKRPNQELETYLFAMFDENKK----GPAK  315

Query  1007  TERHFGLFTPDMMSKYNLS  1063
             TERHFGLFTP+   KY +S
Sbjct  316   TERHFGLFTPNKQPKYQIS  334



>ref|XP_010090235.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
 gb|EXB39104.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
Length=347

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 216/343 (63%), Gaps = 23/343 (7%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGV-----QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDT  247
             + + +LL+G L I          IGVCYG +GNNLP+    I LY    IR +RLY+P+ 
Sbjct  14    MISTMLLLGLLIITSTIDKTAAQIGVCYGMLGNNLPSQKEVIALYNQNNIRRMRLYDPNQ  73

Query  248   NVFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPG  424
                 ALRG+NI++++ VPN  L  LA+  A A  WVQ N+  Y NV FKY+AVGNEV   
Sbjct  74    AALQALRGTNIELMLGVPNTDLQRLASNQAEANTWVQNNVRNYNNVKFKYIAVGNEVKTS  133

Query  425   KTGSDYALAALKNVHAALLA---ANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMY  595
              + + + + A++N+  A+     AN+  IK ST+  +GVLD +YPP  G FK + + ++ 
Sbjct  134   DSFAQFLVPAMQNIQRAISTFGLANQ--IKVSTSIDTGVLDVSYPPSKGSFKSDYRAIIN  191

Query  596   PIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLE  760
             P++ FL  N  PLL N+YPYF+ +G+   + L +ALF   +   ++      NLFDA+L+
Sbjct  192   PVISFLVSNGSPLLVNLYPYFSYSGNTRDISLDYALFRSPSVVVQDGQYGYRNLFDAILD  251

Query  761   SFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSH  940
             + Y+A+EKAGG +++IVVSE+GWPS GG   +  NA TY  NL+QHV+   GT K+PG  
Sbjct  252   AVYSALEKAGGGSLEIVVSESGWPSAGGTGTTVDNARTYNNNLVQHVK--KGTPKKPGRP  309

Query  941   IETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             I+TY+FAMF+EN KT      + E+H+GLF P+   KY ++FN
Sbjct  310   IQTYIFAMFNENQKT-----PELEKHWGLFLPNKQPKYQMNFN  347



>gb|ABJ98942.1| beta-1,3-glucanase [Musa x paradisiaca]
Length=340

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 215/321 (67%), Gaps = 16/321 (5%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QSIGVCYG +GNNLP  +  ++LYK+  I  +RLY+P+     ALR SNI V++DVP   
Sbjct  27    QSIGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSD  86

Query  311   LPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             + +LA N +AA  W++RN+V Y P+V+F+Y+AVGNE+ PG   + Y L A++N++ AL +
Sbjct  87    VQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSS  146

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             A  +  IK STA  +GVLD +YPP  G F   A+  + PIVQFLA N  PLL N+YPYF+
Sbjct  147   AGLQNQIKVSTAVDTGVLDKSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFS  206

Query  662   RTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
              TG+P  + LP+ALF+      ++      NLFDA++++ +AA+E+ GG+NV +VVSE+G
Sbjct  207   YTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESG  266

Query  827   WPSE-GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             WPS  GG +AS  NA TY +NLI+HV G  GT +RPG  IE Y+F MF+EN K       
Sbjct  267   WPSAGGGAEASTSNARTYNQNLIRHVGG--GTPRRPGKEIEAYIFEMFNENQKA-----G  319

Query  1004  QTERHFGLFTPDMMSKYNLSF  1066
               E++FGLF P+    Y +SF
Sbjct  320   GIEQNFGLFYPNKQPVYQISF  340



>gb|KHN03123.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=324

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 205/327 (63%), Gaps = 8/327 (2%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGV-QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFD  259
             ++AILLL+G L   GV +  G+CYG  GNNLP+    + ++K+ GI  +R+Y PD  +  
Sbjct  3     VSAILLLVGILSSIGVLEFTGICYGINGNNLPSKQEVVDMFKSRGIPRMRIYSPDEEIIQ  62

