BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13703_g1_i1 len=298 path=[2020:0-297]

Length=298
                                                                      Score     E

ref|XP_009617515.1|  PREDICTED: uncharacterized protein LOC104109...    136   3e-37   
ref|XP_009617514.1|  PREDICTED: uncharacterized protein LOC104109...    137   4e-37   
ref|XP_009790406.1|  PREDICTED: uncharacterized protein LOC104237876    137   4e-37   
ref|XP_009617509.1|  PREDICTED: uncharacterized protein LOC104109...    137   8e-37   
ref|XP_010256021.1|  PREDICTED: probable tubulin--tyrosine ligase...    135   2e-36   
ref|XP_010256020.1|  PREDICTED: uncharacterized protein LOC104596...    136   2e-36   
gb|EPS61093.1|  hypothetical protein M569_13707                         134   5e-36   
ref|XP_006360803.1|  PREDICTED: uncharacterized protein LOC102581...    133   7e-36   
ref|XP_006360804.1|  PREDICTED: uncharacterized protein LOC102581...    133   7e-36   
ref|XP_006360801.1|  PREDICTED: uncharacterized protein LOC102581...    133   2e-35   
emb|CDO99053.1|  unnamed protein product                                132   5e-35   
ref|XP_007034747.1|  Survival protein SurE-like phosphatase/nucle...    132   5e-35   
ref|XP_004247359.1|  PREDICTED: uncharacterized protein LOC101253...    132   5e-35   
ref|XP_010326546.1|  PREDICTED: uncharacterized protein LOC101253...    132   7e-35   
ref|XP_008224320.1|  PREDICTED: uncharacterized protein LOC103324062    130   2e-34   
gb|EYU45650.1|  hypothetical protein MIMGU_mgv1a010439mg                130   2e-34   
ref|XP_007222992.1|  hypothetical protein PRUPE_ppa008995mg             130   3e-34   
gb|KDP40167.1|  hypothetical protein JCGZ_02165                         127   4e-33   
ref|XP_006387674.1|  hypothetical protein POPTR_0683s00200g             127   4e-33   
ref|XP_011021531.1|  PREDICTED: uncharacterized protein LOC105123575    127   6e-33   
ref|XP_008340999.1|  PREDICTED: uncharacterized protein LOC103403934    122   6e-33   
ref|XP_010090909.1|  5'-nucleotidase surE                               126   7e-33   
ref|XP_002282293.1|  PREDICTED: uncharacterized protein LOC100242666    126   8e-33   Vitis vinifera
ref|XP_010694161.1|  PREDICTED: uncharacterized protein LOC104907010    126   9e-33   
ref|XP_011090721.1|  PREDICTED: uncharacterized protein LOC105171345    125   2e-32   
gb|KCW60760.1|  hypothetical protein EUGRSUZ_H03483                     124   2e-32   
ref|XP_010024311.1|  PREDICTED: uncharacterized protein LOC104414821    125   2e-32   
ref|XP_010024305.1|  PREDICTED: uncharacterized protein LOC104414818    124   3e-32   
ref|XP_006573884.1|  PREDICTED: uncharacterized protein LOC100808...    124   3e-32   
ref|XP_003517577.1|  PREDICTED: uncharacterized protein LOC100808...    124   3e-32   
ref|XP_009782713.1|  PREDICTED: uncharacterized protein LOC104231414    124   4e-32   
gb|KDO74617.1|  hypothetical protein CISIN_1g021451mg                   122   4e-32   
ref|XP_003539322.1|  PREDICTED: uncharacterized protein LOC100792...    124   5e-32   
ref|XP_002517148.1|  5'-nucleotidase surE, putative                     124   6e-32   Ricinus communis
ref|XP_009366944.1|  PREDICTED: uncharacterized protein LOC103956639    123   7e-32   
gb|KDO74616.1|  hypothetical protein CISIN_1g021451mg                   123   9e-32   
ref|XP_009366934.1|  PREDICTED: uncharacterized protein LOC103956...    123   1e-31   
ref|XP_009366935.1|  PREDICTED: uncharacterized protein LOC103956...    123   1e-31   
ref|XP_009619657.1|  PREDICTED: uncharacterized protein LOC104111622    124   1e-31   
ref|XP_006378397.1|  hypothetical protein POPTR_0010s09840g             123   1e-31   
ref|XP_006419919.1|  hypothetical protein CICLE_v10005476mg             123   1e-31   
ref|XP_006489377.1|  PREDICTED: uncharacterized protein LOC102626...    123   1e-31   
gb|KDO74613.1|  hypothetical protein CISIN_1g021451mg                   123   1e-31   
ref|XP_009366930.1|  PREDICTED: uncharacterized protein LOC103956...    123   2e-31   
gb|KDO74612.1|  hypothetical protein CISIN_1g021451mg                   122   2e-31   
ref|XP_004162274.1|  PREDICTED: 5'-nucleotidase SurE-like               122   2e-31   
ref|XP_004134138.1|  PREDICTED: 5'-nucleotidase SurE-like               122   2e-31   
ref|XP_004299124.1|  PREDICTED: 5'-nucleotidase SurE-like               122   2e-31   
ref|XP_010035228.1|  PREDICTED: uncharacterized protein LOC104424482    120   1e-30   
ref|XP_006356674.1|  PREDICTED: uncharacterized protein LOC102600953    120   1e-30   
gb|KCW84224.1|  hypothetical protein EUGRSUZ_B01087                     120   2e-30   
gb|KCW84225.1|  hypothetical protein EUGRSUZ_B01087                     120   2e-30   
ref|XP_009344093.1|  PREDICTED: uncharacterized protein LOC103935984    119   3e-30   
ref|XP_007157136.1|  hypothetical protein PHAVU_002G045800g             119   6e-30   
ref|XP_008438680.1|  PREDICTED: uncharacterized protein LOC103483713    118   1e-29   
ref|XP_003592399.1|  5'-nucleotidase surE                               117   2e-29   
ref|XP_010090910.1|  5'-nucleotidase surE                               119   2e-29   
gb|AFK47113.1|  unknown                                                 114   3e-29   
ref|XP_004241053.1|  PREDICTED: uncharacterized protein LOC101261826    116   5e-29   
ref|XP_004496738.1|  PREDICTED: 5'-nucleotidase SurE-like               116   6e-29   
ref|XP_006284159.1|  hypothetical protein CARUB_v10005292mg             115   8e-29   
ref|NP_567449.1|  survival protein SurE-like phosphatase/nucleoti...    115   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034746.1|  Survival protein SurE-like phosphatase/nucle...    115   2e-28   
ref|XP_010934984.1|  PREDICTED: uncharacterized protein LOC105054...    114   2e-28   
ref|XP_007034745.1|  Survival protein SurE-like phosphatase/nucle...    115   2e-28   
emb|CDY29782.1|  BnaA01g18840D                                          112   2e-28   
ref|XP_010934966.1|  PREDICTED: uncharacterized protein LOC105054...    114   3e-28   
ref|XP_010449971.1|  PREDICTED: uncharacterized protein LOC104732139    114   3e-28   
gb|KEH27352.1|  survival protein SurE-like phosphatase/nucleotidase     113   3e-28   
ref|XP_008352620.1|  PREDICTED: uncharacterized protein LOC103416137    114   4e-28   
ref|XP_003610719.1|  5'-nucleotidase surE                               114   5e-28   
ref|XP_009147996.1|  PREDICTED: uncharacterized protein LOC103871492    113   8e-28   
ref|XP_006414620.1|  hypothetical protein EUTSA_v10025783mg             113   8e-28   
gb|KFK43729.1|  hypothetical protein AALP_AA1G164900                    113   8e-28   
ref|XP_010440373.1|  PREDICTED: uncharacterized protein LOC104723681    113   1e-27   
ref|XP_002870272.1|  hypothetical protein ARALYDRAFT_493398             112   1e-27   
ref|XP_010532537.1|  PREDICTED: uncharacterized protein LOC104808540    112   2e-27   
emb|CDY22722.1|  BnaA08g05520D                                          112   2e-27   
ref|XP_009107807.1|  PREDICTED: uncharacterized protein LOC103833477    112   2e-27   
emb|CDY09040.1|  BnaC08g09940D                                          112   2e-27   
ref|XP_009412474.1|  PREDICTED: uncharacterized protein LOC103993956    112   3e-27   
ref|XP_010435047.1|  PREDICTED: uncharacterized protein LOC104718920    111   5e-27   
tpg|DAA59951.1|  TPA: hypothetical protein ZEAMMB73_153792              107   5e-27   
ref|XP_003557407.1|  PREDICTED: probable tubulin--tyrosine ligase...    110   5e-27   
ref|XP_009420646.1|  PREDICTED: uncharacterized protein LOC104000351    110   6e-27   
ref|XP_004955782.1|  PREDICTED: acid phosphatase-like isoform X2        109   2e-26   
ref|XP_006658386.1|  PREDICTED: uncharacterized protein LOC102721291    109   2e-26   
ref|XP_008805747.1|  PREDICTED: uncharacterized protein LOC103718615    109   2e-26   
ref|XP_002461661.1|  hypothetical protein SORBIDRAFT_02g006090          109   2e-26   Sorghum bicolor [broomcorn]
ref|XP_004955781.1|  PREDICTED: acid phosphatase-like isoform X1        109   2e-26   
dbj|BAG86778.1|  unnamed protein product                                109   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059144.1|  Os07g0204500                                       108   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006356672.1|  PREDICTED: acid phosphatase-like isoform X3        107   6e-26   
ref|XP_006356670.1|  PREDICTED: acid phosphatase-like isoform X1        108   7e-26   
dbj|BAJ87892.1|  predicted protein                                      107   8e-26   
ref|XP_008652177.1|  PREDICTED: uncharacterized protein LOC103632103    107   9e-26   
ref|XP_010322260.1|  PREDICTED: uncharacterized protein LOC101261...    105   3e-25   
ref|XP_004241052.1|  PREDICTED: uncharacterized protein LOC101261...    106   4e-25   
emb|CAB10272.1|  hypothetical protein                                   105   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858911.1|  hypothetical protein AMTR_s00068p00035490          103   2e-24   
gb|ABK23714.1|  unknown                                                 102   2e-24   Picea sitchensis
gb|AES93678.2|  survival protein SurE-like phosphatase/nucleotidase   95.1    3e-21   
ref|XP_003610720.1|  5'-nucleotidase surE                             95.1    3e-21   
ref|XP_010696523.1|  PREDICTED: uncharacterized protein LOC104909039  91.7    1e-19   
emb|CDO97899.1|  unnamed protein product                              88.6    2e-18   
ref|XP_011015672.1|  PREDICTED: uncharacterized protein LOC105119...  87.0    4e-18   
ref|XP_001784822.1|  predicted protein                                85.1    6e-18   
ref|XP_011015671.1|  PREDICTED: uncharacterized protein LOC105119...  86.7    8e-18   
ref|XP_001766580.1|  predicted protein                                84.3    1e-17   
gb|ABK94047.1|  unknown                                               85.9    1e-17   Populus trichocarpa [western balsam poplar]
gb|KDO65184.1|  hypothetical protein CISIN_1g022032mg                 84.0    1e-17   
ref|XP_004146815.1|  PREDICTED: 5'-nucleotidase SurE-like             85.9    1e-17   
ref|XP_002299895.2|  acid phosphatase survival protein SurE           85.9    1e-17   Populus trichocarpa [western balsam poplar]
gb|KDO65185.1|  hypothetical protein CISIN_1g022032mg                 83.6    2e-17   
gb|ABR16074.1|  unknown                                               85.5    2e-17   Picea sitchensis
ref|XP_004303652.1|  PREDICTED: 5'-nucleotidase SurE-like             84.7    2e-17   
gb|KDO65183.1|  hypothetical protein CISIN_1g022032mg                 84.0    3e-17   
gb|KDO65182.1|  hypothetical protein CISIN_1g022032mg                 84.0    3e-17   
ref|XP_007215687.1|  hypothetical protein PRUPE_ppa008696mg           83.6    4e-17   
ref|XP_006853858.1|  hypothetical protein AMTR_s00036p00106140        84.3    5e-17   
ref|XP_007150495.1|  hypothetical protein PHAVU_005G157500g           84.0    5e-17   
ref|XP_006426577.1|  hypothetical protein CICLE_v10025780mg           84.3    5e-17   
ref|XP_008447629.1|  PREDICTED: uncharacterized protein LOC103490041  84.0    6e-17   
ref|XP_010924989.1|  PREDICTED: uncharacterized protein LOC105047656  84.3    6e-17   
gb|KHN30063.1|  5'-nucleotidase surE                                  83.2    6e-17   
ref|XP_006466007.1|  PREDICTED: uncharacterized protein LOC102624443  84.3    6e-17   
ref|XP_008228273.1|  PREDICTED: uncharacterized protein LOC103327688  84.0    6e-17   
ref|NP_001241615.1|  uncharacterized protein LOC100779772             83.6    8e-17   
emb|CDX68252.1|  BnaA07g22920D                                        83.6    8e-17   
gb|KDP33860.1|  hypothetical protein JCGZ_07431                       84.0    8e-17   
ref|XP_009104839.1|  PREDICTED: uncharacterized protein LOC103830776  83.6    9e-17   
ref|XP_010685370.1|  PREDICTED: uncharacterized protein LOC104899800  83.2    9e-17   
emb|CDY53290.1|  BnaCnng24750D                                        83.2    1e-16   
ref|XP_008242371.1|  PREDICTED: uncharacterized protein LOC103340703  83.6    1e-16   
ref|XP_002978358.1|  hypothetical protein SELMODRAFT_14959            81.6    1e-16   
ref|XP_010907863.1|  PREDICTED: uncharacterized protein LOC105034...  83.2    1e-16   
ref|XP_010242242.1|  PREDICTED: uncharacterized protein LOC104586648  83.2    1e-16   
ref|XP_010907721.1|  PREDICTED: uncharacterized protein LOC105034...  83.2    1e-16   
ref|XP_010416061.1|  PREDICTED: uncharacterized protein LOC104701976  82.8    2e-16   
gb|KHG01721.1|  5'-nucleotidase surE                                  82.8    2e-16   
ref|XP_002276942.1|  PREDICTED: uncharacterized protein LOC100242981  82.4    2e-16   Vitis vinifera
ref|XP_010262068.1|  PREDICTED: uncharacterized protein LOC104600684  82.8    2e-16   
ref|XP_011009858.1|  PREDICTED: uncharacterized protein LOC105114858  80.1    2e-16   
ref|XP_009392992.1|  PREDICTED: uncharacterized protein LOC103978786  82.4    3e-16   
ref|XP_006302370.1|  hypothetical protein CARUB_v10020451mg           82.0    3e-16   
gb|KFK41715.1|  hypothetical protein AALP_AA2G164000                  81.6    4e-16   
ref|XP_010428191.1|  PREDICTED: uncharacterized protein LOC104712896  81.6    4e-16   
ref|XP_003546718.1|  PREDICTED: uncharacterized protein LOC100790...  81.6    4e-16   
ref|XP_010471334.1|  PREDICTED: uncharacterized protein LOC104751142  81.6    5e-16   
gb|AAD55635.1|AC008017_8  Unknown protein                             81.3    5e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72957.1|  BnaC06g34050D                                        81.3    5e-16   
ref|XP_002970193.1|  hypothetical protein SELMODRAFT_441080           81.6    6e-16   
dbj|BAH57142.1|  AT1G72880                                            80.9    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357386.1|  PREDICTED: uncharacterized protein LOC102588933  80.9    7e-16   
ref|XP_004241879.1|  PREDICTED: uncharacterized protein LOC101267031  80.9    8e-16   
ref|NP_177431.1|  survival protein SurE-like phosphatase/nucleoti...  80.9    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390611.1|  hypothetical protein EUTSA_v10018692mg           80.9    1e-15   
ref|XP_007203123.1|  hypothetical protein PRUPE_ppa024008mg           80.9    1e-15   
ref|XP_004511452.1|  PREDICTED: 5'-nucleotidase SurE-like             79.7    1e-15   
ref|XP_010033769.1|  PREDICTED: uncharacterized protein LOC104423012  80.1    2e-15   
ref|XP_007024517.1|  Acid phosphatase                                 80.1    2e-15   
ref|XP_008807163.1|  PREDICTED: uncharacterized protein LOC103719612  80.1    2e-15   
ref|XP_004288960.1|  PREDICTED: 5'-nucleotidase SurE-like             79.7    2e-15   
ref|XP_006385420.1|  acid phosphatase survival protein SurE           79.7    2e-15   
ref|XP_011009859.1|  PREDICTED: uncharacterized protein LOC105114859  79.7    3e-15   
gb|ACR34676.1|  unknown                                               77.4    3e-15   Zea mays [maize]
ref|XP_003569660.1|  PREDICTED: uncharacterized protein LOC100842342  79.3    3e-15   
emb|CDX96436.1|  BnaA07g30470D                                        79.3    3e-15   
ref|XP_009798241.1|  PREDICTED: uncharacterized protein LOC104244504  79.3    3e-15   
ref|XP_009105950.1|  PREDICTED: uncharacterized protein LOC103831786  79.3    3e-15   
ref|XP_009616297.1|  PREDICTED: uncharacterized protein LOC104108863  79.0    4e-15   
ref|XP_003597571.1|  5'-nucleotidase surE                             79.0    4e-15   
gb|KDP40754.1|  hypothetical protein JCGZ_24753                       79.0    5e-15   
ref|XP_008391343.1|  PREDICTED: uncharacterized protein LOC103453576  78.6    6e-15   
ref|XP_004486847.1|  PREDICTED: 5'-nucleotidase SurE-like             78.6    6e-15   
ref|XP_010656176.1|  PREDICTED: uncharacterized protein LOC100245...  78.2    7e-15   
ref|XP_002279415.1|  PREDICTED: uncharacterized protein LOC100245...  78.2    7e-15   Vitis vinifera
gb|EPS57329.1|  hypothetical protein M569_17488                       78.2    7e-15   
ref|XP_010318496.1|  PREDICTED: uncharacterized protein LOC101263...  77.8    7e-15   
ref|XP_003531609.1|  PREDICTED: uncharacterized protein LOC100776267  78.2    8e-15   
ref|XP_004235585.1|  PREDICTED: uncharacterized protein LOC101263...  77.8    1e-14   
ref|XP_009588878.1|  PREDICTED: uncharacterized protein LOC104086340  77.4    1e-14   
ref|XP_002888898.1|  hypothetical protein ARALYDRAFT_476423           77.4    1e-14   
ref|XP_009795881.1|  PREDICTED: uncharacterized protein LOC104242507  77.4    2e-14   
emb|CBI27894.3|  unnamed protein product                              78.2    2e-14   
ref|NP_001151071.1|  acid phosphatase                                 77.4    2e-14   Zea mays [maize]
ref|XP_009412229.1|  PREDICTED: uncharacterized protein LOC103993772  76.6    3e-14   
ref|WP_026882691.1|  stationary phase survival protein SurE           75.1    3e-14   
ref|XP_011072533.1|  PREDICTED: uncharacterized protein LOC105157763  76.6    3e-14   
gb|EYU21362.1|  hypothetical protein MIMGU_mgv1a018727mg              74.7    4e-14   
ref|XP_009127958.1|  PREDICTED: uncharacterized protein LOC103852812  76.3    4e-14   
ref|XP_010540078.1|  PREDICTED: uncharacterized protein LOC104813948  76.3    4e-14   
gb|KHN39314.1|  5'-nucleotidase surE                                  75.9    4e-14   
gb|EAZ13283.1|  hypothetical protein OsJ_03208                        76.6    5e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ACN28052.1|  unknown                                               73.9    5e-14   Zea mays [maize]
ref|NP_001044033.1|  Os01g0709400                                     76.3    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006342968.1|  PREDICTED: uncharacterized protein LOC102583687  75.9    5e-14   
gb|EAY75560.1|  hypothetical protein OsI_03464                        76.3    5e-14   Oryza sativa Indica Group [Indian rice]
emb|CDX82123.1|  BnaC02g21670D                                        75.5    6e-14   
gb|AHM56559.1|  5'-nucleotidase SurE                                  73.9    7e-14   
ref|XP_002456236.1|  hypothetical protein SORBIDRAFT_03g032610        75.9    7e-14   Sorghum bicolor [broomcorn]
ref|XP_004969715.1|  PREDICTED: uncharacterized protein LOC101780960  75.9    8e-14   
ref|XP_010537568.1|  PREDICTED: uncharacterized protein LOC104812224  75.5    9e-14   
gb|KHG18100.1|  5'-nucleotidase surE                                  74.7    1e-13   
ref|WP_013257275.1|  stationary phase survival protein SurE           73.6    1e-13   
ref|WP_022663719.1|  nucleotidase                                     73.2    2e-13   
ref|XP_011080073.1|  PREDICTED: uncharacterized protein LOC105163...  74.7    2e-13   
ref|XP_006646255.1|  PREDICTED: uncharacterized protein LOC102713705  73.6    2e-13   
ref|XP_007138715.1|  hypothetical protein PHAVU_009G231200g           73.9    3e-13   
ref|XP_003533765.1|  PREDICTED: uncharacterized protein LOC100785...  73.9    3e-13   
ref|XP_011080065.1|  PREDICTED: uncharacterized protein LOC105163...  73.9    3e-13   
ref|XP_008672803.1|  PREDICTED: acid phosphatase isoform X4           73.6    5e-13   
ref|WP_012531116.1|  stationary phase survival protein SurE           71.6    5e-13   
gb|AIS52432.1|  5'-nucleotidase SurE                                  71.6    5e-13   
ref|WP_026840538.1|  stationary phase survival protein SurE           71.6    5e-13   
ref|WP_024334057.1|  nucleotidase                                     71.6    5e-13   
ref|NP_001147148.1|  acid phosphatase                                 73.6    5e-13   Zea mays [maize]
ref|WP_012648406.1|  stationary phase survival protein SurE           71.6    5e-13   
ref|WP_006965847.1|  stationary-phase survival protein SurE           71.6    5e-13   
ref|WP_013278508.1|  stationary phase survival protein SurE           71.6    6e-13   
ref|XP_008672799.1|  PREDICTED: acid phosphatase isoform X2           73.2    6e-13   
emb|CDM83776.1|  unnamed protein product                              73.2    6e-13   
ref|XP_002521387.1|  acid phosphatase, putative                       73.2    6e-13   Ricinus communis
ref|XP_008672802.1|  PREDICTED: acid phosphatase isoform X3           73.2    6e-13   
ref|XP_003529777.1|  PREDICTED: uncharacterized protein LOC100814744  72.8    7e-13   
ref|XP_007135537.1|  hypothetical protein PHAVU_010G137700g           72.8    7e-13   
ref|WP_013175383.1|  stationary phase survival protein SurE           71.2    8e-13   
ref|WP_035422548.1|  MULTISPECIES: stationary phase survival prot...  70.9    9e-13   
ref|WP_011939473.1|  stationary phase survival protein SurE           70.9    1e-12   
ref|WP_018205883.1|  hypothetical protein                             70.9    1e-12   
ref|XP_007012796.1|  Survival protein SurE-like phosphatase/nucle...  71.6    1e-12   
ref|WP_003446796.1|  stationary phase survival protein SurE           70.5    1e-12   
ref|WP_038268174.1|  hypothetical protein [                           70.5    1e-12   
ref|WP_003870656.1|  MULTISPECIES: stationary phase survival prot...  70.5    1e-12   
ref|WP_004100941.1|  stationary phase survival protein SurE           70.5    1e-12   
gb|KGX86740.1|  stationary phase survival protein SurE                70.5    1e-12   
ref|WP_036834241.1|  stationary phase survival protein SurE           70.5    1e-12   
ref|XP_007012794.1|  Acid phosphatase, putative isoform 1             72.0    1e-12   
ref|WP_036732936.1|  5'-nucleotidase                                  70.5    1e-12   