Query  260   ALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPYP-NVNFKYVAVGNEVYPGKTGS  436
             ALRGS I++++DV  D + +L + N A  WV R I  Y  +VNFKY+ VGNEV+P    +
Sbjct  63    ALRGSRIELVMDVAGDTIQSLTDPNVAADWVHRYITSYSQDVNFKYIVVGNEVHPNYDLA  122

Query  437   DYALAALKNVHAALLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLA  616
              Y L A+ N+  A+ +AN    K STA  + ++ ++YPP N VF  +A   + PI+ FL 
Sbjct  123   PYILPAMTNIQNAISSANLV-TKVSTAIDTTLVTNSYPPNNSVFTADASPYIGPIINFLV  181

Query  617   QNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYS-EENNLFDAMLESFYAAVEKAGG  793
             +N  PLLAN+YPYFA   +   + L +ALF++  +      NLFDAML+S YAA+EK G 
Sbjct  182   KNEAPLLANLYPYFAYVNNQKDIDLHYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGA  241

Query  794   SNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDE  973
              N+++VVSE+GWPS GG  A   NA  YY  LI+H     GT KRPG  I+T+LFAMFDE
Sbjct  242   PNLEVVVSESGWPSAGGDGALVDNAHVYYFRLIKHAYSGSGTPKRPGRPIQTFLFAMFDE  301

Query  974   NNKTVKPNNDQTERHFGLFTPDMMSKY  1054
             N K       + ERHFG+F PD   KY
Sbjct  302   NQKP----GAEVERHFGIFNPDKSPKY  324



>emb|CAB38443.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=352

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 212/338 (63%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLL  F    G+    +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +AL
Sbjct  21    MLLLFFFAASVGITDAQVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNRAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEISPVNRGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI++
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIR  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF   G+P  + LP+ALF+  +    +      NLFDA L+  Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDVLYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+   GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+ FGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKQFGLFFPDKWQKYNLNF  351



>gb|ABM74067.1| beta-1,3-glucanase 1 [Prunus avium]
Length=353

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 216/347 (62%), Gaps = 25/347 (7%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQS-----------IGVCYGRIGNNLPNATATITLYKNYGIRGLR  229
             + +I++L+G L +A + +           IGVC G +G++LP     + LYK   I  +R
Sbjct  14    LISIVVLLGQLVVASLATNKHTKVHAGAPIGVCNGMVGDDLPPQAEVVALYKKNNIPRMR  73

Query  230   LYEPDTNVFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVG  406
             LY+P+    +ALRGSNI +++ VPN+ L  +A+  A A  WVQ N+  Y NV F+Y+AVG
Sbjct  74    LYDPNPAALEALRGSNIKLLLGVPNENLQYIASSQANANAWVQNNVRNYANVKFQYIAVG  133

Query  407   NEVYPGKTGSDYALAALKNVHAAL-LAANRGGIKASTATYSGVLDHTYPPENGVFKDEAK  583
             NEV P  + + + + A++ +   + LA     IK STA  +GVL  T+PP  G FK E  
Sbjct  134   NEVKPSDSFAQFLVPAMRKIQKEISLAGLAKKIKVSTAIDTGVLGETFPPSIGSFKSEYD  193

Query  584   NLMYPIVQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFD  748
              L++PI++FL  +  PLL N+YPYFA +G+   ++L +ALF+  +   ++      NLFD
Sbjct  194   ALLHPIIRFLVNHKSPLLVNLYPYFAYSGNTQDIRLDYALFTAPSIVVQDGKFGYRNLFD  253

Query  749   AMLESFYAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKR  928
             AML+  YAA+EKAGG ++++V+SETGWPS  G   +  NA TY  NLIQHV+   GT +R
Sbjct  254   AMLDGVYAALEKAGGGSLKVVISETGWPSAAGTATTIDNARTYISNLIQHVK--EGTPRR  311

Query  929   PGSHIETYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             PG  IETY+FAMFDEN KT      + E+H+GLF+P    KY  SFN
Sbjct  312   PGRPIETYIFAMFDENRKT-----PELEKHWGLFSPTKQPKYQSSFN  353