ref|WP_022772160.1|  5'-nucleotidase                                  70.1    2e-12   
ref|WP_013756591.1|  multifunctional protein surE                     70.5    2e-12   
ref|XP_007012795.1|  Acid phosphatase isoform 2                       71.6    2e-12   
ref|WP_027434485.1|  hypothetical protein                             70.1    2e-12   
ref|WP_014455967.1|  5'/3'-nucleotidase SurE                          70.1    2e-12   
ref|WP_005584758.1|  5'-nucleotidase SurE                             70.1    2e-12   
gb|AGO87874.1|  stationary phase survival protein SurE                69.7    2e-12   
ref|WP_015617057.1|  5'/3'-nucleotidase SurE                          69.7    2e-12   
dbj|BAJ94333.1|  predicted protein                                    71.6    2e-12   
ref|WP_014451274.1|  stationary phase survival protein SurE           69.7    2e-12   
ref|WP_041081957.1|  stationary phase survival protein SurE           69.7    3e-12   
ref|WP_015836860.1|  stationary phase survival protein SurE           69.7    3e-12   
ref|XP_010087727.1|  5'-nucleotidase surE                             70.1    3e-12   
ref|WP_040498748.1|  stationary phase survival protein SurE           69.3    3e-12   
emb|CAM76763.1|  Survival protein SurE                                69.7    3e-12   Magnetospirillum gryphiswaldense
ref|WP_024079295.1|  broad specificity 5'(3')-nucleotidase and po...  69.3    3e-12   
ref|WP_022776817.1|  5'-nucleotidase                                  69.3    4e-12   
ref|WP_015720855.1|  stationary phase survival protein SurE           68.9    4e-12   
ref|WP_026679639.1|  stationary phase survival protein SurE           68.9    5e-12   
gb|EEE66769.1|  hypothetical protein OsJ_23493                        69.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|WP_012057058.1|  stationary phase survival protein SurE           68.9    5e-12   
ref|WP_013240098.1|  MULTISPECIES: stationary phase survival prot...  68.9    5e-12   
ref|WP_014062848.1|  stationary phase survival protein SurE           68.9    5e-12   
ref|WP_014956816.1|  nucleotidase                                     68.9    5e-12   
gb|EEC81705.1|  hypothetical protein OsI_25312                        69.3    5e-12   Oryza sativa Indica Group [Indian rice]
gb|KHG05983.1|  5'-nucleotidase surE                                  70.1    6e-12   
ref|WP_026868856.1|  stationary phase survival protein SurE           68.6    6e-12   
ref|WP_034846060.1|  stationary phase survival protein SurE           68.6    6e-12   
ref|WP_029231428.1|  5'-nucleotidase                                  68.6    6e-12   
ref|WP_027363683.1|  5'-nucleotidase                                  68.6    7e-12   
ref|WP_038293917.1|  5'-nucleotidase [                                68.6    7e-12   
emb|CEK29656.1|  stationary-phase survival protein SurE [ [           68.6    7e-12   
ref|WP_021121529.1|  5'/3'-nucleotidase SurE [                        68.6    7e-12   
ref|WP_035783476.1|  5'-nucleotidase                                  68.6    7e-12   
gb|EPZ56738.1|  5'/3'-nucleotidase SurE [ [                           68.6    7e-12   
emb|CEK38462.1|  acid phosphatase [ [                                 68.6    8e-12   
ref|WP_034104465.1|  5'-nucleotidase                                  68.6    8e-12   
ref|WP_023787284.1|  stationary phase survival protein SurE           68.6    8e-12   
ref|WP_013405799.1|  5'-nucleotidase                                  68.6    9e-12   
emb|CEK33499.1|  stationary-phase survival protein SurE,5'-nucleo...  68.2    9e-12   
gb|AGO88059.1|  stationary phase survival protein SurE                68.2    9e-12   
ref|WP_027289036.1|  stationary phase survival protein SurE           68.2    1e-11   
ref|WP_041018633.1|  stationary phase survival protein SurE           68.2    1e-11   
ref|XP_008775154.1|  PREDICTED: uncharacterized protein LOC103695568  68.6    1e-11   
ref|XP_002505041.1|  predicted protein                                69.3    1e-11   
ref|WP_015851789.1|  stationary phase survival protein SurE           67.8    1e-11   
ref|WP_012805306.1|  stationary phase survival protein SurE           67.8    1e-11   
ref|WP_026496347.1|  5'-nucleotidase                                  67.8    1e-11   
ref|WP_015337225.1|  5'-nucleotidase surE                             67.8    1e-11   
ref|WP_027722923.1|  stationary phase survival protein SurE           67.8    1e-11   
gb|KHO62451.1|  5'/3'-nucleotidase SurE                               67.8    1e-11   
ref|WP_013614285.1|  stationary phase survival protein SurE           67.8    1e-11   
ref|WP_026669681.1|  5'-nucleotidase                                  67.4    1e-11   
ref|WP_026524361.1|  5'-nucleotidase                                  67.4    1e-11   
ref|WP_027837851.1|  stationary phase survival protein SurE           67.8    2e-11   
ref|WP_011698033.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_011195842.1|  stationary phase survival protein SurE           67.8    2e-11   
ref|WP_005812070.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_028577104.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_026672411.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_018703189.1|  hypothetical protein                             67.4    2e-11   
ref|WP_035344985.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_027937410.1|  5'-nucleotidase                                  67.4    2e-11   
ref|WP_003867979.1|  MULTISPECIES: stationary phase survival prot...  67.4    2e-11   
ref|WP_024879884.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_026598570.1|  stationary phase survival protein SurE           67.4    2e-11   
ref|WP_006310346.1|  5-nucleotidase SurE                              67.0    2e-11   
ref|WP_013150305.1|  MULTISPECIES: stationary phase survival prot...  67.0    2e-11   
ref|WP_027116230.1|  5'-nucleotidase                                  67.0    2e-11   
ref|WP_035135853.1|  stationary phase survival protein SurE           67.0    2e-11   
ref|WP_018265455.1|  MULTISPECIES: stationary phase survival prot...  67.0    2e-11   
ref|WP_026518756.1|  5'-nucleotidase                                  67.0    2e-11   
gb|KIC72859.1|  5'-nucleotidase SurE                                  67.4    2e-11   
ref|WP_034434072.1|  hypothetical protein                             67.0    3e-11   
dbj|BAD70183.1|  survival protein SurE                                66.2    3e-11   
ref|WP_027134696.1|  stationary phase survival protein SurE           67.0    3e-11   
ref|WP_026489243.1|  5'-nucleotidase                                  66.6    3e-11   
ref|WP_039383940.1|  stationary phase survival protein SurE           67.0    3e-11   
ref|WP_034997139.1|  stationary phase survival protein SurE           66.6    3e-11   
emb|CBX28351.1|  5'-nucleotidase surE                                 66.6    3e-11   
ref|WP_020184706.1|  hypothetical protein                             66.6    3e-11   
ref|WP_035289082.1|  stationary phase survival protein SurE           66.6    3e-11   
ref|WP_004511648.1|  stationary phase survival protein SurE           66.6    3e-11   
ref|WP_031513980.1|  5'-nucleotidase                                  66.6    3e-11   
gb|AGO88087.1|  stationary phase survival protein SurE                66.6    3e-11   
ref|WP_038059779.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_008634011.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_012995198.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_014509698.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_013780577.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_029895419.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_011173994.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_014628820.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_026477911.1|  5'-nucleotidase                                  66.2    4e-11   
ref|WP_026986392.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_036280841.1|  stationary phase survival protein SurE           66.2    4e-11   
ref|WP_012032567.1|  stationary phase survival protein SurE           66.6    4e-11   
ref|WP_007089629.1|  5'-nucleotidase                                  66.2    4e-11   
ref|WP_037992524.1|  stationary phase survival protein SurE           66.2    4e-11   
ref|WP_018053391.1|  hypothetical protein                             66.2    4e-11   
ref|WP_031582616.1|  5'-nucleotidase                                  66.2    4e-11   
ref|XP_002514125.1|  acid phosphatase, putative                       67.8    5e-11   
ref|WP_015933693.1|  stationary phase survival protein SurE           66.2    5e-11   
ref|WP_037562765.1|  stationary phase survival protein SurE           65.9    5e-11   
ref|WP_023436960.1|  stationary phase survival protein SurE           66.2    5e-11   
ref|WP_027187288.1|  stationary phase survival protein SurE           66.2    5e-11   
dbj|GAM11365.1|  5'-nucleotidase SurE                                 66.2    5e-11   
ref|WP_010236527.1|  stationary phase survival protein SurE           66.2    5e-11   
ref|WP_037581703.1|  stationary phase survival protein SurE           65.9    5e-11   
ref|WP_027983527.1|  hypothetical protein                             66.2    5e-11   
ref|WP_040343809.1|  stationary phase survival protein SurE           65.9    5e-11   
ref|WP_039648253.1|  stationary phase survival protein SurE           66.2    6e-11   
ref|WP_029775562.1|  hypothetical protein                             66.2    6e-11   
ref|WP_011384901.1|  5'-nucleotidase                                  66.2    6e-11   
ref|WP_025763301.1|  5'-nucleotidase                                  65.9    6e-11   
ref|WP_008908587.1|  stationary phase survival protein SurE           65.9    6e-11   
ref|WP_035116028.1|  5'-nucleotidase                                  65.9    7e-11   
ref|WP_031445453.1|  stationary phase survival protein SurE           65.9    7e-11   
ref|WP_035141226.1|  stationary phase survival protein SurE           65.9    7e-11   
ref|WP_035772061.1|  5'-nucleotidase                                  65.5    7e-11   
ref|WP_026653486.1|  hypothetical protein                             65.5    7e-11   
ref|WP_013164626.1|  stationary phase survival protein SurE           65.9    7e-11   
ref|WP_015756956.1|  stationary phase survival protein SurE           65.9    8e-11   
ref|WP_021619054.1|  5'/3'-nucleotidase SurE                          65.9    8e-11   
ref|WP_018589374.1|  hypothetical protein                             65.5    9e-11   
ref|WP_029649977.1|  stationary phase survival protein SurE           65.5    9e-11   
dbj|GAK58590.1|  5'-nucleotidase surE                                 65.5    9e-11   
ref|WP_018408170.1|  stationary phase survival protein SurE           65.5    9e-11   
ref|WP_031538993.1|  stationary phase survival protein SurE           65.5    9e-11   
ref|WP_010942170.1|  stationary phase survival protein SurE           65.5    9e-11   
ref|WP_022765896.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_027118977.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_021283167.1|  hypothetical protein                             65.1    1e-10   
gb|EOR22543.1|  5'(3')-nucleotidase/polyphosphatase                   65.5    1e-10   
ref|WP_013558094.1|  stationary phase survival protein SurE           65.5    1e-10   
ref|WP_033405904.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_003609817.1|  stationary phase survival protein SurE           65.5    1e-10   
ref|WP_014889554.1|  stationary phase survival protein SurE           65.5    1e-10   
ref|WP_038050555.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_010297999.1|  5'-nucleotidase                                  65.5    1e-10   
ref|WP_028307253.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_031452393.1|  nucleotidase                                     65.1    1e-10   
ref|WP_009168924.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_026663058.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_013279434.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_031585548.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_022797726.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_026520923.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_007163164.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_022767368.1|  5'-nucleotidase                                  65.1    1e-10   
ref|WP_029683882.1|  stationary phase survival protein SurE           65.1    1e-10   
dbj|GAL62375.1|  5-nucleotidase SurE                                  65.1    1e-10   
ref|WP_040200094.1|  stationary phase survival protein SurE           65.1    1e-10   
emb|CDZ81229.1|  5'-nucleotidase SurE                                 65.1    1e-10   
ref|WP_020403374.1|  hypothetical protein                             65.1    1e-10   
ref|WP_008637293.1|  stationary phase survival protein SurE           65.1    1e-10   
ref|WP_006919239.1|  5''/3''-nucleotidase SurE                        65.1    1e-10   
ref|WP_007290706.1|  stationary phase survival protein SurE           64.7    1e-10   
ref|WP_034959707.1|  stationary phase survival protein SurE           64.7    1e-10   
ref|WP_021430734.1|  5'/3'-nucleotidase SurE [                        64.7    1e-10   
ref|WP_020885648.1|  Survival protein SurE-like phosphatase/nucle...  64.7    1e-10   
ref|WP_035001037.1|  hypothetical protein                             64.7    1e-10   
ref|WP_034141943.1|  stationary phase survival protein SurE           65.1    1e-10   
gb|EMR07701.1|  5'/3'-nucleotidase SurE                               64.7    2e-10   
emb|CDO61215.1|  5-nucleotidase SurE                                  65.5    2e-10   
ref|WP_007221523.1|  survival protein                                 65.1    2e-10   
ref|WP_009181231.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_012002738.1|  MULTISPECIES: stationary phase survival prot...  64.7    2e-10   
ref|WP_026945029.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_024281849.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_024824530.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_027002251.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_008712698.1|  MULTISPECIES: 5'-nucleotidase                    64.7    2e-10   
ref|WP_005011588.1|  5'-nucleotidase surE                             64.7    2e-10   
ref|WP_029775354.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_005998577.1|  5'/3'-nucleotidase SurE [                        64.7    2e-10   
ref|WP_017750434.1|  hypothetical protein                             64.7    2e-10   
ref|WP_038463216.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_018662000.1|  5-nucleotidase SurE                              64.7    2e-10   
ref|WP_007059185.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_027308239.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_009107491.1|  stationary phase survival protein SurE           64.7    2e-10   
emb|CAJ73835.1|  similar to acid phosphatase SurE                     64.7    2e-10   
ref|WP_012336208.1|  MULTISPECIES: stationary phase survival prot...  64.3    2e-10   
ref|WP_014296210.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_029243502.1|  5'-nucleotidase                                  64.7    2e-10   
ref|WP_011413091.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_013705181.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_028527103.1|  stationary phase survival protein SurE           64.7    2e-10   
ref|WP_034924233.1|  hypothetical protein                             64.3    2e-10   
ref|WP_013778402.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_012545452.1|  MULTISPECIES: stationary phase survival prot...  64.3    2e-10   
ref|WP_038559585.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_013788006.1|  stationary phase survival protein SurE           64.3    2e-10   
gb|AHG90776.1|  Survival protein SurE-like phosphatase/nucleotidase   64.3    2e-10   
gb|AHF16627.1|  stationary phase survival protein SurE                64.3    2e-10   
ref|WP_025993495.1|  5'-nucleotidase                                  64.3    2e-10   
ref|WP_010163586.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_004886531.1|  stationary-phase survival protein SurE           64.3    2e-10   
ref|WP_015862609.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_038085459.1|  hypothetical protein                             64.3    2e-10   
ref|WP_010414840.1|  stationary phase survival protein SurE           64.3    2e-10   
ref|WP_039460146.1|  5'-nucleotidase                                  64.3    2e-10   
ref|WP_015824332.1|  stationary phase survival protein SurE           64.3    3e-10   
ref|WP_015050580.1|  stationary phase survival protein SurE           64.3    3e-10   
ref|WP_010216710.1|  stationary phase survival protein SurE           64.3    3e-10   
ref|WP_036990465.1|  hypothetical protein                             64.3    3e-10   
ref|WP_003605704.1|  stationary phase survival protein SurE           64.3    3e-10   
gb|KHK02498.1|  5-nucleotidase SurE                                   64.3    3e-10   
ref|WP_011341155.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_037999343.1|  5'-nucleotidase                                  64.3    3e-10   
ref|WP_025487399.1|  acid phosphatase                                 63.9    3e-10   
ref|WP_021633749.1|  5'/3'-nucleotidase SurE                          63.9    3e-10   
ref|WP_041041254.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_012174587.1|  5'-nucleotidase                                  63.9    3e-10   
ref|WP_018999441.1|  hypothetical protein                             63.9    3e-10   
ref|WP_006834517.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_016330343.1|  5'/3'-nucleotidase SurE                          63.9    3e-10   
ref|WP_027353631.1|  hypothetical protein                             63.9    3e-10   
ref|WP_013495510.1|  stationary phase survival protein SurE           64.3    3e-10   
gb|KIA77408.1|  5'-nucleotidase SurE                                  64.7    3e-10   
ref|WP_009610237.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_007673627.1|  stationary phase survival protein SurE           64.3    3e-10   
ref|WP_015413780.1|  5'-nucleotidase surE                             63.9    3e-10   
ref|WP_018460889.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_012448041.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_019014865.1|  hypothetical protein                             63.9    3e-10   
ref|WP_033191942.1|  stationary phase survival protein SurE           63.9    3e-10   
ref|WP_013842222.1|  stationary phase survival protein SurE           63.9    4e-10   
emb|CEA01581.1|  stationary phase survival protein SurE               63.9    4e-10   
ref|WP_035306713.1|  stationary phase survival protein SurE           63.9    4e-10   
ref|WP_012881998.1|  stationary phase survival protein SurE           63.9    4e-10   
ref|WP_023652275.1|  stationary-phase survival protein                63.9    4e-10   
ref|WP_035785243.1|  stationary phase survival protein SurE           63.5    4e-10   
ref|WP_013986664.1|  stationary-phase survival protein SurE           63.9    4e-10   
gb|AII57884.1|  stationary phase survival protein SurE                63.9    4e-10   
ref|WP_013297836.1|  stationary phase survival protein SurE           63.5    4e-10   
ref|WP_006425244.1|  stationary phase survival protein SurE           63.9    4e-10   
ref|WP_012385624.1|  stationary phase survival protein SurE           63.9    4e-10   
ref|WP_008537234.1|  5'/3'-nucleotidase SurE                          63.5    4e-10   
ref|WP_007562485.1|  stationary phase survival protein SurE           63.5    4e-10   
ref|WP_018084996.1|  hypothetical protein                             63.5    4e-10   
ref|WP_038151487.1|  stationary-phase survival protein SurE           63.5    4e-10   
ref|WP_028257258.1|  stationary-phase survival protein SurE           63.5    4e-10   
ref|WP_011174531.1|  5'-nucleotidase                                  63.5    4e-10   
ref|WP_015311576.1|  5'/3'-nucleotidase SurE                          63.5    4e-10   
ref|WP_034812881.1|  hypothetical protein [                           63.5    4e-10   
ref|WP_040680181.1|  stationary phase survival protein SurE           63.9    4e-10   
ref|WP_038055097.1|  5'-nucleotidase                                  63.5    4e-10   
ref|WP_029917817.1|  stationary phase survival protein SurE           63.5    4e-10   
ref|WP_018211559.1|  stationary phase survival protein SurE           63.5    4e-10   
ref|WP_038048621.1|  5'-nucleotidase                                  63.5    5e-10   
ref|WP_038041084.1|  5'-nucleotidase                                  63.5    5e-10   
ref|WP_037233811.1|  stationary phase survival protein SurE           63.5    5e-10   
ref|WP_014677610.1|  Multifunctional protein surE                     63.5    5e-10   
ref|WP_010599795.1|  stationary phase survival protein SurE           63.9    5e-10   
ref|WP_027625427.1|  stationary phase survival protein SurE           63.5    5e-10   
ref|WP_041076849.1|  stationary phase survival protein SurE           63.5    5e-10   
ref|WP_018110379.1|  5'-nucleotidase                                  63.2    5e-10   
ref|WP_013456770.1|  stationary phase survival protein SurE           63.5    5e-10   
ref|WP_003049056.1|  stationary phase survival protein SurE           63.5    5e-10   



>ref|XP_009617515.1| PREDICTED: uncharacterized protein LOC104109850 isoform X3 [Nicotiana 
tomentosiformis]
Length=249

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV VLVSTNRF+V VCAPDSE+SAVSHSITWRHA+ VK+V+I G
Sbjct  13   VMVTNDDGIDAPGLRALVNVLVSTNRFHVLVCAPDSEKSAVSHSITWRHALSVKQVDIRG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAFSV+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFSVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_009617514.1| PREDICTED: uncharacterized protein LOC104109850 isoform X2 [Nicotiana 
tomentosiformis]
Length=283

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV VLVSTNRF+V VCAPDSE+SAVSHSITWRHA+ VK+V+I G
Sbjct  13   VMVTNDDGIDAPGLRALVNVLVSTNRFHVLVCAPDSEKSAVSHSITWRHALSVKQVDIRG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAFSV+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFSVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_009790406.1| PREDICTED: uncharacterized protein LOC104237876 [Nicotiana sylvestris]
Length=309

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVSTNRF+V VCAPDSE+SAVSHSITWRHA+ VK+V+ISG
Sbjct  13   LMVTNDDGIDAPGLRALVNVLVSTNRFHVLVCAPDSEKSAVSHSITWRHALSVKQVDISG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAFSV+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFSVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_009617509.1| PREDICTED: uncharacterized protein LOC104109850 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617510.1| PREDICTED: uncharacterized protein LOC104109850 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617511.1| PREDICTED: uncharacterized protein LOC104109850 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617513.1| PREDICTED: uncharacterized protein LOC104109850 isoform X1 [Nicotiana 
tomentosiformis]
Length=309

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV VLVSTNRF+V VCAPDSE+SAVSHSITWRHA+ VK+V+I G
Sbjct  13   VMVTNDDGIDAPGLRALVNVLVSTNRFHVLVCAPDSEKSAVSHSITWRHALSVKQVDIRG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAFSV+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFSVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_010256021.1| PREDICTED: probable tubulin--tyrosine ligase PBY1 isoform X2 
[Nelumbo nucifera]
Length=308

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVSTN + V VCAPDSE+SAVSHSITWRHA+ V RVEI G
Sbjct  13   IMVTNDDGIDAPGLRALVQVLVSTNLYEVLVCAPDSEKSAVSHSITWRHALSVNRVEIEG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLGISKALFS++PDLVISGINMGSN
Sbjct  73   TTAYAVSGTPADCASLGISKALFSTIPDLVISGINMGSN  111



>ref|XP_010256020.1| PREDICTED: uncharacterized protein LOC104596523 isoform X1 [Nelumbo 
nucifera]
Length=337

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVSTN + V VCAPDSE+SAVSHSITWRHA+ V RVEI G
Sbjct  13   IMVTNDDGIDAPGLRALVQVLVSTNLYEVLVCAPDSEKSAVSHSITWRHALSVNRVEIEG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLGISKALFS++PDLVISGINMGSN
Sbjct  73   TTAYAVSGTPADCASLGISKALFSTIPDLVISGINMGSN  111



>gb|EPS61093.1| hypothetical protein M569_13707, partial [Genlisea aurea]
Length=273

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LVRVLVS++RF+V VCAPDSE SAVSHSITWRHA+  KRVEI+G
Sbjct  13   VLVTNDDGIDAPGLRSLVRVLVSSDRFHVLVCAPDSENSAVSHSITWRHAISAKRVEING  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGISKALF S+PDLV+SGINMGSN
Sbjct  73   ATAFAVSGTPADCTSLGISKALFPSIPDLVLSGINMGSN  111



>ref|XP_006360803.1| PREDICTED: uncharacterized protein LOC102581587 isoform X3 [Solanum 
tuberosum]
Length=254

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV +LVSTNRF+V VCAPDSE+SAVSHSITWR+A+ VK+V+ISG
Sbjct  13   VLVTNDDGIDAPGLRALVSLLVSTNRFHVLVCAPDSEKSAVSHSITWRNALSVKQVDISG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFAVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_006360804.1| PREDICTED: uncharacterized protein LOC102581587 isoform X4 [Solanum 
tuberosum]
Length=249

 Score =   133 bits (334),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV +LVSTNRF+V VCAPDSE+SAVSHSITWR+A+ VK+V+ISG
Sbjct  13   VLVTNDDGIDAPGLRALVSLLVSTNRFHVLVCAPDSEKSAVSHSITWRNALSVKQVDISG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFAVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>ref|XP_006360801.1| PREDICTED: uncharacterized protein LOC102581587 isoform X1 [Solanum 
tuberosum]
 ref|XP_006360802.1| PREDICTED: uncharacterized protein LOC102581587 isoform X2 [Solanum 
tuberosum]
Length=309

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV +LVSTNRF+V VCAPDSE+SAVSHSITWR+A+ VK+V+ISG
Sbjct  13   VLVTNDDGIDAPGLRALVSLLVSTNRFHVLVCAPDSEKSAVSHSITWRNALSVKQVDISG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGISKALF SVPDLVISG+NMG N
Sbjct  73   ATAFAVSGTPADCTSLGISKALFPSVPDLVISGVNMGDN  111



>emb|CDO99053.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVSTNRF+V VCAPDSE+SAVSHS+TWR+ V  K+VE+SG
Sbjct  15   VMVTNDDGIDAPGLRALVRVLVSTNRFHVLVCAPDSEKSAVSHSVTWRNPVSAKQVEVSG  74

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGIS+ALF S+PDLVISGINMGSN
Sbjct  75   ATAFAVSGTPADCTSLGISQALFPSIPDLVISGINMGSN  113



>ref|XP_007034747.1| Survival protein SurE-like phosphatase/nucleotidase [Theobroma 
cacao]
 gb|EOY05673.1| Survival protein SurE-like phosphatase/nucleotidase [Theobroma 
cacao]
Length=309

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVS+NRF V VCAPDSE+SAVSHSITWRH V VK+V+I G
Sbjct  14   VMVTNDDGIDAPGLRALVRVLVSSNRFRVLVCAPDSEKSAVSHSITWRHPVSVKQVDIDG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V+GTPADC SLGIS ALF SVPDLVISGINMGSN
Sbjct  74   ATAYAVSGTPADCTSLGISGALFPSVPDLVISGINMGSN  112



>ref|XP_004247359.1| PREDICTED: uncharacterized protein LOC101253828 isoform X2 [Solanum 
lycopersicum]
Length=309

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            STNRF+V VCAPDSE+SAVSHSITWR+A+ VK+V+ISGATAF+V+GTPADC SLGISKAL
Sbjct  35   STNRFHVLVCAPDSEKSAVSHSITWRNALSVKQVDISGATAFAVSGTPADCTSLGISKAL  94

Query  248  FSSVPDLVISGINMGSN  298
            F SVPDLVISG+NMG N
Sbjct  95   FPSVPDLVISGVNMGDN  111



>ref|XP_010326546.1| PREDICTED: uncharacterized protein LOC101253828 isoform X1 [Solanum 
lycopersicum]
Length=314

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            STNRF+V VCAPDSE+SAVSHSITWR+A+ VK+V+ISGATAF+V+GTPADC SLGISKAL
Sbjct  35   STNRFHVLVCAPDSEKSAVSHSITWRNALSVKQVDISGATAFAVSGTPADCTSLGISKAL  94

Query  248  FSSVPDLVISGINMGSN  298
            F SVPDLVISG+NMG N
Sbjct  95   FPSVPDLVISGVNMGDN  111



>ref|XP_008224320.1| PREDICTED: uncharacterized protein LOC103324062 [Prunus mume]
Length=309

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  GL  LV+VLVST R+NV VCAPD+EQSAVSH ITWRH +  K+V I G
Sbjct  14   VMVTNDDGIEGPGLLALVQVLVSTRRYNVLVCAPDTEQSAVSHCITWRHPIAAKQVHIDG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V+G+PADCASLGISK LF SVPDLVISGINMGSN
Sbjct  74   ATAYAVSGSPADCASLGISKTLFPSVPDLVISGINMGSN  112



>gb|EYU45650.1| hypothetical protein MIMGU_mgv1a010439mg [Erythranthe guttata]
Length=312

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV VLVS+NRF+V VCAPDSE+SAV HSITWR+A+  K+V+ISG
Sbjct  18   VMVTNDDGIDAPGLRALVHVLVSSNRFHVLVCAPDSEKSAVGHSITWRNAISAKKVDISG  77

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC SLGISKALF SVPDLVISGIN GSN
Sbjct  78   ATAFAVSGTPADCTSLGISKALFPSVPDLVISGINKGSN  116



>ref|XP_007222992.1| hypothetical protein PRUPE_ppa008995mg [Prunus persica]
 gb|EMJ24191.1| hypothetical protein PRUPE_ppa008995mg [Prunus persica]
Length=311

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  GL  LV+VLVST R+NV VCAP+SEQSAVSH ITWRH +  K+V I G
Sbjct  14   VMVTNDDGIEGPGLLALVQVLVSTRRYNVLVCAPESEQSAVSHCITWRHPIAAKQVHIDG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V+G+PADCASLGISK LF SVPDLVISGINMGSN
Sbjct  74   ATAYAVSGSPADCASLGISKTLFPSVPDLVISGINMGSN  112



>gb|KDP40167.1| hypothetical protein JCGZ_02165 [Jatropha curcas]
Length=309

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +M+TNDDG+DA GL+ LVRVLVST+RFNV VCAPDSE+SA SH ITWRH +  +RV I G
Sbjct  15   IMITNDDGIDAPGLQSLVRVLVSTHRFNVLVCAPDSEKSAASHCITWRHPISARRVNIEG  74

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC+SLGIS+ALF  +PDLVISGINMGSN
Sbjct  75   ATAFAVSGTPADCSSLGISEALFPLIPDLVISGINMGSN  113



>ref|XP_006387674.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 ref|XP_006387675.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 ref|XP_006387676.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 ref|XP_006387677.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 gb|ERP46588.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 gb|ERP46589.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 gb|ERP46590.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
 gb|ERP46591.1| hypothetical protein POPTR_0683s00200g [Populus trichocarpa]
Length=305

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVST RF V VCAPDSE+SA+SHSITWR  +  +RVEI G
Sbjct  7    IMVTNDDGIDAPGLRALVQVLVSTRRFQVLVCAPDSEKSAMSHSITWRDPIAARRVEIEG  66

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA+++AGTPADC SLGISK+LF  +PDLVISGINMGSN
Sbjct  67   ATAYAIAGTPADCTSLGISKSLFPLIPDLVISGINMGSN  105



>ref|XP_011021531.1| PREDICTED: uncharacterized protein LOC105123575 [Populus euphratica]
 ref|XP_011021532.1| PREDICTED: uncharacterized protein LOC105123575 [Populus euphratica]
Length=305

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVST RF V VCAPDSE+SA SHSITWR  +  +RVEI G
Sbjct  7    IMVTNDDGIDAPGLRALVQVLVSTRRFQVLVCAPDSEKSATSHSITWRDPIAARRVEIEG  66

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA+++AGTPADC SLGISK+LF  +PDLVISGINMGSN
Sbjct  67   ATAYAIAGTPADCTSLGISKSLFPLIPDLVISGINMGSN  105



>ref|XP_008340999.1| PREDICTED: uncharacterized protein LOC103403934 [Malus domestica]
Length=126

 Score =   122 bits (305),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  G+  LV+VLVST+R+NV VCAPDSE+SAVSH ITW H +  K+V I+G
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSTHRYNVLVCAPDSEKSAVSHCITWLHPIAAKKVHING  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            AT ++V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   ATVYAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  112



>ref|XP_010090909.1| 5'-nucleotidase surE [Morus notabilis]
 gb|EXB41281.1| 5'-nucleotidase surE [Morus notabilis]
Length=310

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVS  R+ V VCAPDSE+SAVSHSITWR+ + VK+ +I G
Sbjct  14   IMVTNDDGIDAPGLRALVQVLVSAGRYIVQVCAPDSEKSAVSHSITWRNPLAVKQADIPG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADCASLGISKALFSSVPDLVISGINMGSN
Sbjct  74   ATAFAVSGTPADCASLGISKALFSSVPDLVISGINMGSN  112



>ref|XP_002282293.1| PREDICTED: uncharacterized protein LOC100242666 [Vitis vinifera]
 emb|CBI26244.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   126 bits (317),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVSTN + V VCAPDSE+SAVSHSITW HA+ VKRVEI G
Sbjct  13   IMVTNDDGIDAPGLRALVQVLVSTNLYEVLVCAPDSEKSAVSHSITWIHALAVKRVEIEG  72

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V+GTPAD ASLGIS  LF S+PDLVISGINMGSN
Sbjct  73   ATAYAVSGTPADSASLGISTTLFPSIPDLVISGINMGSN  111



>ref|XP_010694161.1| PREDICTED: uncharacterized protein LOC104907010 [Beta vulgaris 
subsp. vulgaris]
Length=300

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN +N+ +CAPDSEQSAVSH ITWRH +  K V+I G
Sbjct  7    IMVTNDDGIDAPGLRSLVRVLVSTNLYNIRICAPDSEQSAVSHGITWRHPISAKNVDIEG  66

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V GTPADC+SLG+S ALF S+PDLV+SGINMGSN
Sbjct  67   ATAFAVTGTPADCSSLGVSDALFPSIPDLVLSGINMGSN  105



>ref|XP_011090721.1| PREDICTED: uncharacterized protein LOC105171345 [Sesamum indicum]
Length=309

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVS+NRFNV VCAPDSE+SAVSH ITWR+A+  K VEISG
Sbjct  14   VMVTNDDGIDAPGLRALVRVLVSSNRFNVLVCAPDSEKSAVSHCITWRNAIFAKPVEISG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+V+GTPADC +LGIS ALF S PDLVISGINMGSN
Sbjct  74   AIAFAVSGTPADCTALGISNALFPSKPDLVISGINMGSN  112



>gb|KCW60760.1| hypothetical protein EUGRSUZ_H03483, partial [Eucalyptus grandis]
Length=233

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GL+ LVRVLVS+ R+NV VCAPD+E+SAVSHSITWRH +  +RV + G
Sbjct  29   VMVTNDDGIDAAGLQSLVRVLVSSGRYNVQVCAPDAERSAVSHSITWRHPLVARRVNVEG  88

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+VAGTPADC SLGISKALF SV DLVISGINMGSN
Sbjct  89   AIAFAVAGTPADCTSLGISKALFPSVADLVISGINMGSN  127