>gb|ABB04444.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSVGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A++ AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>ref|XP_004516618.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=376

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 210/319 (66%), Gaps = 14/319 (4%)
 Frame = +2

Query  131   QSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPNDM  310
             QSIGVCYGR+ +NLP A   I L K+  I+ +R+Y+PD     ALRGSNI++++ VPN+ 
Sbjct  22    QSIGVCYGRVADNLPPANEVIDLLKSNNIKRMRIYDPDEATLQALRGSNIELVIGVPNEN  81

Query  311   LPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALLA  484
             +  +A   ++A YWVQ  I+ Y  +V F+Y+ VGNE+ P    S + L A++N++A L++
Sbjct  82    IQTIATGVSSASYWVQNYILKYSKDVKFRYIVVGNEINPNDPTSQFILPAMQNINAVLIS  141

Query  485   AN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYFA  661
             AN +  IK STA     L  +YPP  G F   + + +  IVQFL Q++ PLLAN+Y YF+
Sbjct  142   ANLQNKIKVSTAIQLDFLGSSYPPSTGAFSSSSNSYISSIVQFLLQSDAPLLANVYTYFS  201

Query  662   RTGDPDHVQLPFALFS----EVNSYSEE-NNLFDAMLESFYAAVEKAGGSNVQIVVSETG  826
                 P  ++L FAL +    +VN    +  NLFDA L + Y+A+EK GG+N+++VVSE+G
Sbjct  202   YISAPKEIELSFALLNSPTVQVNDGEYKYTNLFDATLGALYSALEKVGGANLEVVVSESG  261

Query  827   WPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQ  1006
             WPS+GG  A+  NA+ YY NLI+HV  ++GT KRP   +ETYLFAMFDEN K       +
Sbjct  262   WPSDGGVAATVENAQAYYSNLIKHV--SNGTPKRPNQELETYLFAMFDENKK----GPAK  315

Query  1007  TERHFGLFTPDMMSKYNLS  1063
             TERHFGLFTP+   KY +S
Sbjct  316   TERHFGLFTPNKQPKYQIS  334



>ref|XP_004505799.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=329

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +2

Query  122   AGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVP  301
             A  QS+GVCYG + NNLP A   I L+K  GI  +R+Y P+    +ALRGSNI++ + VP
Sbjct  18    AAAQSVGVCYGIVANNLPPAVEVIDLFKTNGIARMRIYNPNQATLEALRGSNIELAIGVP  77

Query  302   NDMLPALAN-FNAAYYWVQRNIVPYPN-VNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
             N+ + ++AN  ++A  WVQ NI+ Y N V F+Y+ +GNE+ P    S + L A++N++ A
Sbjct  78    NEEIQSIANDISSAANWVQNNIINYANNVIFRYIILGNEISPNDPTSQFILPAMQNIYGA  137

Query  476   LLAANRGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPY  655
             L    +  IK STA    +L  +YPP  G F  +A   + PIV FL+ N  PLLAN+YPY
Sbjct  138   L-GNLQNQIKISTAIQLSLLGSSYPPSQGEFSPDAIPYITPIVNFLSTNGAPLLANVYPY  196

Query  656   FARTGDPDHVQLPFALFSEVNSYSE--ENNLFDAMLESFYAAVEKAGGSNVQIVVSETGW  829
             FA   D   + L +A F++   Y++    NLFDAML++ YAA+ K G S++QIVVSE+GW
Sbjct  197   FAYISDQKDISLEYATFTQ-QGYTDIGYQNLFDAMLDALYAAILKTGASDLQIVVSESGW  255

Query  830   PSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNNDQT  1009
             PS GG  A+  NA  YY NLI HV    GT  RP   IETYLFAMFDEN   +KP    +
Sbjct  256   PSAGGEGATTENAAAYYTNLINHVNSGIGTPMRPNQSIETYLFAMFDEN---MKP-GATS  311