>ref|XP_010024311.1| PREDICTED: uncharacterized protein LOC104414821 [Eucalyptus grandis]
 gb|KCW60763.1| hypothetical protein EUGRSUZ_H03485 [Eucalyptus grandis]
Length=302

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVS+ R+NV VCAPDSE+SAVSHSITW+H +  +RV+I G
Sbjct  14   VMVTNDDGIDAPGLRSLVRVLVSSGRYNVQVCAPDSEKSAVSHSITWQHPLAARRVDIEG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+VAGTPAD ASLGISKALF SV DLVISGINMGSN
Sbjct  74   ATAFAVAGTPADSASLGISKALFPSVADLVISGINMGSN  112



>ref|XP_010024305.1| PREDICTED: uncharacterized protein LOC104414818 [Eucalyptus grandis]
Length=280

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GL+ LVRVLVS+ R+NV VCAPD+E+SAVSHSITWRH +  +RV + G
Sbjct  9    VMVTNDDGIDAAGLQSLVRVLVSSGRYNVQVCAPDAERSAVSHSITWRHPLVARRVNVEG  68

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+VAGTPADC SLGISKALF SV DLVISGINMGSN
Sbjct  69   AIAFAVAGTPADCTSLGISKALFPSVADLVISGINMGSN  107



>ref|XP_006573884.1| PREDICTED: uncharacterized protein LOC100808698 isoform X2 [Glycine 
max]
Length=296

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTNDDG+DA GLR LV  LV+ N FNV VCAPDSE+SAVSHSITW H V VK+V+I G
Sbjct  9    ILVTNDDGIDAPGLRALVHSLVNANLFNVLVCAPDSEKSAVSHSITWLHPVAVKQVQIEG  68

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TAF+V+GTPADCASLGISKALF +VPDLV+SGIN GSN
Sbjct  69   TTAFAVSGTPADCASLGISKALFPTVPDLVVSGINKGSN  107



>ref|XP_003517577.1| PREDICTED: uncharacterized protein LOC100808698 isoform X1 [Glycine 
max]
 gb|KHN30472.1| 5'-nucleotidase surE [Glycine soja]
Length=303

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTNDDG+DA GLR LV  LV+ N FNV VCAPDSE+SAVSHSITW H V VK+V+I G
Sbjct  9    ILVTNDDGIDAPGLRALVHSLVNANLFNVLVCAPDSEKSAVSHSITWLHPVAVKQVQIEG  68

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TAF+V+GTPADCASLGISKALF +VPDLV+SGIN GSN
Sbjct  69   TTAFAVSGTPADCASLGISKALFPTVPDLVVSGINKGSN  107



>ref|XP_009782713.1| PREDICTED: uncharacterized protein LOC104231414 [Nicotiana sylvestris]
Length=308

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVS+N FNV VCAPDSE+S VSHS++WR A+ VK+VEISG
Sbjct  11   VMVTNDDGIDAPGLRSLVRVLVSSNLFNVLVCAPDSEKSGVSHSVSWRRALSVKKVEISG  70

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  S+G+SK LF SVPDLV+SGINMGSN
Sbjct  71   ATAFAVSGTPADSTSIGLSKTLFPSVPDLVVSGINMGSN  109



>gb|KDO74617.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
Length=213

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>ref|XP_003539322.1| PREDICTED: uncharacterized protein LOC100792340 isoform X1 [Glycine 
max]
 ref|XP_006590400.1| PREDICTED: uncharacterized protein LOC100792340 isoform X2 [Glycine 
max]
 ref|XP_006590401.1| PREDICTED: uncharacterized protein LOC100792340 isoform X3 [Glycine 
max]
 gb|KHN35182.1| 5'-nucleotidase surE [Glycine soja]
Length=303

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTNDDG+DA GLR LV  +V+ N FNV VCAPDSE+SAVSHSITW H V VK+V+I G
Sbjct  9    ILVTNDDGIDAPGLRALVHSIVNANLFNVLVCAPDSEKSAVSHSITWLHPVAVKQVQIEG  68

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TAF+V+GTPADCASLGISKALF +VPDLV+SGIN GSN
Sbjct  69   TTAFAVSGTPADCASLGISKALFPTVPDLVVSGINKGSN  107



>ref|XP_002517148.1| 5'-nucleotidase surE, putative [Ricinus communis]
 gb|EEF45311.1| 5'-nucleotidase surE, putative [Ricinus communis]
Length=306

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +M+TNDDG+DA GLR LVRVLV+TNRF + VCAPDSE+SAVSHSIT+RH +  +RV+I G
Sbjct  11   IMITNDDGIDAPGLRSLVRVLVATNRFRILVCAPDSEKSAVSHSITYRHPISARRVDIEG  70

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
              A++++GTPADCASLG+S ALF SVPDLVISGINMGSN
Sbjct  71   TLAYAISGTPADCASLGVSTALFPSVPDLVISGINMGSN  109



>ref|XP_009366944.1| PREDICTED: uncharacterized protein LOC103956639 [Pyrus x bretschneideri]
Length=264

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  G+  LV+VLVST+R+NV VCAPDSE+SAVSH ITW H +  K+V I+G
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSTHRYNVLVCAPDSEKSAVSHCITWLHPIAAKKVHING  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            AT F+V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   ATVFAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  112



>gb|KDO74616.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
Length=276

 Score =   123 bits (308),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>ref|XP_009366934.1| PREDICTED: uncharacterized protein LOC103956631 isoform X2 [Pyrus 
x bretschneideri]
Length=286

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  G+  LV+VLVST+R+NV VCAPDSE+SAVSH ITW H +  K+V I+G
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSTHRYNVLVCAPDSEKSAVSHCITWLHPIAAKKVHING  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            AT F+V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   ATVFAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  112



>ref|XP_009366935.1| PREDICTED: uncharacterized protein LOC103956631 isoform X3 [Pyrus 
x bretschneideri]
Length=282

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  G+  LV+VLVST+R+NV VCAPDSE+SAVSH ITW H +  K+V I+G
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSTHRYNVLVCAPDSEKSAVSHCITWLHPIAAKKVHING  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            AT F+V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   ATVFAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  112



>ref|XP_009619657.1| PREDICTED: uncharacterized protein LOC104111622 [Nicotiana tomentosiformis]
Length=326

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV VLVS+N FNV VCAPDSE+SAVSHS++W+ A+ VK+VEISG
Sbjct  31   VMVTNDDGIDAPGLRSLVHVLVSSNLFNVLVCAPDSEKSAVSHSVSWQRALSVKKVEISG  90

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  S+G+SK LF SVPDLV+SGINMGSN
Sbjct  91   ATAFAVSGTPADSTSIGLSKTLFPSVPDLVVSGINMGSN  129



>ref|XP_006378397.1| hypothetical protein POPTR_0010s09840g [Populus trichocarpa]
 gb|ERP56194.1| hypothetical protein POPTR_0010s09840g [Populus trichocarpa]
Length=285

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV+VLVST RF V VCAPDSE+SA+SHSI W   +  +RVEI G
Sbjct  7    IMVTNDDGIDAPGLRALVQVLVSTRRFQVLVCAPDSEKSAMSHSIKWPDPIAARRVEIEG  66

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA+++AGTPADC SLGISK+LF  +PDLVISGINMGSN
Sbjct  67   ATAYAIAGTPADCTSLGISKSLFPKIPDLVISGINMGSN  105



>ref|XP_006419919.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
 ref|XP_006419920.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
 ref|XP_006419921.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
 gb|ESR33159.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
 gb|ESR33160.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
 gb|ESR33161.1| hypothetical protein CICLE_v10005476mg [Citrus clementina]
Length=312

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>ref|XP_006489377.1| PREDICTED: uncharacterized protein LOC102626546 isoform X1 [Citrus 
sinensis]
Length=312

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR +VRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSVVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>gb|KDO74613.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
 gb|KDO74614.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
 gb|KDO74615.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
Length=312

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>ref|XP_009366930.1| PREDICTED: uncharacterized protein LOC103956631 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009366931.1| PREDICTED: uncharacterized protein LOC103956631 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009366933.1| PREDICTED: uncharacterized protein LOC103956631 isoform X1 [Pyrus 
x bretschneideri]
Length=306

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  G+  LV+VLVST+R+NV VCAPDSE+SAVSH ITW H +  K+V I+G
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSTHRYNVLVCAPDSEKSAVSHCITWLHPIAAKKVHING  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            AT F+V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   ATVFAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  112



>gb|KDO74612.1| hypothetical protein CISIN_1g021451mg [Citrus sinensis]
Length=307

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTNR+ V VCAPDSE+SAVSHSITWRH +  +  +  G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNRYTVQVCAPDSEKSAVSHSITWRHPISARPADFDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADCASLG+S+ALF SVPDLVISGINMGSN
Sbjct  77   VTAYAVSGTPADCASLGVSQALFPSVPDLVISGINMGSN  115



>ref|XP_004162274.1| PREDICTED: 5'-nucleotidase SurE-like [Cucumis sativus]
Length=307

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVST  +NV VCAPDSE+SAVS SITWRH V VKRV I G
Sbjct  14   IMVTNDDGIDAPGLRSLVRVLVSTQLYNVQVCAPDSEKSAVSQSITWRHPVSVKRVAIEG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             T+++V+GTPADC+SLG+SKALF +VPD+V+SGINMGSN
Sbjct  74   TTSYAVSGTPADCSSLGVSKALFPTVPDMVVSGINMGSN  112



>ref|XP_004134138.1| PREDICTED: 5'-nucleotidase SurE-like [Cucumis sativus]
 gb|KGN56987.1| hypothetical protein Csa_3G147210 [Cucumis sativus]
Length=307

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVST  +NV VCAPDSE+SAVS SITWRH V VKRV I G
Sbjct  14   IMVTNDDGIDAPGLRSLVRVLVSTQLYNVQVCAPDSEKSAVSQSITWRHPVSVKRVAIEG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             T+++V+GTPADC+SLG+SKALF +VPD+V+SGINMGSN
Sbjct  74   TTSYAVSGTPADCSSLGVSKALFPTVPDMVVSGINMGSN  112



>ref|XP_004299124.1| PREDICTED: 5'-nucleotidase SurE-like [Fragaria vesca subsp. vesca]
Length=306

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  GL  LV VLVSTN +NV VCAPDSE SAVSH ITWR  +  K V+I+G
Sbjct  12   VMVTNDDGIEGPGLLSLVHVLVSTNLYNVLVCAPDSENSAVSHCITWRRPIAAKIVDIAG  71

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADCASLG+S+ALF SVPDLVISGIN GSN
Sbjct  72   ATAFAVSGTPADCASLGVSEALFPSVPDLVISGINKGSN  110



>ref|XP_010035228.1| PREDICTED: uncharacterized protein LOC104424482 [Eucalyptus grandis]
 ref|XP_010035232.1| PREDICTED: uncharacterized protein LOC104424482 [Eucalyptus grandis]
 ref|XP_010035237.1| PREDICTED: uncharacterized protein LOC104424482 [Eucalyptus grandis]
Length=310

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+ + + V VCAPDSE+SAVSHSITWRH V VKRV+I G
Sbjct  15   VLVTNDDGIDAPGLRALVGALVAADGYRVRVCAPDSEKSAVSHSITWRHPVAVKRVDIDG  74

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+V+GTPADC SLGIS A+FSSVPDLV+SGIN GSN
Sbjct  75   AEAFAVSGTPADCTSLGISNAIFSSVPDLVLSGINKGSN  113



>ref|XP_006356674.1| PREDICTED: uncharacterized protein LOC102600953 [Solanum tuberosum]
Length=300

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VM+TNDDG+DA GLR LVRVLVS+N FNV VCAPDSE+SAVSH ++W+H + VK+V+ISG
Sbjct  11   VMITNDDGIDAPGLRSLVRVLVSSNLFNVLVCAPDSEKSAVSHCVSWQHPLSVKKVDISG  70

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC S+GISK LF  VPDLV+SGIN GSN
Sbjct  71   ATAFAVSGTPADCTSIGISKVLFPFVPDLVVSGINKGSN  109



>gb|KCW84224.1| hypothetical protein EUGRSUZ_B01087 [Eucalyptus grandis]
Length=341

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+ + + V VCAPDSE+SAVSHSITWRH V VKRV+I G
Sbjct  52   VLVTNDDGIDAPGLRALVGALVAADGYRVRVCAPDSEKSAVSHSITWRHPVAVKRVDIDG  111

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+V+GTPADC SLGIS A+FSSVPDLV+SGIN GSN
Sbjct  112  AEAFAVSGTPADCTSLGISNAIFSSVPDLVLSGINKGSN  150



>gb|KCW84225.1| hypothetical protein EUGRSUZ_B01087 [Eucalyptus grandis]
Length=347

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+ + + V VCAPDSE+SAVSHSITWRH V VKRV+I G
Sbjct  52   VLVTNDDGIDAPGLRALVGALVAADGYRVRVCAPDSEKSAVSHSITWRHPVAVKRVDIDG  111

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A AF+V+GTPADC SLGIS A+FSSVPDLV+SGIN GSN
Sbjct  112  AEAFAVSGTPADCTSLGISNAIFSSVPDLVLSGINKGSN  150



>ref|XP_009344093.1| PREDICTED: uncharacterized protein LOC103935984 [Pyrus x bretschneideri]
 ref|XP_009344094.1| PREDICTED: uncharacterized protein LOC103935984 [Pyrus x bretschneideri]
Length=306

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++  GL  LV VLVST+RFNV VCAPDSE+SAVSH ITW H +  K+V I G
Sbjct  14   VMVTNDDGIEGPGLLALVHVLVSTHRFNVLVCAPDSEKSAVSHCITWLHPIAAKKVHIDG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V+G+PADCASLG+SK LF ++ DLVISGIN GSN
Sbjct  74   ATAYAVSGSPADCASLGVSKTLFRTIRDLVISGINKGSN  112



>ref|XP_007157136.1| hypothetical protein PHAVU_002G045800g [Phaseolus vulgaris]
 gb|ESW29130.1| hypothetical protein PHAVU_002G045800g [Phaseolus vulgaris]
Length=300

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
            N FN+ VCAPDSE+SAVSHSITW H +  K+V+I G TAF+V+GTPADCASLG+SKALF 
Sbjct  33   NLFNLQVCAPDSEKSAVSHSITWLHPIAAKQVKIDGTTAFAVSGTPADCASLGVSKALFP  92

Query  254  SVPDLVISGINMGSN  298
            +VPDLV+SGIN GSN
Sbjct  93   TVPDLVVSGINKGSN  107



>ref|XP_008438680.1| PREDICTED: uncharacterized protein LOC103483713 [Cucumis melo]
 ref|XP_008438681.1| PREDICTED: uncharacterized protein LOC103483713 [Cucumis melo]
Length=307

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVS+  +NV VCAPDSE+SAVS SITW H V VKRV I G
Sbjct  14   IMVTNDDGIDAPGLRSLVRVLVSSQLYNVRVCAPDSEKSAVSQSITWLHPVSVKRVAIEG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             T+++V+GTPADC+SLG+SKALF +VPD+V+SGINMGSN
Sbjct  74   TTSYAVSGTPADCSSLGVSKALFPTVPDMVVSGINMGSN  112



>ref|XP_003592399.1| 5'-nucleotidase surE [Medicago truncatula]
 gb|AES62650.1| survival protein SurE-like phosphatase/nucleotidase [Medicago 
truncatula]
Length=306

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +M+TNDDG+DA GLR LV+ L+ TN +N+ +CAPDSE+SAVSHSITW H +  K+V I G
Sbjct  11   IMITNDDGIDAPGLRALVKALLDTNLYNLQICAPDSEKSAVSHSITWLHPIAAKKVHIDG  70

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADC SLG+SKALF +V DLVISGINMG+N
Sbjct  71   TTAYAVSGTPADCTSLGVSKALFPTVADLVISGINMGNN  109



>ref|XP_010090910.1| 5'-nucleotidase surE [Morus notabilis]
 gb|EXB41282.1| 5'-nucleotidase surE [Morus notabilis]
Length=560

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG++A GLR LV  LVST+ + V VCAPDS +SAVSHSIT+RH + VK+VEI G
Sbjct  281  IMVTNDDGINAPGLRALVHALVSTDLYVVQVCAPDSNKSAVSHSITYRHPLVVKQVEIQG  340

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADCASLG+SKALF S+PDLV+SGIN GSN
Sbjct  341  ATAFAVSGTPADCASLGVSKALFPSIPDLVVSGINEGSN  379


 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVST+ + V VCAPDSEQSAVSH  T+RH + VK+VEI G
Sbjct  14   IMVTNDDGIDAPGLRALVHVLVSTDLYVVRVCAPDSEQSAVSHHSTYRHPISVKQVEIQG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADCASLG+S+ LF SVPDLVISGIN G+N
Sbjct  74   ATAFAVSGTPADCASLGVSEVLFPSVPDLVISGINQGNN  112



>gb|AFK47113.1| unknown [Medicago truncatula]
Length=200

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATA-FSVAGTPADCASLGISKA  244
            +TN FN+FVCAPDSE+SAVSHSITW H +  K+V I G  A FSV+GTPADCASLGISK+
Sbjct  33   NTNLFNIFVCAPDSEKSAVSHSITWLHPISAKQVHIHGTIASFSVSGTPADCASLGISKS  92

Query  245  LFSSVPDLVISGINMGSN  298
            LF SVP LV+SGIN GSN
Sbjct  93   LFPSVPHLVVSGINRGSN  110



>ref|XP_004241053.1| PREDICTED: uncharacterized protein LOC101261826 [Solanum lycopersicum]
Length=301

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LVRVLVS+N FNV VCAPDSE+SAVSH ++W+H + VK+V+ISG
Sbjct  12   VMVTNDDGIDAPGLRSLVRVLVSSNLFNVLVCAPDSEKSAVSHCVSWQHPLSVKKVDISG  71

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  S+G+SK LF  VPDLV+SGIN GSN
Sbjct  72   ATAFAVSGTPADSTSIGLSKVLFPFVPDLVVSGINKGSN  110



>ref|XP_004496738.1| PREDICTED: 5'-nucleotidase SurE-like [Cicer arietinum]
Length=304

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +M+TNDDG+DA GLR LV VL++TN +++ VCAPD+E+SAVSHSITW H +  K+V I G
Sbjct  9    IMITNDDGIDAPGLRALVNVLLATNLYDLQVCAPDTEKSAVSHSITWLHPIAAKKVHIDG  68

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
             TA++V+GTPADC SLGISKALF++V DLV+SGINMG+N
Sbjct  69   TTAYAVSGTPADCTSLGISKALFATVADLVVSGINMGNN  107



>ref|XP_006284159.1| hypothetical protein CARUB_v10005292mg [Capsella rubella]
 gb|EOA17057.1| hypothetical protein CARUB_v10005292mg [Capsella rubella]
Length=313

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVSTN ++V VCAPDSE+SAVSHSI W   +  KRVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVHVLVSTNLYDVRVCAPDSEKSAVSHSIIWNRPLTAKRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   ATAYAVDGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>ref|NP_567449.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
 gb|AAM65266.1| unknown [Arabidopsis thaliana]
 gb|AAO00861.1| expressed protein [Arabidopsis thaliana]
 gb|AAP42727.1| At4g14930 [Arabidopsis thaliana]
 gb|AEE83524.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
Length=315

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  KRVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAKRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA+SV GTPADC  LG+S+ALF S PDLV+SGIN+GSN
Sbjct  76   ATAYSVDGTPADCTGLGLSEALFPSRPDLVLSGINVGSN  114



>ref|XP_007034746.1| Survival protein SurE-like phosphatase/nucleotidase, putative 
isoform 2 [Theobroma cacao]
 gb|EOY05672.1| Survival protein SurE-like phosphatase/nucleotidase, putative 
isoform 2 [Theobroma cacao]
Length=317

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +++TNDDG++A GL+ LV VLVST++FN+ VCAP  E SAV HSITWR  + VK+V++ G
Sbjct  16   ILITNDDGIEAPGLKALVSVLVSTHQFNLLVCAPQREMSAVGHSITWRRPLSVKQVDMHG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF V+GTPADCASLG+S  LF SVPDLVISGIN GSN
Sbjct  76   ATAFVVSGTPADCASLGVSSVLFPSVPDLVISGINQGSN  114



>ref|XP_010934984.1| PREDICTED: uncharacterized protein LOC105054982 isoform X2 [Elaeis 
guineensis]
Length=285

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +T+ + V VCAP S+QS VSHSITWRHA+  KRVEI GATAF+V+GTPADCASLGIS  L
Sbjct  35   ATDCYRVLVCAPASDQSGVSHSITWRHALSAKRVEIEGATAFAVSGTPADCASLGISGKL  94

Query  248  FSSV-PDLVISGINMGSN  298
            F  V PDLVISGIN+G N
Sbjct  95   FDGVIPDLVISGINIGCN  112



>ref|XP_007034745.1| Survival protein SurE-like phosphatase/nucleotidase, putative 
isoform 1 [Theobroma cacao]
 gb|EOY05671.1| Survival protein SurE-like phosphatase/nucleotidase, putative 
isoform 1 [Theobroma cacao]
Length=316

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +++TNDDG++A GL+ LV VLVST++FN+ VCAP  E SAV HSITWR  + VK+V++ G
Sbjct  16   ILITNDDGIEAPGLKALVSVLVSTHQFNLLVCAPQREMSAVGHSITWRRPLSVKQVDMHG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF V+GTPADCASLG+S  LF SVPDLVISGIN GSN
Sbjct  76   ATAFVVSGTPADCASLGVSSVLFPSVPDLVISGINQGSN  114



>emb|CDY29782.1| BnaA01g18840D, partial [Brassica napus]
Length=201

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  +RVEI G
Sbjct  16   IMVTNDDGIDAHGLRALVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAQRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AEAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>ref|XP_010934966.1| PREDICTED: uncharacterized protein LOC105054982 isoform X1 [Elaeis 
guineensis]
 ref|XP_010934976.1| PREDICTED: uncharacterized protein LOC105054982 isoform X1 [Elaeis 
guineensis]
Length=311

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +T+ + V VCAP S+QS VSHSITWRHA+  KRVEI GATAF+V+GTPADCASLGIS  L
Sbjct  35   ATDCYRVLVCAPASDQSGVSHSITWRHALSAKRVEIEGATAFAVSGTPADCASLGISGKL  94

Query  248  FSSV-PDLVISGINMGSN  298
            F  V PDLVISGIN+G N
Sbjct  95   FDGVIPDLVISGINIGCN  112



>ref|XP_010449971.1| PREDICTED: uncharacterized protein LOC104732139 [Camelina sativa]
Length=313

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVSTN ++V VCAPDSE+SAVSHSI W   +  KRVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVSVLVSTNLYDVRVCAPDSEKSAVSHSIIWNRPLTAKRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V GTPADC  LG+S+ALF S PDLV+SGIN+GSN
Sbjct  76   ATAYAVDGTPADCTGLGLSEALFPSRPDLVLSGINVGSN  114



>gb|KEH27352.1| survival protein SurE-like phosphatase/nucleotidase [Medicago 
truncatula]
Length=273

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATA-FSVAGTPADCASLGISKA  244
            +TN FN+FVCAPDSE+SAVSHSITW H +  K+V I G  A FSV+GTPADC SLGISK+
Sbjct  33   NTNLFNIFVCAPDSEKSAVSHSITWLHPISAKQVHIHGTIASFSVSGTPADCTSLGISKS  92

Query  245  LFSSVPDLVISGINMGSN  298
            LF SVP LV+SGIN GSN
Sbjct  93   LFPSVPHLVVSGINRGSN  110



>ref|XP_008352620.1| PREDICTED: uncharacterized protein LOC103416137 [Malus domestica]
Length=307

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPD-SEQSAVSHSITWRHAVPVKRVEIS  178
            VMVTNDDG++  G+  LV+VLVS  R+NV VCAPD +E+SAVSH ITW H +  K+V I+
Sbjct  14   VMVTNDDGIEGPGILALVQVLVSXXRYNVLVCAPDRTEKSAVSHCITWLHPIAAKKVHIN  73

Query  179  GATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            GAT ++V+G+PADCASLG+SK LF S+PDLVISGIN GSN
Sbjct  74   GATVYAVSGSPADCASLGVSKTLFPSIPDLVISGINQGSN  113



>ref|XP_003610719.1| 5'-nucleotidase surE [Medicago truncatula]
 gb|AES93677.1| survival protein SurE-like phosphatase/nucleotidase [Medicago 
truncatula]
Length=307

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATA-FSVAGTPADCASLGISKA  244
            +TN FN+FVCAPDSE+SAVSHSITW H +  K+V I G  A FSV+GTPADC SLGISK+
Sbjct  33   NTNLFNIFVCAPDSEKSAVSHSITWLHPISAKQVHIHGTIASFSVSGTPADCTSLGISKS  92

Query  245  LFSSVPDLVISGINMGSN  298
            LF SVP LV+SGIN GSN
Sbjct  93   LFPSVPHLVVSGINRGSN  110



>ref|XP_009147996.1| PREDICTED: uncharacterized protein LOC103871492 [Brassica rapa]
Length=311

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  +RVEI G
Sbjct  16   IMVTNDDGIDAHGLRALVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAQRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AEAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>ref|XP_006414620.1| hypothetical protein EUTSA_v10025783mg [Eutrema salsugineum]
 gb|ESQ56073.1| hypothetical protein EUTSA_v10025783mg [Eutrema salsugineum]
Length=311

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  +RVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAQRVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AVAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>gb|KFK43729.1| hypothetical protein AALP_AA1G164900 [Arabis alpina]
Length=310

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  KR+EI G
Sbjct  16   IMVTNDDGIDAHGLRSLVRVLVSTNLYDVLVCAPDSEKSAVSHSIIWSRPLTAKRIEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S ALF ++PDLV+SGIN+GSN
Sbjct  76   AIAYAVSGTPADCTGLGLSGALFPTLPDLVLSGINVGSN  114



>ref|XP_010440373.1| PREDICTED: uncharacterized protein LOC104723681 [Camelina sativa]
Length=313

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVSTN ++V VCAPDSE+SAVSHSI W   +  KRV+I G
Sbjct  16   IMVTNDDGIDAPGLRSLVSVLVSTNLYDVRVCAPDSEKSAVSHSIIWNRPLTAKRVDIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V GTPADC  LG+S+ALF S PDLV+SGIN+GSN
Sbjct  76   ATAYAVDGTPADCTGLGLSEALFPSRPDLVLSGINVGSN  114



>ref|XP_002870272.1| hypothetical protein ARALYDRAFT_493398 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46531.1| hypothetical protein ARALYDRAFT_493398 [Arabidopsis lyrata subsp. 
lyrata]
Length=316

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +  KRV+I G
Sbjct  17   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAKRVDIDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V GTPADC  LG+S+ALF S PDLV+SGIN+GSN
Sbjct  77   ATAYAVDGTPADCTGLGLSEALFPSRPDLVLSGINVGSN  115



>ref|XP_010532537.1| PREDICTED: uncharacterized protein LOC104808540 [Tarenaya hassleriana]
Length=310

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTNDDG+DA GLR LVRVLVSTN + V VCAPDSE+SAVSHSITW   V  K+VEI G
Sbjct  16   ILVTNDDGIDAPGLRSLVRVLVSTNLYTVRVCAPDSEKSAVSHSITWAKPVSAKQVEIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPADC  LG+S+ LF S PDLV+SGIN GSN
Sbjct  76   ATAFAVSGTPADCTGLGLSELLFPSPPDLVLSGINKGSN  114



>emb|CDY22722.1| BnaA08g05520D [Brassica napus]
Length=307

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +   RVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAHRVEIEG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AEAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>ref|XP_009107807.1| PREDICTED: uncharacterized protein LOC103833477 [Brassica rapa]
 ref|XP_009107808.1| PREDICTED: uncharacterized protein LOC103833477 [Brassica rapa]
Length=307

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +   RVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAHRVEIEG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AEAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>emb|CDY09040.1| BnaC08g09940D [Brassica napus]
Length=307

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDSE+SAVSHSI W   +   RVEI G
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSEKSAVSHSIIWSRPLTAHRVEIEG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            A A++V+GTPADC  LG+S+ALF S+PDLV+SGIN+GSN
Sbjct  76   AEAYAVSGTPADCTGLGLSEALFPSLPDLVLSGINVGSN  114



>ref|XP_009412474.1| PREDICTED: uncharacterized protein LOC103993956 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412475.1| PREDICTED: uncharacterized protein LOC103993956 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412476.1| PREDICTED: uncharacterized protein LOC103993956 [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV +LV+ +R+ V VCAPDS+QS V H I WR  +  KRVEI G
Sbjct  13   LMVTNDDGIDAPGLRFLVDLLVAADRYRVLVCAPDSDQSGVGHGIAWRRPLSAKRVEIMG  72

Query  182  ATAFSVAGTPADCASLGISKALF-SSVPDLVISGINMGSN  298
            ATAF+V+GTPADCASLGIS  LF  ++PDLVISGIN+GSN
Sbjct  73   ATAFAVSGTPADCASLGISGKLFVGTIPDLVISGINIGSN  112



>ref|XP_010435047.1| PREDICTED: uncharacterized protein LOC104718920 [Camelina sativa]
Length=313

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +MVTNDDG+DA GLR LV VLVSTN ++V VCAPDSE+SAVSHSI W   +  KRV+I G
Sbjct  16   IMVTNDDGIDAPGLRSLVSVLVSTNLYDVRVCAPDSEKSAVSHSIIWNRPLTAKRVDIDG  75

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATA++V GTPADC  LG+S+ LF S PDLV+SGIN+GSN
Sbjct  76   ATAYAVDGTPADCTGLGLSEVLFPSRPDLVLSGINVGSN  114



>tpg|DAA59951.1| TPA: hypothetical protein ZEAMMB73_153792 [Zea mays]
Length=131

 Score =   107 bits (266),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +  R+ V VCAPD+++S VSH ITWR A+  KRV+I GATAF V+GTPADCASLGIS  L
Sbjct  49   AAGRYRVLVCAPDTDKSGVSHCITWRPALRCKRVDIIGATAFGVSGTPADCASLGISGKL  108

Query  248  FSS-VPDLVISGINMGSN  298
            F   VPDLV+SGIN+G+N
Sbjct  109  FDGLVPDLVLSGINIGNN  126



>ref|XP_003557407.1| PREDICTED: probable tubulin--tyrosine ligase PBY1 [Brachypodium 
distachyon]
Length=298

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV  LV+  RF V VCAPD+++S VSH ITWR A+  KRV ISG
Sbjct  10   VMVTNDDGIDAPGLRFLVDQLVAEGRFRVLVCAPDTDRSGVSHCITWRPALCCKRVNISG  69

Query  182  ATAFSVAGTPADCASLGISKALFSS-VPDLVISGINMGSN  298
            ATAF V+GTPADCASLGIS  LF   VPDLV+SGIN+G+N
Sbjct  70   ATAFGVSGTPADCASLGISGKLFDGLVPDLVLSGINIGNN  109



>ref|XP_009420646.1| PREDICTED: uncharacterized protein LOC104000351 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            + +R+ V VCAPDS++S V HSITW  A+  KR EI GATAF+V+GTPADCASLGIS  L
Sbjct  35   AADRYRVLVCAPDSDKSGVGHSITWHRALSAKRAEIMGATAFAVSGTPADCASLGISGKL  94

Query  248  FSSV-PDLVISGINMGSN  298
            F  V PDLVISGIN+GSN
Sbjct  95   FDGVIPDLVISGINIGSN  112



>ref|XP_004955782.1| PREDICTED: acid phosphatase-like isoform X2 [Setaria italica]
Length=304

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +  R+ V VCAPD+++S VSH ITWR A+  KRV+ISGATAF V+GTPADCASLGIS  L
Sbjct  38   AARRYRVLVCAPDTDKSGVSHCITWRPALRCKRVDISGATAFGVSGTPADCASLGISGKL  97

Query  248  FSS-VPDLVISGINMGSN  298
            F   VPDLV+SGIN+G+N
Sbjct  98   FDGVVPDLVLSGINIGNN  115



>ref|XP_006658386.1| PREDICTED: uncharacterized protein LOC102721291 [Oryza brachyantha]
Length=318

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+  RF V VCAPD+++S VSHSITWR A+  KRV+I G
Sbjct  22   VLVTNDDGIDAPGLRFLVDQLVAARRFRVLVCAPDTDRSGVSHSITWRPALRCKRVDIDG  81

Query  182  ATAFSVAGTPADCASLGISKALFSS-VPDLVISGINMGSN  298
            ATAF+ +GTPADCASLGIS  LF+  VPDL ISGIN+G+N
Sbjct  82   ATAFAASGTPADCASLGISGKLFNGLVPDLAISGINVGNN  121



>ref|XP_008805747.1| PREDICTED: uncharacterized protein LOC103718615 [Phoenix dactylifera]
 ref|XP_008805748.1| PREDICTED: uncharacterized protein LOC103718615 [Phoenix dactylifera]
Length=311

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +T+R+ V VCAP S+QS VSHS+TWRH +  KRVEI GA AF+V+GTPAD ASLGIS  L
Sbjct  35   ATDRYRVLVCAPASDQSGVSHSVTWRHPLSAKRVEIEGAAAFAVSGTPADSASLGISGKL  94

Query  248  FSS-VPDLVISGINMGSN  298
            F   +PDLVISGIN+G N
Sbjct  95   FDGIIPDLVISGINIGCN  112



>ref|XP_002461661.1| hypothetical protein SORBIDRAFT_02g006090 [Sorghum bicolor]
 gb|EER98182.1| hypothetical protein SORBIDRAFT_02g006090 [Sorghum bicolor]
Length=305

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +  R+ V VCAPD+++S VSHSITWR A+  KRV+I+GATAF V+G+PADCASLGIS  L
Sbjct  40   AAGRYRVLVCAPDTDKSGVSHSITWRAALRCKRVDITGATAFGVSGSPADCASLGISGKL  99

Query  248  FSS-VPDLVISGINMGSN  298
            F   VPDLV+SGIN+G+N
Sbjct  100  FDGLVPDLVLSGINIGNN  117



>ref|XP_004955781.1| PREDICTED: acid phosphatase-like isoform X1 [Setaria italica]
Length=321

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            +  R+ V VCAPD+++S VSH ITWR A+  KRV+ISGATAF V+GTPADCASLGIS  L
Sbjct  38   AARRYRVLVCAPDTDKSGVSHCITWRPALRCKRVDISGATAFGVSGTPADCASLGISGKL  97

Query  248  FSS-VPDLVISGINMGSN  298
            F   VPDLV+SGIN+G+N
Sbjct  98   FDGVVPDLVLSGINIGNN  115



>dbj|BAG86778.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+  R+ V VCAPD+++S VSHSITWR A+  KRV+I G
Sbjct  17   VLVTNDDGIDAPGLRFLVGQLVAARRYRVLVCAPDTDRSGVSHSITWRPALRCKRVDIDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSS-VPDLVISGINMGSN  298
            ATAF+ +GTPADCASLGIS  LF   VPDLV+SGIN+G+N
Sbjct  77   ATAFAASGTPADCASLGISGKLFDGLVPDLVVSGINVGNN  116



>ref|NP_001059144.1| Os07g0204500 [Oryza sativa Japonica Group]
 dbj|BAC79797.1| putative stationary phase survival protein SurE [Oryza sativa 
Japonica Group]
 dbj|BAF21058.1| Os07g0204500 [Oryza sativa Japonica Group]
Length=305

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTNDDG+DA GLR LV  LV+  R+ V VCAPD+++S VSHSITWR A+  KRV+I G
Sbjct  17   VLVTNDDGIDAPGLRFLVGQLVAARRYRVLVCAPDTDRSGVSHSITWRPALRCKRVDIDG  76

Query  182  ATAFSVAGTPADCASLGISKALFSS-VPDLVISGINMGSN  298
            ATAF+ +GTPADCASLGIS  LF   VPDL ISGIN+G+N
Sbjct  77   ATAFAASGTPADCASLGISGKLFDGLVPDLAISGINVGNN  116



>ref|XP_006356672.1| PREDICTED: acid phosphatase-like isoform X3 [Solanum tuberosum]
Length=292

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV  LVSTN F+V V APDSE+SA SH ++W+  V VK+V++ G
Sbjct  14   VMVTNDDGIDAPGLRALVAALVSTNLFHVLVFAPDSERSAASHCVSWQRVVTVKKVDVPG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  SLGISK +F S+PDLV+SGIN+G N
Sbjct  74   ATAFAVSGTPADSTSLGISKKIFPSIPDLVVSGINLGCN  112



>ref|XP_006356670.1| PREDICTED: acid phosphatase-like isoform X1 [Solanum tuberosum]
 ref|XP_006356671.1| PREDICTED: acid phosphatase-like isoform X2 [Solanum tuberosum]
Length=316

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV  LVSTN F+V V APDSE+SA SH ++W+  V VK+V++ G
Sbjct  14   VMVTNDDGIDAPGLRALVAALVSTNLFHVLVFAPDSERSAASHCVSWQRVVTVKKVDVPG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  SLGISK +F S+PDLV+SGIN+G N
Sbjct  74   ATAFAVSGTPADSTSLGISKKIFPSIPDLVVSGINLGCN  112



>dbj|BAJ87892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG+DA GLR LV  LV+  R+ V VCAPD+++S VSH ITWR A+  K V I+G
Sbjct  12   VMVTNDDGIDAQGLRFLVDQLVAQGRYRVLVCAPDTDRSGVSHCITWRSALRCKSVHING  71

Query  182  ATAFSVAGTPADCASLGISKALFSS-VPDLVISGINMGSN  298
            ATAF V+GTPADCASLGIS  LF   VPDLV+SGIN+G+N
Sbjct  72   ATAFGVSGTPADCASLGISGKLFDGLVPDLVLSGINIGNN  111



>ref|XP_008652177.1| PREDICTED: uncharacterized protein LOC103632103 [Zea mays]
Length=304

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSS  256
            R+ V VCAPD+++S VSH ITWR A+  KRV+I GATAF V+GTPADCASLGIS  LF  
Sbjct  52   RYRVLVCAPDTDKSGVSHCITWRPALRCKRVDIIGATAFGVSGTPADCASLGISGKLFDG  111