Query  1010  ERHFGLFTPDMMSKYNL  1060
             E++FGLFTPD   KYN+
Sbjct  312   EQYFGLFTPDKSQKYNI  328



>gb|ACJ62691.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDKKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62646.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62699.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62647.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62648.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62654.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62664.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62667.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62672.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62693.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62696.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62629.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62684.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>ref|XP_006409034.1| hypothetical protein EUTSA_v10003126mg [Eutrema salsugineum]
 gb|ESQ50487.1| hypothetical protein EUTSA_v10003126mg [Eutrema salsugineum]
Length=370

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 216/340 (64%), Gaps = 17/340 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A++ +L+G      H A  Q +GVCYGR G+NLP+   TI L+K   IR +RLY PD +
Sbjct  35    LASLTILLGLFFVNSHTAAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHD  94

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPY-PNVNFKYVAVGNEVYPG  424
             V  ALRGS+I+V++ +PN  L  +A+  + A  WVQ N+  Y  +V F+YV+VGNEV   
Sbjct  95    VLAALRGSDIEVMLGLPNQDLQRIASSQSEADTWVQNNVNNYVDDVKFRYVSVGNEVKIF  154

Query  425   KTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              + S + + A++N+  A+L +  GG IK STA   GVL  +YPP  G FK E   LM PI
Sbjct  155   DSYSQFLVPAMENIDRAVLGSGLGGRIKVSTAIDMGVLGESYPPSKGSFKGEVMVLMEPI  214

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             ++FL     PL  N+Y YF+  G+PD ++L +ALF+       +      NLFDAML++ 
Sbjct  215   IRFLVNKKSPLHLNLYTYFSYAGNPDQIRLDYALFTASPGTVSDPPRSYQNLFDAMLDAV  274

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             ++A+E++GG ++ +VVSETGWP+EGG + +  NA  Y  NLI HV+  +GT KRPG  IE
Sbjct  275   HSALERSGGESLDVVVSETGWPTEGGTETNLENARIYSNNLINHVK--NGTPKRPGKEIE  332

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TYLFAM+DEN K   P+    E+ +GLF P+   KY ++F
Sbjct  333   TYLFAMYDENKKPTPPD---VEKFWGLFHPNKQPKYEVNF  369



>gb|ACJ62633.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>ref|XP_003607322.1| Endo-1 3-beta-glucanase [Medicago truncatula]
Length=373

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 205/324 (63%), Gaps = 10/324 (3%)
 Frame = +2

Query  116   HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVD  295
             H+   QSIG CYG++ NNLP     I +++   I  +R+Y PD    +A RGS + +++ 
Sbjct  53    HLYKAQSIGACYGQVANNLPPVAFVINMFEQNIIHKMRIYNPDQATLEASRGSLLSLVIG  112

Query  296   VPNDMLPALAN-FNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKT-GSDYALAALKNV  466
             VPN+ + ++AN  ++A  WVQ NI+ Y P VNF+Y+ VGNE+ P     S + L A++N+
Sbjct  113   VPNEDIQSIANDISSANNWVQNNILKYTPGVNFRYIVVGNEINPSNDPTSQFVLRAMQNI  172

Query  467   HAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLAN  643
             ++AL +AN +  IK STA   G+L  +YPP  G F   A   +  IV FL     PLLAN
Sbjct  173   YSALASANLQNQIKISTAINMGLLGSSYPPSAGAFSASAIPYITSIVGFLVNTEAPLLAN  232

Query  644   IYPYFARTGDPDHVQLPFALFSEV-NSYSEENNLFDAMLESFYAAVEKAGGSNVQIVVSE  820
             ++PYFA  GDP ++ L FALF +  N+     NLFDA L+S YAA+EK GGS+V+IVVSE
Sbjct  233   VHPYFAYIGDPQNIPLDFALFKQQGNNAVGYQNLFDAQLDSVYAALEKVGGSSVKIVVSE  292

Query  821   TGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             +GWPS GG  A+  NA TYY NLI H    +GT  RPG  IETYLFAMFDEN K      
Sbjct  293   SGWPSAGGDVATIENARTYYSNLINHANSGNGTPLRPGQAIETYLFAMFDENQKP----G  348