Query  257  -VPDLVISGINMGSN  298
             VPDLV+SGIN+G+N
Sbjct  112  LVPDLVLSGINIGNN  126



>ref|XP_010322260.1| PREDICTED: uncharacterized protein LOC101261528 isoform X2 [Solanum 
lycopersicum]
Length=292

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++A GLR +VR LVSTN F+V V APDSE+SA SH ++W+  V VK+V++ G
Sbjct  14   VMVTNDDGINAPGLRAIVRALVSTNLFHVLVFAPDSERSAASHCVSWQRVVTVKKVDVPG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  SLGISK +F SVP+LV+SGIN+G N
Sbjct  74   ATAFAVSGTPADSTSLGISKKIFPSVPNLVVSGINLGCN  112



>ref|XP_004241052.1| PREDICTED: uncharacterized protein LOC101261528 isoform X1 [Solanum 
lycopersicum]
Length=320

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            VMVTNDDG++A GLR +VR LVSTN F+V V APDSE+SA SH ++W+  V VK+V++ G
Sbjct  14   VMVTNDDGINAPGLRAIVRALVSTNLFHVLVFAPDSERSAASHCVSWQRVVTVKKVDVPG  73

Query  182  ATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
            ATAF+V+GTPAD  SLGISK +F SVP+LV+SGIN+G N
Sbjct  74   ATAFAVSGTPADSTSLGISKKIFPSVPNLVVSGINLGCN  112



>emb|CAB10272.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78535.1| hypothetical protein [Arabidopsis thaliana]
Length=275

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 83/112 (74%), Gaps = 13/112 (12%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDS-------------EQSAVSHSITW  142
            +MVTNDDG+DA GLR LVRVLVSTN ++V VCAPDS             E+SAVSHSI W
Sbjct  16   IMVTNDDGIDAPGLRSLVRVLVSTNLYDVRVCAPDSYMCNSYLFMKFSREKSAVSHSIIW  75

Query  143  RHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
               +  KRVEI GATA+SV GTPADC  LG+S+ALF S PDLV+SGIN+GSN
Sbjct  76   SRPLTAKRVEIDGATAYSVDGTPADCTGLGLSEALFPSRPDLVLSGINVGSN  127



>ref|XP_006858911.1| hypothetical protein AMTR_s00068p00035490 [Amborella trichopoda]
 gb|ERN20378.1| hypothetical protein AMTR_s00068p00035490 [Amborella trichopoda]
Length=276

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTNDDG+ A G+R L+ VLVSTNR++V VCAPD E+SAVSH IT R A+ V  VEI G
Sbjct  10   ILVTNDDGIYAPGIRSLIHVLVSTNRYHVLVCAPDQERSAVSHCITARGALQVTPVEIEG  69

Query  182  ATAFSVAGTPADCASLGISKALF-SSVPDLVISGINMGSN  298
            A A+  +GTPADCASLG+S  LF  ++PDLV+SGIN GSN
Sbjct  70   AIAYGTSGTPADCASLGLSGILFPGTIPDLVVSGINKGSN  109



>gb|ABK23714.1| unknown [Picea sitchensis]
Length=200

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  71   TNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALF  250
            T R+NV VCAPDSE+SAV HSIT R  + V++VEI GATAF ++GTPADC SL +S ALF
Sbjct  65   TGRYNVSVCAPDSEKSAVGHSITSRGNIAVRQVEIKGATAFELSGTPADCVSLSLSGALF  124

Query  251  S-SVPDLVISGINMGSN  298
            S S P LVISGIN GSN
Sbjct  125  SWSKPTLVISGINKGSN  141



>gb|AES93678.2| survival protein SurE-like phosphatase/nucleotidase [Medicago 
truncatula]
Length=282

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +++TNDDG+DA GLR LV  LV+TN FNV VCAPDS      H +TW H V VK+V+I G
Sbjct  10   ILITNDDGIDAPGLRALVESLVNTNLFNVLVCAPDS------HCMTWLHPVAVKQVDIHG  63

Query  182  ATA-FSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
              A F+V+GTPADC SLGIS+ALF + P+LV+SGIN GSN
Sbjct  64   TVASFAVSGTPADCTSLGISRALFPTTPNLVVSGINKGSN  103



>ref|XP_003610720.1| 5'-nucleotidase surE [Medicago truncatula]
Length=345

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +++TNDDG+DA GLR LV  LV+TN FNV VCAPDS      H +TW H V VK+V+I G
Sbjct  19   ILITNDDGIDAPGLRALVESLVNTNLFNVLVCAPDS------HCMTWLHPVAVKQVDIHG  72

Query  182  ATA-FSVAGTPADCASLGISKALFSSVPDLVISGINMGSN  298
              A F+V+GTPADC SLGIS+ALF + P+LV+SGIN GSN
Sbjct  73   TVASFAVSGTPADCTSLGISRALFPTTPNLVVSGINKGSN  112



>ref|XP_010696523.1| PREDICTED: uncharacterized protein LOC104909039 [Beta vulgaris 
subsp. vulgaris]
Length=403

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            RF+V+VCAP  ++SA  HS+T R  V V   EISGATAF V+GTPADC SL +S+ALFS 
Sbjct  105  RFDVYVCAPQFDKSASGHSLTVRETVEVTSAEISGATAFEVSGTPADCVSLALSQALFSW  164

Query  254  SVPDLVISGINMGS  295
            S P LV+SGIN GS
Sbjct  165  SKPLLVLSGINRGS  178



>emb|CDO97899.1| unnamed protein product [Coffea canephora]
Length=407

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R+NV VCAP S++SA  HS+T R  + V   EI GATA+ V+GTPADC SL +S ALFS 
Sbjct  108  RYNVHVCAPQSDKSASGHSLTMRQTISVSLAEIDGATAYEVSGTPADCVSLALSGALFSW  167

Query  254  SVPDLVISGINMGS  295
            + P LVISGIN GS
Sbjct  168  TKPLLVISGINRGS  181



>ref|XP_011015672.1| PREDICTED: uncharacterized protein LOC105119243 isoform X2 [Populus 
euphratica]
Length=363

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T + A+ V  VEI+GA A+ V+GTP DC SL +S ALFS S
Sbjct  96   YNVHVCAPQSDKSVSSHSVTLQEAIAVTSVEINGAIAYEVSGTPVDCVSLALSGALFSWS  155

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  156  KPLLVISGINRGSN  169



>ref|XP_001784822.1| predicted protein [Physcomitrella patens]
 gb|EDQ50374.1| predicted protein [Physcomitrella patens]
Length=208

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSV-AGTPADCASLGISKALFS-S  256
            NVF+CAPDSEQS VSHSIT R  + V  V I GATAF   AGTPADC SL ++ ++F  +
Sbjct  30   NVFICAPDSEQSGVSHSITHRSVLEVSSVNILGATAFETSAGTPADCVSLALTSSIFPWA  89

Query  257  VPDLVISGINMGSN  298
             P LV+SGIN GSN
Sbjct  90   KPTLVVSGINKGSN  103



>ref|XP_011015671.1| PREDICTED: uncharacterized protein LOC105119243 isoform X1 [Populus 
euphratica]
Length=393

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T + A+ V  VEI+GA A+ V+GTP DC SL +S ALFS S
Sbjct  96   YNVHVCAPQSDKSVSSHSVTLQEAIAVTSVEINGAIAYEVSGTPVDCVSLALSGALFSWS  155

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  156  KPLLVISGINRGSN  169



>ref|XP_001766580.1| predicted protein [Physcomitrella patens]
 gb|EDQ68645.1| predicted protein [Physcomitrella patens]
Length=219

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +VFVCAPDSE+S+VSHSIT R  + V  V I GATAF  +GTPADC SL ++ ++F  + 
Sbjct  42   HVFVCAPDSEKSSVSHSITPRAILEVASVNIPGATAFETSGTPADCVSLAMTASIFPWTK  101

Query  260  PDLVISGINMGSN  298
            P LV+SGIN GSN
Sbjct  102  PTLVVSGINKGSN  114



>gb|ABK94047.1| unknown [Populus trichocarpa]
Length=394

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T   A+ V  VEI+GA A+ V+GTP DC SL +S ALFS S
Sbjct  97   YNVHVCAPQSDKSVSSHSVTLHEAIAVTSVEINGAIAYEVSGTPVDCVSLALSGALFSWS  156

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  157  KPLLVISGINRGSN  170



>gb|KDO65184.1| hypothetical protein CISIN_1g022032mg [Citrus sinensis]
Length=198

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>ref|XP_004146815.1| PREDICTED: 5'-nucleotidase SurE-like [Cucumis sativus]
 ref|XP_004154795.1| PREDICTED: 5'-nucleotidase SurE-like [Cucumis sativus]
 gb|KGN59808.1| hypothetical protein Csa_3G848180 [Cucumis sativus]
Length=388

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T R  V V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  92   YNVHVCAPQSDKSVSSHSVTLRETVAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  151

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  152  KPLLVISGINRGS  164



>ref|XP_002299895.2| acid phosphatase survival protein SurE [Populus trichocarpa]
 gb|EEE84700.2| acid phosphatase survival protein SurE [Populus trichocarpa]
Length=394

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T   A+ V  VEI+GA A+ V+GTP DC SL +S ALFS S
Sbjct  97   YNVHVCAPQSDKSVSSHSVTLHEAIAVTSVEINGAIAYEVSGTPVDCVSLALSGALFSWS  156

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  157  KPLLVISGINRGSN  170



>gb|KDO65185.1| hypothetical protein CISIN_1g022032mg [Citrus sinensis]
Length=208

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>gb|ABR16074.1| unknown [Picea sitchensis]
Length=394

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN+DG++A GL+ LV  LV+  RFNV VCAP+S++S   H ++ R  +    V I G
Sbjct  67   VLVTNEDGIEAPGLKCLVEALVNGGRFNVHVCAPESDKSGSGHCVSVRQTLVASSVGIKG  126

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATA+ V+GTPADC SLG+S ALF    P LVISGIN GSN
Sbjct  127  ATAYEVSGTPADCVSLGLSGALFPWKKPSLVISGINKGSN  166



>ref|XP_004303652.1| PREDICTED: 5'-nucleotidase SurE-like [Fragaria vesca subsp. vesca]
Length=372

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  V V   +++GATA+ VAGTP DC SL +S ALFS S
Sbjct  78   YNVHVCAPQSDKSVSGHSVTLRETVSVSSADMNGATAYEVAGTPVDCVSLALSGALFSWS  137

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  138  KPLLVISGINRGSN  151



>gb|KDO65183.1| hypothetical protein CISIN_1g022032mg [Citrus sinensis]
Length=261

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>gb|KDO65182.1| hypothetical protein CISIN_1g022032mg [Citrus sinensis]
Length=303

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>ref|XP_007215687.1| hypothetical protein PRUPE_ppa008696mg [Prunus persica]
 gb|EMJ16886.1| hypothetical protein PRUPE_ppa008696mg [Prunus persica]
Length=322

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  V V   EI GATA+ V+GTP DC SL +S ALFS S
Sbjct  87   YNVHVCAPQSDKSLSGHSVTLRETVSVSSAEIKGATAYEVSGTPVDCVSLALSGALFSWS  146

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  147  KPLLVISGINRGSS  160



>ref|XP_006853858.1| hypothetical protein AMTR_s00036p00106140 [Amborella trichopoda]
 gb|ERN15325.1| hypothetical protein AMTR_s00036p00106140 [Amborella trichopoda]
Length=381

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++S   HS+T R  + V  VEI+GATAF V+GTPADC SL +S ALFS 
Sbjct  82   RCSVHVCAPESDKSVSGHSVTLRETLTVSSVEINGATAFEVSGTPADCISLALSGALFSW  141

Query  254  SVPDLVISGINMGSN  298
            S P LVISG+N GS+
Sbjct  142  SKPVLVISGVNKGSS  156



>ref|XP_007150495.1| hypothetical protein PHAVU_005G157500g [Phaseolus vulgaris]
 gb|ESW22489.1| hypothetical protein PHAVU_005G157500g [Phaseolus vulgaris]
Length=370

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VC P S++SA +HS+T R  V     +ISGATAF ++GTP DC SL +S ALFS S
Sbjct  74   YNVHVCVPQSDKSASAHSVTLRETVEAASSKISGATAFEISGTPVDCVSLALSGALFSWS  133

Query  257  VPDLVISGINMGSN  298
             P LV+SGIN GSN
Sbjct  134  KPMLVVSGINRGSN  147



>ref|XP_006426577.1| hypothetical protein CICLE_v10025780mg [Citrus clementina]
 gb|ESR39817.1| hypothetical protein CICLE_v10025780mg [Citrus clementina]
Length=397

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>ref|XP_008447629.1| PREDICTED: uncharacterized protein LOC103490041 [Cucumis melo]
 gb|ADN33735.1| acid phosphatase [Cucumis melo subsp. melo]
Length=388

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S  SHS+T R  V V   EI+G TA+ V+GTP DC SL +S ALFS S
Sbjct  92   YNVHVCAPQSDKSVSSHSVTLRETVAVSSAEINGVTAYEVSGTPVDCVSLALSGALFSWS  151

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  152  KPLLVISGINRGS  164



>ref|XP_010924989.1| PREDICTED: uncharacterized protein LOC105047656 [Elaeis guineensis]
Length=403

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +V VCAP+S++SA  HS+T R  V V   E +GATAF V+GTPADC SL +S A+FS S 
Sbjct  102  DVHVCAPESDKSASGHSVTVRETVAVTSAEFNGATAFEVSGTPADCVSLALSGAVFSWSR  161

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  162  PALVISGINRGSN  174



>gb|KHN30063.1| 5'-nucleotidase surE [Glycine soja]
Length=325

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DGV++ GL  LV  LV    +NV VC P S++S  +HS+T R  +     +ISG
Sbjct  52   VLVTNSDGVESPGLTHLVEALVQQGLYNVHVCVPQSDKSVSAHSVTLRETIEAASAKISG  111

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF ++GTP DC SL +S ALFS S P LVISGIN GSN
Sbjct  112  ATAFEISGTPVDCVSLALSGALFSWSKPMLVISGINRGSN  151



>ref|XP_006466007.1| PREDICTED: uncharacterized protein LOC102624443 [Citrus sinensis]
Length=397

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQSDKSVSGHSVTLRETIAVSSAEINGATAYEVSGTPVDCVSLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPLLVISGINRGS  167



>ref|XP_008228273.1| PREDICTED: uncharacterized protein LOC103327688 [Prunus mume]
Length=381

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  V V   EI GATA+ V+GTP DC SL +S ALFS S
Sbjct  87   YNVHVCAPQSDKSLSGHSVTLRETVSVSSAEIKGATAYEVSGTPVDCVSLALSGALFSWS  146

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  147  KPLLVISGINRGSS  160



>ref|NP_001241615.1| uncharacterized protein LOC100779772 [Glycine max]
 gb|ACU20880.1| unknown [Glycine max]
Length=375

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DGV++ GL  LV  LV    +NV VC P S++S  +HS+T R  +     +ISG
Sbjct  52   VLVTNSDGVESPGLTHLVEALVQQGLYNVHVCVPQSDKSVSAHSVTLRETIEAASAKISG  111

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF ++GTP DC SL +S ALFS S P LVISGIN GSN
Sbjct  112  ATAFEISGTPVDCVSLALSGALFSWSKPMLVISGINRGSN  151



>emb|CDX68252.1| BnaA07g22920D [Brassica napus]
Length=378

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA SHS+T    +    V I GATAF V+GTP DC SLG+S ALF+ S
Sbjct  82   YNVHVCAPQTDKSASSHSMTPGETISASSVNIKGATAFEVSGTPVDCISLGLSGALFAWS  141

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  142  KPILVISGINQGSN  155



>gb|KDP33860.1| hypothetical protein JCGZ_07431 [Jatropha curcas]
Length=394

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN +G+++ GL  LV  LV   RFNV VCAP S++S   HS+T R  +  + +EISG
Sbjct  73   VLVTNGEGIESSGLTSLVEALVRDGRFNVHVCAPQSDRSVSGHSVTIRETLAARSIEISG  132

Query  182  AT-AFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
             T A+ V+GTPADC SL +S ALFS + P LVISGIN GS
Sbjct  133  VTAAYEVSGTPADCVSLALSGALFSWTKPALVISGINRGS  172



>ref|XP_009104839.1| PREDICTED: uncharacterized protein LOC103830776 [Brassica rapa]
Length=380

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA SHS+T    +    V I GATAF V+GTP DC SLG+S ALF+ S
Sbjct  84   YNVHVCAPQTDKSASSHSMTPGETISASSVNIKGATAFEVSGTPVDCISLGLSGALFAWS  143

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  144  KPILVISGINQGSN  157



>ref|XP_010685370.1| PREDICTED: uncharacterized protein LOC104899800 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV+VCAP  ++S+  H +T+   + V  VE+ GATAF V+GTP DC SL +S ALFS S
Sbjct  85   YNVYVCAPQMDKSSSGHGVTFGETIAVSSVEMHGATAFEVSGTPVDCVSLALSGALFSWS  144

Query  257  VPDLVISGINMGSN  298
             P LV+SGIN GSN
Sbjct  145  KPMLVVSGINKGSN  158



>emb|CDY53290.1| BnaCnng24750D [Brassica napus]
Length=381

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA SHS+T    +    V+I GAT+F V+GTP DC SLG+S ALF+ S
Sbjct  85   YNVHVCAPQTDKSASSHSMTPGETISASSVDIKGATSFEVSGTPVDCISLGLSGALFAWS  144

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  145  KPILVISGINQGSN  158



>ref|XP_008242371.1| PREDICTED: uncharacterized protein LOC103340703 [Prunus mume]
Length=392

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
            +R +V+VCAP  ++S   HS+T R  + V   +I+GATAF V+GTPADC SL +S ALF+
Sbjct  89   DRLDVYVCAPQLDRSVAGHSVTVRETISVSSSQINGATAFEVSGTPADCVSLALSGALFA  148

Query  254  -SVPDLVISGINMGS  295
             S P LV+SGIN GS
Sbjct  149  WSKPALVVSGINRGS  163



>ref|XP_002978358.1| hypothetical protein SELMODRAFT_14959, partial [Selaginella moellendorffii]
 gb|EFJ20344.1| hypothetical protein SELMODRAFT_14959, partial [Selaginella moellendorffii]
Length=208

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V++TNDDG+ A GL  LV+ LV   R NV VCAPDS++S   H IT R  + V  VEI G
Sbjct  4    VLITNDDGIAAPGLGALVQALVRGGRCNVNVCAPDSDKSGTGHGITARGVLEVGAVEIPG  63

Query  182  ATA-FSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
             +A   V GTP DC SLG+S ALF  S PDLVISGIN GSN
Sbjct  64   TSASHEVGGTPVDCVSLGLSGALFPWSKPDLVISGINKGSN  104



>ref|XP_010907863.1| PREDICTED: uncharacterized protein LOC105034292 isoform X2 [Elaeis 
guineensis]
Length=383

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +V VCAP+S++SA  H++T R  V V   E +GATAF V+GTPADC SL +S  LFS S 
Sbjct  84   DVHVCAPESDKSASGHAVTVRETVAVTSAEFNGATAFEVSGTPADCVSLALSGVLFSWSR  143

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  144  PALVISGINKGSN  156



>ref|XP_010242242.1| PREDICTED: uncharacterized protein LOC104586648 [Nelumbo nucifera]
 ref|XP_010242243.1| PREDICTED: uncharacterized protein LOC104586648 [Nelumbo nucifera]
Length=381