Query  1001  DQTERHFGLFTPDMMS-KYNLSFN  1069
               TE+HFGLF P   S KY LSFN
Sbjct  349   AATEQHFGLFNPVGTSPKYILSFN  372



>gb|ACJ62673.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEENN-----LFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++ +     LFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQYLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>ref|XP_006396056.1| hypothetical protein EUTSA_v10007971mg [Eutrema salsugineum]
 gb|ESQ33342.1| hypothetical protein EUTSA_v10007971mg [Eutrema salsugineum]
Length=370

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 216/340 (64%), Gaps = 17/340 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             +A++ +L+G      H A  Q +GVCYGR G+NLP+   TI L+K   IR +RLY PD +
Sbjct  35    LASLTILLGLFFVNSHTAAGQQVGVCYGRYGDNLPSPAETIELFKQKNIRRVRLYSPDHD  94

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPY-PNVNFKYVAVGNEVYPG  424
             V  ALRGS+I+V++ +PN  L  +A+  + A  WVQ N+  Y  +V F+YV+VGNEV   
Sbjct  95    VLAALRGSDIEVMLGLPNQDLQRIASSQSEADTWVQNNVNNYVDDVKFRYVSVGNEVKIF  154

Query  425   KTGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPI  601
              + S + + A++N+  A+L +  GG IK STA   GVL  +YPP  G FK E   LM PI
Sbjct  155   DSYSQFLVPAMENIDRAVLGSGLGGRIKVSTAIDMGVLGESYPPSKGSFKGEVMVLMEPI  214

Query  602   VQFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESF  766
             ++FL     PL  N+Y YF+  G+PD ++L +ALF+       +      NLFDAML++ 
Sbjct  215   IRFLVNKKSPLHLNLYTYFSYAGNPDQIRLDYALFTASPGTVSDPPRSYQNLFDAMLDAV  274

Query  767   YAAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             ++A+E++GG ++ +VVSETGWP+EGG + +  NA  Y  NLI HV+  +GT KRPG  IE
Sbjct  275   HSALERSGGESLDVVVSETGWPTEGGTETNLENARIYSNNLINHVK--NGTPKRPGKEIE  332

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             TYLFAM+DEN K   P+    E+ +GLF P+   KY ++F
Sbjct  333   TYLFAMYDENKKPTPPD---VEKFWGLFHPNKQPKYEVNF  369



>gb|ABB04441.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ABB04453.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ABN09653.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 214/338 (63%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLLI F    G+    +GVCYG  GNNLP+ +  I LYK   I+ +R+Y+P+  V +AL
Sbjct  21    MLLLIFFTASIGITDAQVGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDPNQAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEISPVNGGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLL NIYPYF    +P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLTNIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFA FDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFATFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



>ref|XP_008351633.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Malus domestica]
Length=346

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 219/340 (64%), Gaps = 20/340 (6%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             + +I+L++G L       G Q IGVCYG  G+ LP     I LYK   IR +RLY+P+  
Sbjct  16    VISIILVLGQLMASFETTGAQ-IGVCYGMNGD-LPPQAEVIALYKQNNIRRMRLYDPNPA  73

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGK  427
                ALRGS+I++++ +PND L  +A+  A A  WVQ N+  Y NV FKY+AVGNE+ P  
Sbjct  74    ALAALRGSDIELMLGIPNDQLQNIASSQANANTWVQNNVRNYANVRFKYIAVGNEIKPSD  133

Query  428   TGSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
             + + + + A++N+  A+ +A  G  IK STA  +GVL  ++PP NG F+ +   ++ P+V
Sbjct  134   SSAQFLVPAMRNIQNAISSAGLGNQIKVSTAIDTGVLGKSFPPSNGEFRGDYSPILNPVV  193

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
             +FL  N  PLL N+YPYF+  G+   ++L +ALF+  +   ++      NLFDA+L++ Y
Sbjct  194   RFLVDNKSPLLVNLYPYFSYIGNTRDIRLDYALFTARSVVVQDGQRGYRNLFDAILDAVY  253

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             AA++K GG ++ IVVSE+GWP+ GG   +  NA TY  NL+QHV+G  GT ++PG  IET
Sbjct  254   AALDKVGGGSLDIVVSESGWPTAGGTATTVDNARTYNSNLVQHVKG--GTPRKPGRPIET  311

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             Y+FAMFDEN KT      + E+H+GLF+P+   KY ++FN
Sbjct  312   YIFAMFDENRKT-----PELEKHWGLFSPNKQPKYPINFN  346



>gb|ACJ62639.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 211/321 (66%), Gaps = 20/321 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSF  1066
             ++ERHFGLF PD    Y ++F
Sbjct  313   ESERHFGLFNPDKSPAYPINF  333



>gb|ACJ62625.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A++ AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>ref|XP_010273330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=316

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 204/319 (64%), Gaps = 17/319 (5%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             G  SIGVC G +G+ LP+    + LYK   I  +RLY P    F AL+GSNI+V++ VPN
Sbjct  4     GAYSIGVCNGLLGDPLPSPQEVVALYKANDINKMRLYAPHQPTFQALKGSNIEVMLGVPN  63

Query  305   DMLPALA--NFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAA  475
             + L  +A  +   AY +V  NIV     +NFKY+AVGNEV        Y L A++N+  A
Sbjct  64    EDLQRIAGNDLTPAYDFVYGNIVDNRATINFKYIAVGNEV--DLQYFQYVLPAMRNIQRA  121

Query  476   LLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYP  652
             + AA  +  +K +TATYS VLD TYPP N VF+ E    M+PI+ FLA+   PL ANIYP
Sbjct  122   VEAAGLQNQVKVTTATYSAVLDKTYPPSNSVFRAEYLQYMWPIIGFLAEKGSPLCANIYP  181

Query  653   YFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVS  817
             YFA  G+P  ++L +ALF+   +   +      NLFDAML+SFYAAVEKAGG +V+IVVS
Sbjct  182   YFAYIGNPSSIRLDYALFTAPGTVVTDGRFRYQNLFDAMLDSFYAAVEKAGGPSVKIVVS  241

Query  818   ETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPN  997
             E+GWP+ G   A+  NA+TY   LI+HV+G  GT +RP   IE Y+FAMFDEN K +   
Sbjct  242   ESGWPNAGESAATTANAQTYLNGLIRHVKG--GTPRRPNGPIEAYIFAMFDENKKPLP--  297

Query  998   NDQTERHFGLFTPDMMSKY  1054
               +TERHFGLF P+   KY
Sbjct  298   --ETERHFGLFFPNKQPKY  314



>ref|XP_008240765.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=347

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 217/341 (64%), Gaps = 18/341 (5%)
 Frame = +2

Query  83    IAAILLLIGFLHIAGVQS---IGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNV  253
             I +I+LL G L  +   +   IGVCYG +G+NLP+A   I++Y  Y I+ +RLY+P+   
Sbjct  13    IVSIMLLFGLLMASLTTTGAKIGVCYGTLGDNLPSAQEVISMYNQYSIQKMRLYDPNPQA  72

Query  254   FDALRGSNIDVIVDVPNDMLPALANFNA-AYYWVQRNIVPYPNVNFKYVAVGNEVYPGKT  430
               ALRGSNI++++DVPN+ L  +++  A A  W+Q N++ Y NVNFKY+ VGNE+ P   
Sbjct  73    LQALRGSNIELMLDVPNEGLKDISSSQASADSWIQSNVINYGNVNFKYIVVGNEIDPKGP  132

Query  431   GSDYALAALKNVHAALLAANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
              + +  +A++N+  A+ AA     IK STA Y+ +L  ++PP    F  E +  + PI+ 
Sbjct  133   FAPFVASAMENIQKAVSAAGLATQIKVSTAVYTAILKESFPPSKAFFNPEYRQFLDPIIA  192

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL  N  P L N+YPY +   +   + + +ALF+  +   ++      NLFDA+L++ Y 
Sbjct  193   FLVANQSPFLVNVYPYISYVQNRQTMGMDYALFTSPSVVVQDGQLGYQNLFDAILDAVYE  252