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+DA GL  LV  LV   ++NV VCAP S++S   HS+T+   + V   EI+G
Sbjct  61   VLVTNADGIDAPGLTFLVEALVRQGQYNVHVCAPQSDKSVSGHSVTFCETLAVTSAEING  120

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
            ATA+ V+GTPADC SL +S ALFS S P LVISGIN GS
Sbjct  121  ATAYEVSGTPADCVSLALSGALFSWSKPALVISGINRGS  159



>ref|XP_010907721.1| PREDICTED: uncharacterized protein LOC105034292 isoform X1 [Elaeis 
guineensis]
Length=395

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +V VCAP+S++SA  H++T R  V V   E +GATAF V+GTPADC SL +S  LFS S 
Sbjct  96   DVHVCAPESDKSASGHAVTVRETVAVTSAEFNGATAFEVSGTPADCVSLALSGVLFSWSR  155

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  156  PALVISGINKGSN  168



>ref|XP_010416061.1| PREDICTED: uncharacterized protein LOC104701976 [Camelina sativa]
Length=385

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS+T    + V  V I GATAF VAGTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSMTPGETIAVSSVTIKGATAFEVAGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>gb|KHG01721.1| 5'-nucleotidase surE [Gossypium arboreum]
Length=386

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI GATA+ V+GTP DC SL +S ALFS S
Sbjct  90   YNVHVCAPQSDKSVSGHSVTVRETITVTPAEIDGATAYEVSGTPVDCVSLALSGALFSWS  149

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  150  KPLLVISGINRGS  162



>ref|XP_002276942.1| PREDICTED: uncharacterized protein LOC100242981 [Vitis vinifera]
 emb|CBI35904.3| unnamed protein product [Vitis vinifera]
Length=384

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS+T R  V V   EI+GATA+ V+GTP DC SL +S ALFS S 
Sbjct  89   NVHVCAPQSDKSVSGHSVTLRETVAVTSAEINGATAYEVSGTPVDCVSLALSGALFSWSK  148

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  149  PLLVISGINRGS  160



>ref|XP_010262068.1| PREDICTED: uncharacterized protein LOC104600684 [Nelumbo nucifera]
Length=393

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R NV VCAP S++S   HS+T R  + V   +I GATA+ V GTPADC SL +S ALFS 
Sbjct  95   RCNVHVCAPQSDKSVSGHSVTLRETLAVTSAQILGATAYEVCGTPADCVSLALSGALFSW  154

Query  254  SVPDLVISGINMGS  295
            S P LVISGIN GS
Sbjct  155  SKPALVISGINRGS  168



>ref|XP_011009858.1| PREDICTED: uncharacterized protein LOC105114858 [Populus euphratica]
Length=173

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S  SHS+T +  +     EI+GA A+ ++GTP DC SL +S ALFS S 
Sbjct  96   NVHVCAPQSDKSVSSHSVTLQETIAATSAEINGAVAYEISGTPVDCVSLALSGALFSWSK  155

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  156  PLLVISGINRGSN  168



>ref|XP_009392992.1| PREDICTED: uncharacterized protein LOC103978786 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+ + GL +LV  LV   + +V VCAPDS++S   HSIT    V     +I G
Sbjct  79   VLVTNADGIGSPGLTLLVEALVREGQSDVHVCAPDSDKSVSGHSITLHQTVAATSADIKG  138

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF ++G+PADC SL +S ALFS S P LVISGIN GSN
Sbjct  139  ATAFEISGSPADCVSLALSGALFSWSKPTLVISGINKGSN  178



>ref|XP_006302370.1| hypothetical protein CARUB_v10020451mg [Capsella rubella]
 gb|EOA35268.1| hypothetical protein CARUB_v10020451mg [Capsella rubella]
Length=385

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS+T    + V  V I GATAF V+GTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSMTPGETIAVSSVNIKGATAFEVSGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>gb|KFK41715.1| hypothetical protein AALP_AA2G164000 [Arabis alpina]
Length=383

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS+T    +    V I GATAF VAGTP DC SLG+S ALF+ S
Sbjct  87   YNVHVCAPQTDKSASAHSMTPGETIAASSVSIKGATAFEVAGTPVDCISLGLSGALFAWS  146

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  147  KPVLVISGINQGS  159



>ref|XP_010428191.1| PREDICTED: uncharacterized protein LOC104712896 [Camelina sativa]
Length=386

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS+T    + V  V + GATAF VAGTP DC SLG+S ALF+ S
Sbjct  90   YNVHVCAPQTDKSASAHSMTPGETIAVSSVTMKGATAFEVAGTPVDCISLGLSGALFAWS  149

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  150  KPILVISGINQGS  162



>ref|XP_003546718.1| PREDICTED: uncharacterized protein LOC100790833 isoform X1 [Glycine 
max]
 gb|KHN32704.1| 5'-nucleotidase surE [Glycine soja]
Length=372

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VC P S++S   HS+T R  +     +I+GATAF ++GTP DC SL +S ALFS S
Sbjct  75   YNVHVCVPQSDKSVSGHSVTLRETIEAASAKINGATAFEISGTPVDCVSLALSGALFSWS  134

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GSN
Sbjct  135  KPMLVISGINRGSN  148



>ref|XP_010471334.1| PREDICTED: uncharacterized protein LOC104751142 [Camelina sativa]
Length=385

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS+T    + V  V I GATAF V+GTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSMTPGETIAVSSVTIKGATAFEVSGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>gb|AAD55635.1|AC008017_8 Unknown protein [Arabidopsis thaliana]
Length=359

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS T    + V  V++ GATAF V+GTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSTTPGETIAVSSVKLKGATAFEVSGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>emb|CDX72957.1| BnaC06g34050D [Brassica napus]
Length=379

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+D+ GL  LV  LVS   +NV VCAP +++S  SHS+T    +    V+I G
Sbjct  57   VLVTNGDGIDSPGLVSLVEALVSEGLYNVHVCAPQTDKSVSSHSMTPGETIAASSVDIKG  116

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF V+GTP DC SLG+S ALF+ S P LVISGIN GS+
Sbjct  117  ATAFEVSGTPVDCISLGLSGALFAWSKPILVISGINQGSS  156



>ref|XP_002970193.1| hypothetical protein SELMODRAFT_441080 [Selaginella moellendorffii]
 gb|EFJ28323.1| hypothetical protein SELMODRAFT_441080 [Selaginella moellendorffii]
Length=414

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V++TNDDG+ A GL  LV+ LV   R NV VCAPDS++S   H IT R  + V  VEI G
Sbjct  36   VLITNDDGIAAPGLGALVQALVRGGRCNVNVCAPDSDKSGTGHGITARGVLEVGAVEIPG  95

Query  182  ATA-FSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
             +A   V GTP DC SLG+S ALF  S PDLVISGIN GSN
Sbjct  96   TSASHEVGGTPVDCVSLGLSGALFPWSKPDLVISGINKGSN  136



>dbj|BAH57142.1| AT1G72880 [Arabidopsis thaliana]
Length=353

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS T    + V  V++ GATAF V+GTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSTTPGETIAVSSVKLKGATAFEVSGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>ref|XP_006357386.1| PREDICTED: uncharacterized protein LOC102588933 [Solanum tuberosum]
Length=378

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS T + ++ V   EI GATA+ V+GTP DC SL +S ALFS S
Sbjct  81   YNVNVCAPQSDESMAGHSFTLKESIAVTSAEIHGATAYEVSGTPVDCVSLALSGALFSWS  140

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  141  KPMLVISGINKGS  153



>ref|XP_004241879.1| PREDICTED: uncharacterized protein LOC101267031 [Solanum lycopersicum]
Length=370

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV +CAP S++S   HS T + ++ V   EI GATA+ V+GTP DC SL +S ALFS S
Sbjct  73   YNVNICAPQSDESTAGHSFTLKESIAVTSAEIHGATAYEVSGTPLDCVSLALSGALFSWS  132

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  133  KPMLVISGINKGS  145



>ref|NP_177431.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
 ref|NP_849880.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
 gb|AAP21183.1| At1g72880 [Arabidopsis thaliana]
 dbj|BAE99324.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35385.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
 gb|AEE35386.1| survival protein SurE-like phosphatase/nucleotidase [Arabidopsis 
thaliana]
Length=385

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS T    + V  V++ GATAF V+GTP DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSTTPGETIAVSSVKLKGATAFEVSGTPVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  149  KPILVISGINQGS  161



>ref|XP_006390611.1| hypothetical protein EUTSA_v10018692mg [Eutrema salsugineum]
 gb|ESQ27897.1| hypothetical protein EUTSA_v10018692mg [Eutrema salsugineum]
Length=388

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV+VCAP +++SA +HS T    +      I+GATAF V+GTP DC SLG+S ALF+ S
Sbjct  92   YNVYVCAPQTDKSAAAHSTTPGETIAASSTNINGATAFEVSGTPVDCISLGLSGALFAWS  151

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  152  KPILVISGINQGS  164



>ref|XP_007203123.1| hypothetical protein PRUPE_ppa024008mg [Prunus persica]
 gb|EMJ04322.1| hypothetical protein PRUPE_ppa024008mg [Prunus persica]
Length=392

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
            +R +V VCAP  ++S   HS+T R  + V   +I+GATAF V+GTPADC SL +S ALF+
Sbjct  89   DRLDVCVCAPQLDRSVAGHSVTVRETISVSSSQINGATAFEVSGTPADCVSLALSGALFA  148

Query  254  -SVPDLVISGINMGS  295
             S P LV+SGIN GS
Sbjct  149  WSKPALVVSGINRGS  163



>ref|XP_004511452.1| PREDICTED: 5'-nucleotidase SurE-like [Cicer arietinum]
Length=324

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 80/120 (67%), Gaps = 21/120 (18%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            +M+TNDDG+DA GLR LV  LV+TN FNV VCAPDSE+SAVSHSITW H++  K+V I G
Sbjct  9    IMITNDDGIDAPGLRALVDSLVNTNVFNVLVCAPDSEKSAVSHSITWLHSISAKQVNIHG  68

Query  182  ATA-FSVAGTPAD---------CASLGIS-KALF----------SSVPDLVISGINMGSN  298
              A F+V+GTPAD         C++L IS K+L           S++   VISGIN GSN
Sbjct  69   TVASFAVSGTPADSPDLVISLLCSALSISIKSLIICVFIEIYVPSNLFKQVISGINRGSN  128



>ref|XP_010033769.1| PREDICTED: uncharacterized protein LOC104423012 [Eucalyptus grandis]
 gb|KCW53573.1| hypothetical protein EUGRSUZ_J02848 [Eucalyptus grandis]
Length=381

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VC P S++SA  HS+T R  V V   EI+GA A+ V+GTP DC SL +S ALFS S 
Sbjct  85   NVHVCVPQSDKSASGHSVTLRETVAVTSAEINGAVAYEVSGTPVDCVSLALSGALFSWSK  144

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  145  PLLVISGINRGS  156



>ref|XP_007024517.1| Acid phosphatase [Theobroma cacao]
 gb|EOY27139.1| Acid phosphatase [Theobroma cacao]
Length=388

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS+T R  + V   EI GATA+ V+GT  DC SL +S ALFS S
Sbjct  93   YNVHVCAPQSDKSVSGHSVTLRETIAVTPAEIDGATAYEVSGTTVDCVSLALSGALFSWS  152

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  153  KPLLVISGINRGS  165



>ref|XP_008807163.1| PREDICTED: uncharacterized protein LOC103719612 [Phoenix dactylifera]
Length=398

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+ +LGL  LV  LV   + +V VCAP+ ++SA  HS+T R  V V     +G
Sbjct  72   VLVTNGDGIGSLGLAALVEALVRGGQCDVHVCAPELDKSASGHSVTVRETVAVTSAGFNG  131

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF V+GTPADC SL +S ALFS S P LV+SGIN GSN
Sbjct  132  ATAFEVSGTPADCVSLALSGALFSWSRPALVVSGINRGSN  171



>ref|XP_004288960.1| PREDICTED: 5'-nucleotidase SurE-like [Fragaria vesca subsp. vesca]
Length=389

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
             +V+VCAP S++S   HS+T    + V   +I+GATAF V+GTPADC SL +S ALF+ S
Sbjct  89   LDVYVCAPKSDRSVAGHSVTVGETISVSSAQINGATAFEVSGTPADCVSLALSGALFNFS  148

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  149  RPTLVISGINRGSS  162



>ref|XP_006385420.1| acid phosphatase survival protein SurE [Populus trichocarpa]
 gb|ERP63217.1| acid phosphatase survival protein SurE [Populus trichocarpa]
Length=390

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S  SHS+T +  +     EI+GA A+ ++GTP DC SL +S ALFS S 
Sbjct  96   NVHVCAPQSDKSVSSHSVTLQETIAATSAEINGAVAYEISGTPVDCVSLALSGALFSWSK  155

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  156  PLLVISGINRGSN  168



>ref|XP_011009859.1| PREDICTED: uncharacterized protein LOC105114859 [Populus euphratica]
Length=390

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S  SHS+T +  +     EI+GA A+ ++GTP DC SL +S ALFS S 
Sbjct  96   NVHVCAPQSDKSVSSHSVTLQETIAATSAEINGAVAYEISGTPVDCVSLALSGALFSWSK  155

Query  260  PDLVISGINMGSN  298
            P LVISGIN GSN
Sbjct  156  PLLVISGINRGSN  168



>gb|ACR34676.1| unknown [Zea mays]
 gb|AFW83716.1| hypothetical protein ZEAMMB73_487675 [Zea mays]
Length=176

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
             R +V VCAP+S++ A  HSIT R  +    V+ +GA AF  +GTP DC SL +S  LF 
Sbjct  94   GRCDVHVCAPESDKQACGHSITIRETIAASSVDFTGAKAFETSGTPVDCVSLALSGRLFP  153

Query  254  -SVPDLVISGINMGSN  298
             S P LVISGIN GSN
Sbjct  154  WSSPALVISGINTGSN  169



>ref|XP_003569660.1| PREDICTED: uncharacterized protein LOC100842342 [Brachypodium 
distachyon]
Length=394

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
             R +V VCAPDS++    HSIT R  V    V+++GA AF ++GTP DC SL +S  LFS
Sbjct  87   GRCDVHVCAPDSDKPVCGHSITIRETVAATSVDLTGAKAFEISGTPVDCVSLALSGRLFS  146

Query  254  -SVPDLVISGINMGSN  298
             S P LVISGIN G N
Sbjct  147  WSAPALVISGINAGPN  162



>emb|CDX96436.1| BnaA07g30470D [Brassica napus]
Length=376

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+D+ GL  LV  LVS   +NV VCAP +++S  SHS+T    +    V I G
Sbjct  54   VLVTNGDGIDSPGLLSLVEALVSEGLYNVHVCAPQTDKSVSSHSMTPGETIAASSVIIKG  113

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
            ATAF V+GTP DC SLG+S ALF+ S P LVISGIN GS
Sbjct  114  ATAFEVSGTPVDCISLGLSGALFAWSKPILVISGINQGS  152



>ref|XP_009798241.1| PREDICTED: uncharacterized protein LOC104244504 [Nicotiana sylvestris]
Length=381

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++S   HS T +  + V   EI GA A+ V+GTP DC SL +S ALFS S
Sbjct  84   YNVHVCAPQSDKSTAGHSFTLKETIAVTSAEIHGAIAYEVSGTPVDCVSLALSGALFSWS  143

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  144  KPMLVISGINKGS  156



>ref|XP_009105950.1| PREDICTED: uncharacterized protein LOC103831786 [Brassica rapa]
Length=376

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+D+ GL  LV  LVS   +NV VCAP +++S  SHS+T    +    V I G
Sbjct  54   VLVTNGDGIDSPGLLSLVEALVSEGLYNVHVCAPQTDKSVSSHSMTPGETIAASSVIIKG  113

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
            ATAF V+GTP DC SLG+S ALF+ S P LVISGIN GS
Sbjct  114  ATAFEVSGTPVDCISLGLSGALFAWSKPILVISGINQGS  152



>ref|XP_009616297.1| PREDICTED: uncharacterized protein LOC104108863 [Nicotiana tomentosiformis]
Length=390

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS+T +  V V   E+ GATA+ V+GTP DC SL +S ALFS S 
Sbjct  94   NVNVCAPQSDKSVAGHSVTLKETVAVTPTEVHGATAYEVSGTPVDCVSLALSGALFSWSK  153

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  154  PVLVISGINRGS  165



>ref|XP_003597571.1| 5'-nucleotidase surE [Medicago truncatula]
 gb|AES67822.1| survival protein SurE-like phosphatase/nucleotidase [Medicago 
truncatula]
Length=377

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
            N +NV VC P S++S   HS+T R  V     +++GATAF ++GTP DC SL +S ALFS
Sbjct  77   NLYNVHVCVPQSDKSVSGHSVTIRETVEACSAQVNGATAFEISGTPVDCVSLALSGALFS  136

Query  254  -SVPDLVISGINMGS  295
             S P LVISGIN GS
Sbjct  137  WSKPVLVISGINRGS  151



>gb|KDP40754.1| hypothetical protein JCGZ_24753 [Jatropha curcas]
Length=384

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV V AP S++S   HS+T R  + V   EI+GATA+ V+GTP DC SL +S ALFS S
Sbjct  88   YNVNVLAPQSDKSVSGHSVTLRETIAVTSAEINGATAYEVSGTPVDCVSLALSGALFSWS  147

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  148  KPLLVISGINRGS  160



>ref|XP_008391343.1| PREDICTED: uncharacterized protein LOC103453576 [Malus domestica]
Length=381

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP  ++S   HS+T +  V V   +I+GATA+ V+GTP DC SL +S ALFS S
Sbjct  87   YNVHVCAPQLDKSVSGHSVTLQETVAVSSADINGATAYEVSGTPVDCVSLALSGALFSWS  146

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  147  KPLLVISGINRGSS  160



>ref|XP_004486847.1| PREDICTED: 5'-nucleotidase SurE-like [Cicer arietinum]
Length=372

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VC P S+++   HS+T R  V     +++GATAF ++GTP DC SL +S ALFS S
Sbjct  74   YNVHVCVPQSDKTVSGHSVTLRETVEASSAKLNGATAFEISGTPVDCVSLALSGALFSWS  133

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  134  KPALVISGINRGS  146



>ref|XP_010656176.1| PREDICTED: uncharacterized protein LOC100245780 isoform X2 [Vitis 
vinifera]
Length=369

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            RF+V VCAP S++S   HS+T +  +     EI GATA+ V+GTPADC SL +S ALFS 
Sbjct  69   RFHVHVCAPQSDKSVSGHSMTVQETLTACSAEIGGATAYEVSGTPADCVSLALSGALFSW  128

Query  254  SVPDLVISGINMGS  295
            S P LVI GIN GS
Sbjct  129  SKPVLVICGINKGS  142



>ref|XP_002279415.1| PREDICTED: uncharacterized protein LOC100245780 isoform X1 [Vitis 
vinifera]
Length=371

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            RF+V VCAP S++S   HS+T +  +     EI GATA+ V+GTPADC SL +S ALFS 
Sbjct  69   RFHVHVCAPQSDKSVSGHSMTVQETLTACSAEIGGATAYEVSGTPADCVSLALSGALFSW  128