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPD--ASHGNAETYYKNLIQHVEGNHGTRKRPGSHIE  946
             A+EKAGG ++++VVSE+GWPS GG     +  NA TY  NL++HV+G  GT KRPGS +E
Sbjct  253   ALEKAGGGSLKLVVSESGWPSAGGDGEVTTKENARTYNSNLVKHVKG--GTPKRPGSPVE  310

Query  947   TYLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN  1069
             TY+FAMF+E+NKT      + E+H+GLF P+   KY++ FN
Sbjct  311   TYIFAMFNEDNKT----GPEIEKHWGLFFPNKTPKYSIDFN  347



>gb|ACJ62645.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +ALRG++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALRGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNE   G TGS   L A+KN++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEASGGDTGS--ILPAMKNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A+E AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGL  PD    Y ++F+
Sbjct  313   ESERHFGLSNPDKSPAYPINFS  334



>gb|ACJ62680.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A++ AG  NV +VVSE+
Sbjct  200   SYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04445.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 212/322 (66%), Gaps = 20/322 (6%)
 Frame = +2

Query  125   GVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPN  304
             GVQSIGVCYG  G+NLP A+  + LY++ GI  +R+Y PD N  +AL G++I +I+DVPN
Sbjct  26    GVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVPN  85

Query  305   DMLPALA-NFNAAYYWVQRNIVPYPNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
               L +LA + +AA  WVQ N+  +P+V+F+Y+AVGNEV  G TGS   L A++N++AAL 
Sbjct  86    TDLASLASDPSAAAAWVQSNVQAFPSVSFRYIAVGNEVSGGDTGS--ILPAMQNLNAALA  143

Query  482   AANRGG-IKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
              A  GG IK STA  S V    +PP  G F   ++  M PI Q+L     PLL N+YPYF
Sbjct  144   NAGLGGSIKVSTAVQSDVT-QGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLCNVYPYF  199

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             +  G+P  + L +ALF+   +  ++      NLFDA++++F +A++ AG  NV +VVSE+
Sbjct  200   SYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVPVVVSES  259

Query  824   GWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNND  1003
             GWPS GG  A+  NA+TY +NLI HV    GT KRPG  IETY+FAMF+E+ KT      
Sbjct  260   GWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPGP-IETYIFAMFNEDQKT----GA  312

Query  1004  QTERHFGLFTPDMMSKYNLSFN  1069
             ++ERHFGLF PD    Y ++F+
Sbjct  313   ESERHFGLFNPDKSPAYPINFS  334



>gb|AAF08679.1| beta-1,3-glucanase [Musa acuminata AAA Group]
Length=322

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 216/322 (67%), Gaps = 16/322 (5%)
 Frame = +2

Query  128   VQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDALRGSNIDVIVDVPND  307
             VQSIGVCYG +GNNLP  +  ++LYK+  I  +RLY+P+     ALR SNI V++DVP  
Sbjct  8     VQSIGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRS  67

Query  308   MLPALA-NFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGKTGSDYALAALKNVHAALL  481
              + +LA N +AA  W++RN+V Y P+V+F+Y+AVGNE+ PG   + Y L A++N++ AL 
Sbjct  68    DVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALS  127

Query  482   AAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQFLAQNNLPLLANIYPYF  658
             +A  +  IK STA  +GVL  +YPP  G F   A+  + PIVQFLA N  PLL N+YPYF
Sbjct  128   SAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYF  187

Query  659   ARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYAAVEKAGGSNVQIVVSET  823
             + TG+P  + LP+ALF+      ++      NLFDA++++ +AA+E+ GG+NV +VVSE+
Sbjct  188   SYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSES  247

Query  824   GWPSE-GGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETYLFAMFDENNKTVKPNN  1000
             GWPS  GG +AS  NA+TY +NLI+HV G  GT +RPG  IE Y+F MF+EN K      
Sbjct  248   GWPSAGGGAEASTSNAQTYNQNLIRHVGG--GTPRRPGKEIEAYIFEMFNENQKA-----  300

Query  1001  DQTERHFGLFTPDMMSKYNLSF  1066
                E++FGLF P+    Y +SF
Sbjct  301   GGIEQNFGLFYPNKQPVYQISF  322



>ref|XP_006284042.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
 gb|EOA16940.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
Length=346

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 217/343 (63%), Gaps = 17/343 (5%)
 Frame = +2

Query  83    IAAILLLIGFL----HIAGVQSIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTN  250
             I  +LLL+       +    + +GVCYG +GNNLP+ + TI L++   IR +RLY+P+  
Sbjct  4     ITPLLLLVALFTSIFNPTSGEPVGVCYGMMGNNLPSHSDTIALFREKNIRRVRLYDPNQA  63

Query  251   VFDALRGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVPY-PNVNFKYVAVGNEVYPGK  427
               +AL+ S I+VIV VPN  L +L N ++A  W+Q N++ Y P V+FKY++VGNEV PG 
Sbjct  64    ALNALKNSGIEVIVGVPNSDLRSLTNPSSARSWLQNNVLNYYPAVSFKYISVGNEVSPGN  123

Query  428   TGSDYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIV  604
              G D  L A++NV+ AL  AN +  IK STA    ++ +++PP +G F+ + +    PI+
Sbjct  124   -GGDLVLPAMRNVYDALRGANLQDRIKVSTAIDMTLIGNSFPPSSGEFRGDVRWYTDPII  182

Query  605   QFLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFY  769
              FL   N  LLANIYPYF+  G+P  + L +ALF+  +    +      NLFDA+L+  Y
Sbjct  183   GFLTSTNSALLANIYPYFSYVGNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVVY  242

Query  770   AAVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIET  949
             +AVE++GG ++ +VVSE+GWPS GG  AS  NA  YY NL   V  N GT KRPG  +ET
Sbjct  243   SAVERSGGGSIPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVET  302

Query  950   YLFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSFN*VQ  1078
             YLFAMFDEN K+      + E++FGLF P+   K+ ++F+ V+
Sbjct  303   YLFAMFDENQKS-----PEIEKNFGLFFPNKQPKFPITFSAVR  340



>gb|AAA87456.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 213/338 (63%), Gaps = 20/338 (6%)
 Frame = +2

Query  92    ILLLIGFLHIAGVQ--SIGVCYGRIGNNLPNATATITLYKNYGIRGLRLYEPDTNVFDAL  265
             +LLL  F    G+    +GVCYG  GNNLP  +  I LYK   I  +R+Y+P+  V +AL
Sbjct  21    MLLLFFFAASVGITDAQVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNRAVLEAL  80

Query  266   RGSNIDVIVDVPNDMLPALANFNAAYYWVQRNIVP-YPNVNFKYVAVGNEVYPGKTGS--  436
             RGSNI++I+ VPN  L +L N + A  WVQ+N+   + +V F+Y+AVGNE+ P   G+  
Sbjct  81    RGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEISPVNRGTAW  140

Query  437   --DYALAALKNVHAALLAAN-RGGIKASTATYSGVLDHTYPPENGVFKDEAKNLMYPIVQ  607
                + L A++N+H A+ +A  +  IK STA    ++ ++YPP  G F+D+ ++ + PI+ 
Sbjct  141   LAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIG  200

Query  608   FLAQNNLPLLANIYPYFARTGDPDHVQLPFALFSEVNSYSEE-----NNLFDAMLESFYA  772
             FL+    PLLANIYPYF    +P  + LP+ALF+  +    +      NLFDA L++ Y+
Sbjct  201   FLSSIRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYS  260

Query  773   AVEKAGGSNVQIVVSETGWPSEGGPDASHGNAETYYKNLIQHVEGNHGTRKRPGSHIETY  952
             A+E+A G ++++VVSE+GWPS G   A+  N  TY  NLIQHV+G  GT KRP   IETY
Sbjct  261   ALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETY  318

Query  953   LFAMFDENNKTVKPNNDQTERHFGLFTPDMMSKYNLSF  1066
             LFAMFDEN K       + E+HFGLF PD   KYNL+F
Sbjct  319   LFAMFDENKK-----QPEVEKHFGLFFPDKRPKYNLNF  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2899735426956