Query  254  SVPDLVISGINMGS  295
            S P LVI GIN GS
Sbjct  129  SKPVLVICGINKGS  142



>gb|EPS57329.1| hypothetical protein M569_17488, partial [Genlisea aurea]
Length=367

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            ++VF+  P S+++   HS+T R  V V  VE++GA AF ++G+PADC SL +S ALFS S
Sbjct  75   YDVFIVVPQSDKTMAGHSLTLRETVEVASVEVNGAVAFEISGSPADCVSLALSGALFSWS  134

Query  257  VPDLVISGINMGS  295
             P LVISG+N GS
Sbjct  135  KPLLVISGVNKGS  147



>ref|XP_010318496.1| PREDICTED: uncharacterized protein LOC101263094 isoform X2 [Solanum 
lycopersicum]
Length=341

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS+T +  + V   +I GATA+ V+GTP DC SL +S ALFS S 
Sbjct  96   NVNVCAPQSDKSVAGHSLTLKETIAVTPTDIHGATAYEVSGTPVDCVSLALSGALFSWSK  155

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  156  PVLVISGINRGS  167



>ref|XP_003531609.1| PREDICTED: uncharacterized protein LOC100776267 [Glycine max]
 gb|KHN11272.1| 5'-nucleotidase surE [Glycine soja]
Length=380

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            ++V VC P S++SA  HS+T    V    V+I+GATAF V+GTP DC SL +S ALFS S
Sbjct  84   YDVHVCVPQSDKSASGHSVTRGETVEACSVQINGATAFEVSGTPVDCVSLALSGALFSWS  143

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  144  KPVLVISGINQGS  156



>ref|XP_004235585.1| PREDICTED: uncharacterized protein LOC101263094 isoform X1 [Solanum 
lycopersicum]
Length=392

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS+T +  + V   +I GATA+ V+GTP DC SL +S ALFS S 
Sbjct  96   NVNVCAPQSDKSVAGHSLTLKETIAVTPTDIHGATAYEVSGTPVDCVSLALSGALFSWSK  155

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  156  PVLVISGINRGS  167



>ref|XP_009588878.1| PREDICTED: uncharacterized protein LOC104086340 [Nicotiana tomentosiformis]
Length=381

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS T +  + V   EI GA A+ V+GTP DC SL +S ALFS S 
Sbjct  85   NVHVCAPQSDKSTAGHSFTLKETIAVTSAEIHGAIAYEVSGTPVDCVSLALSGALFSWSK  144

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  145  PMLVISGINKGS  156



>ref|XP_002888898.1| hypothetical protein ARALYDRAFT_476423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65157.1| hypothetical protein ARALYDRAFT_476423 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++SA +HS T    + V  V I GATAF V+GT  DC SLG+S ALF+ S
Sbjct  89   YNVHVCAPQTDKSASAHSTTPGETIAVSSVSIKGATAFEVSGTSVDCISLGLSGALFAWS  148

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  149  KPLLVISGINQGSS  162



>ref|XP_009795881.1| PREDICTED: uncharacterized protein LOC104242507 [Nicotiana sylvestris]
Length=390

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS+T +  V V   ++ GATA+ V+GTP DC SL +S ALFS S 
Sbjct  94   NVNVCAPQSDKSVAGHSVTLKETVAVTPTDVHGATAYEVSGTPVDCVSLALSGALFSWSK  153

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  154  PVLVISGINRGS  165



>emb|CBI27894.3| unnamed protein product [Vitis vinifera]
Length=663

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            RF+V VCAP S++S   HS+T +  +     EI GATA+ V+GTPADC SL +S ALFS 
Sbjct  69   RFHVHVCAPQSDKSVSGHSMTVQETLTACSAEIGGATAYEVSGTPADCVSLALSGALFSW  128

Query  254  SVPDLVISGINMGS  295
            S P LVI GIN GS
Sbjct  129  SKPVLVICGINKGS  142



>ref|NP_001151071.1| acid phosphatase [Zea mays]
 gb|ACF87720.1| unknown [Zea mays]
 gb|ACG41512.1| acid phosphatase [Zea mays]
 gb|ACN26330.1| unknown [Zea mays]
 gb|ACN26532.1| unknown [Zea mays]
 gb|AFW83717.1| acid phosphatase [Zea mays]
Length=418

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  HSIT R  +    V+ +GA AF  +GTP DC SL +S  LF  
Sbjct  95   RCDVHVCAPESDKQACGHSITIRETIAASSVDFTGAKAFETSGTPVDCVSLALSGRLFPW  154

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN GSN
Sbjct  155  SSPALVISGINTGSN  169



>ref|XP_009412229.1| PREDICTED: uncharacterized protein LOC103993772 [Musa acuminata 
subsp. malaccensis]
Length=379

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+ + GL  LV  LV   + +V VCAPDS++S   HSIT    V     ++ G
Sbjct  47   VLVTNADGIGSHGLTFLVEALVREEQCDVHVCAPDSDKSVSGHSITLHQTVSATSADLKG  106

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF V+G+ ADC SL +S +LFS S P LVISG+N GSN
Sbjct  107  ATAFEVSGSAADCVSLALSGSLFSWSKPTLVISGVNKGSN  146



>ref|WP_026882691.1| stationary phase survival protein SurE [Clostridium akagii]
Length=252

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISG--ATAFSVAGTPADCASLGISKALFSSV  259
            V + APD ++SA  HSIT  H + VK++EI G  + A+SV+GTPADC  +G+ K   S  
Sbjct  29   VIIVAPDDQRSACGHSITLGHPLVVKKIEIIGIRSKAYSVSGTPADCVRIGVLKLFHSEG  88

Query  260  PDLVISGINMGSN  298
             D++ISGIN G N
Sbjct  89   TDIIISGINRGVN  101



>ref|XP_011072533.1| PREDICTED: uncharacterized protein LOC105157763 [Sesamum indicum]
Length=388

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV V AP S++S   HS++ +  V V  VE+ GATA+ ++GTP DC SL +S ALF+ S
Sbjct  91   YNVHVLAPQSDKSTSGHSLSLKETVEVASVEVKGATAYEISGTPVDCVSLALSGALFAWS  150

Query  257  VPDLVISGINMGS  295
             P LV+SGIN GS
Sbjct  151  KPLLVLSGINKGS  163



>gb|EYU21362.1| hypothetical protein MIMGU_mgv1a018727mg, partial [Erythranthe 
guttata]
Length=227

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV V  P S++S   HS++ +  V V  VEI+GA A+ ++GTP DC SL +S ALFS S
Sbjct  69   YNVHVIVPQSDKSTSGHSVSLKETVEVASVEINGAVAYEISGTPVDCVSLALSGALFSWS  128

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  129  KPLLVISGINKGS  141



>ref|XP_009127958.1| PREDICTED: uncharacterized protein LOC103852812 [Brassica rapa]
Length=381

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            V+VTN DG+D++GL  LV  LVS   +NV VCAP +++S  SHS+T    +     +I G
Sbjct  59   VLVTNGDGIDSIGLVSLVEALVSEGLYNVHVCAPQTDKSVSSHSMTPGETIAASSADIKG  118

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGSN  298
            ATAF V+GT  DC SLG+S ALF+ S P LVISGIN GS+
Sbjct  119  ATAFEVSGTTVDCISLGLSGALFAWSKPILVISGINQGSS  158



>ref|XP_010540078.1| PREDICTED: uncharacterized protein LOC104813948 [Tarenaya hassleriana]
Length=389

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++S+  HS+T    + V   ++ GATAF V+GTP DC SL +S ALFS S
Sbjct  95   YNVHVCAPQTDRSSSGHSMTPGETIAVSSADMEGATAFEVSGTPVDCISLALSGALFSWS  154

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  155  KPILVISGINRGS  167



>gb|KHN39314.1| 5'-nucleotidase surE [Glycine soja]
Length=363

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +V VC P S++SA +HS+T    V    V+I+GATAF V+GTP DC SL +S ALFS S 
Sbjct  68   DVHVCVPQSDKSASAHSVTRGETVEACSVQINGATAFEVSGTPVDCVSLALSGALFSWSK  127

Query  260  PDLVISGINMGSN  298
            P LVISGIN GS+
Sbjct  128  PMLVISGINRGSS  140



>gb|EAZ13283.1| hypothetical protein OsJ_03208 [Oryza sativa Japonica Group]
Length=447

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
             R +V VCAP+S++ A  +SIT R  +    V+  GA AF ++GTP DC SL +S  LFS
Sbjct  92   GRCDVHVCAPESDKPACGYSITIRETITATSVDFKGAKAFEISGTPVDCVSLALSGRLFS  151

Query  254  -SVPDLVISGINMGSN  298
             S P LVISGIN G+N
Sbjct  152  WSAPALVISGINAGAN  167



>gb|ACN28052.1| unknown [Zea mays]
 tpg|DAA57906.1| TPA: hypothetical protein ZEAMMB73_590171 [Zea mays]
Length=185

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  91   RCDVHVCAPESDKPACGYSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  150

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  151  SSPALVISGINTGPN  165



>ref|NP_001044033.1| Os01g0709400 [Oryza sativa Japonica Group]
 dbj|BAF05947.1| Os01g0709400 [Oryza sativa Japonica Group]
 dbj|BAH00270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=418

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
             R +V VCAP+S++ A  +SIT R  +    V+  GA AF ++GTP DC SL +S  LFS
Sbjct  92   GRCDVHVCAPESDKPACGYSITIRETITATSVDFKGAKAFEISGTPVDCVSLALSGRLFS  151

Query  254  -SVPDLVISGINMGSN  298
             S P LVISGIN G+N
Sbjct  152  WSAPALVISGINAGAN  167



>ref|XP_006342968.1| PREDICTED: uncharacterized protein LOC102583687 [Solanum tuberosum]
Length=392

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            NV VCAP S++S   HS T +  + V   +I GATA+ V+GTP DC SL +S ALFS + 
Sbjct  96   NVNVCAPQSDKSVAGHSFTLKETIAVTPTDIHGATAYEVSGTPVDCVSLALSGALFSWTK  155

Query  260  PDLVISGINMGS  295
            P LVISGIN GS
Sbjct  156  PVLVISGINRGS  167



>gb|EAY75560.1| hypothetical protein OsI_03464 [Oryza sativa Indica Group]
Length=447

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+  GA AF ++GTP DC SL +S  LFS 
Sbjct  93   RCDVHVCAPESDKPACGYSITIRETITATSVDFKGAKAFEISGTPVDCVSLALSGRLFSW  152

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G+N
Sbjct  153  SAPALVISGINAGAN  167



>emb|CDX82123.1| BnaC02g21670D [Brassica napus]
Length=364

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP +++S  SHS+T    +     +I GATAF V+GT  DC SLG+S ALF+ S
Sbjct  68   YNVHVCAPQTDKSVSSHSMTPGETIAASSADIKGATAFEVSGTTVDCISLGLSGALFAWS  127

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  128  KPILVISGINQGSS  141



>gb|AHM56559.1| 5'-nucleotidase SurE [Eubacterium acidaminophilum DSM 3953]
Length=254

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISGAT---AFSVAGTPADCASLGISKALFSS  256
            V+V APDSE+SAV H+IT  + + +K++   G     A++V+GTPADC  LGI   L   
Sbjct  29   VYVVAPDSEKSAVGHAITMHNPLKIKKINFHGIDSIDAYAVSGTPADCVKLGIEALLRDI  88

Query  257  VPDLVISGINMGSN  298
              DLV+SGIN GSN
Sbjct  89   EIDLVLSGINNGSN  102



>ref|XP_002456236.1| hypothetical protein SORBIDRAFT_03g032610 [Sorghum bicolor]
 gb|EES01356.1| hypothetical protein SORBIDRAFT_03g032610 [Sorghum bicolor]
Length=408

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            ++ R +V VCAP+S++ A  HSIT R  +    V+ +GA AF ++GTP DC SL +S  L
Sbjct  85   ASGRCDVHVCAPESDKPACGHSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRL  144

Query  248  FS-SVPDLVISGINMGSN  298
            F  S P LVISGIN G N
Sbjct  145  FPWSSPALVISGINTGLN  162



>ref|XP_004969715.1| PREDICTED: uncharacterized protein LOC101780960 [Setaria italica]
Length=421

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  HS+T R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  96   RCDVHVCAPESDKPACGHSVTIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  155

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  156  SAPALVISGINAGPN  170



>ref|XP_010537568.1| PREDICTED: uncharacterized protein LOC104812224 [Tarenaya hassleriana]
Length=392

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            ++V VCAP +++SA  HS+T    + V    I GATAF V+GTP DC SL +S ALFS S
Sbjct  96   YSVHVCAPQTDKSASGHSMTPGETIAVSSAHIEGATAFEVSGTPVDCISLALSGALFSWS  155

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  156  NPILVISGINRGS  168



>gb|KHG18100.1| 5'-nucleotidase surE [Gossypium arboreum]
Length=376

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            +NV VCAP S++SA  HS+T    + V + +I GATA+ V GT  DC SL +S ALFS +
Sbjct  86   YNVNVCAPHSDKSASGHSLTVLETITVTQAKIEGATAYEVTGTTVDCVSLALSGALFSWT  145

Query  257  VPDLVISGINMGS  295
             P LVISGIN GS
Sbjct  146  KPLLVISGINRGS  158



>ref|WP_013257275.1| stationary phase survival protein SurE [Desulfarculus baarsii]
 ref|YP_003806413.1| stationary-phase survival protein SurE [Desulfarculus baarsii 
DSM 2075]
 gb|ADK83819.1| stationary-phase survival protein SurE [Desulfarculus baarsii 
DSM 2075]
Length=266

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEI-SGATAFSVAGTPADCASLGISKALF  250
             R  VFV AP++EQSAV HSIT    + V+ +   +G   F+VAGTPADC  L + + L 
Sbjct  25   QRHEVFVVAPETEQSAVGHSITLADPIKVRPLSAKTGMNGFAVAGTPADCVKLAMGQ-LM  83

Query  251  SSVPDLVISGINMGSN  298
               PDLV+SGIN G+N
Sbjct  84   PQPPDLVVSGINQGAN  99



>ref|WP_022663719.1| nucleotidase [Desulfospira joergensenii]
Length=251

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +2

Query  71   TNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEI-SGATAFSVAGTPADCASLGISKAL  247
            T    V + APD+E+SAVSH IT    + +K+V++ S    ++V GTPADC  LG+ + +
Sbjct  24   TEDHEVVLIAPDTEKSAVSHGITLNSPLRIKKVDLESSGKGYAVTGTPADCVKLGLFE-I  82

Query  248  FSSVPDLVISGINMGSN  298
            F + PDLVISGIN G N
Sbjct  83   FETPPDLVISGINAGGN  99



>ref|XP_011080073.1| PREDICTED: uncharacterized protein LOC105163426 isoform X2 [Sesamum 
indicum]
Length=388

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTN DG+++ GL  LV  LVS   +NV V AP S++SA  HS++ +  V V   +I+G
Sbjct  65   ILVTNSDGIESPGLSYLVNALVSEGVYNVNVIAPQSDKSAAGHSVSLKETVEVVTADING  124

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
            A A+ ++GTP DC SL +S ALFS S P LV+SGIN GS
Sbjct  125  AVAYEISGTPVDCVSLALSGALFSCSKPLLVLSGINKGS  163



>ref|XP_006646255.1| PREDICTED: uncharacterized protein LOC102713705, partial [Oryza 
brachyantha]
Length=336

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ +  HSIT    +    V+ +GA AF ++GTP DC SL +S  LFS 
Sbjct  11   RCDVHVCAPESDKPSCGHSITIHETIAATSVDFTGAKAFEISGTPVDCVSLALSGRLFSF  70

Query  254  SVPDLVISGINMGSN  298
            + P LVISGIN G N
Sbjct  71   TAPALVISGINAGPN  85



>ref|XP_007138715.1| hypothetical protein PHAVU_009G231200g [Phaseolus vulgaris]
 gb|ESW10709.1| hypothetical protein PHAVU_009G231200g [Phaseolus vulgaris]
Length=372

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
             +V+VCAP S++S   HS+T    + V   ++SGA A+ V+GTPADC SL +S ALF  S
Sbjct  75   LDVYVCAPQSDRSVCGHSVTTGETLAVCSAQVSGANAYEVSGTPADCVSLALSGALFCWS  134

Query  257  VPDLVISGINMGS  295
             P LVISG+N G+
Sbjct  135  KPVLVISGLNKGA  147



>ref|XP_003533765.1| PREDICTED: uncharacterized protein LOC100785738 isoform X1 [Glycine 
max]
 gb|KHN35858.1| 5'-nucleotidase surE [Glycine soja]
Length=373

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
             +V VCAP++++S   HS+T    + V  V++ GA A+ V+GTPADC SL +S ALFS S
Sbjct  76   LDVHVCAPETDRSVCGHSVTTGETLAVCSVQVGGANAYQVSGTPADCVSLALSGALFSWS  135

Query  257  VPDLVISGINMGS  295
             P LVISG+N G+
Sbjct  136  KPVLVISGLNKGT  148



>ref|XP_011080065.1| PREDICTED: uncharacterized protein LOC105163426 isoform X1 [Sesamum 
indicum]
Length=424

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    VMVTNddgvdalglrvlvrvlvSTNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG  181
            ++VTN DG+++ GL  LV  LVS   +NV V AP S++SA  HS++ +  V V   +I+G
Sbjct  65   ILVTNSDGIESPGLSYLVNALVSEGVYNVNVIAPQSDKSAAGHSVSLKETVEVVTADING  124

Query  182  ATAFSVAGTPADCASLGISKALFS-SVPDLVISGINMGS  295
            A A+ ++GTP DC SL +S ALFS S P LV+SGIN GS
Sbjct  125  AVAYEISGTPVDCVSLALSGALFSCSKPLLVLSGINKGS  163



>ref|XP_008672803.1| PREDICTED: acid phosphatase isoform X4 [Zea mays]
 ref|XP_008672804.1| PREDICTED: acid phosphatase isoform X4 [Zea mays]
 gb|ACN28832.1| unknown [Zea mays]
 tpg|DAA57907.1| TPA: hypothetical protein ZEAMMB73_590171 [Zea mays]
Length=404

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  91   RCDVHVCAPESDKPACGYSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  150

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  151  SSPALVISGINTGPN  165



>ref|WP_012531116.1| stationary phase survival protein SurE [Geobacter bemidjiensis]
 ref|YP_002139487.1| stationary phase survival protein SurE [Geobacter bemidjiensis 
Bem]
 sp|B5EHF5.1|SURE_GEOBB RecName: Full=5'-nucleotidase SurE; AltName: Full=Nucleoside 
5'-monophosphate phosphohydrolase [Geobacter bemidjiensis Bem]
 gb|ACH39691.1| nucleoside 3'/5'-monophosphate phosphatase and short-chain exopolyphosphatase 
SurE [Geobacter bemidjiensis Bem]
Length=248

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 4/66 (6%)
 Frame = +2

Query  101  PDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSVPDLVISG  280
            PD EQSAVSH++T  H +   R+   GA  FSV GTP DC +LGI  +L S  PDLVISG
Sbjct  34   PDREQSAVSHALTLHHPLRAARI---GANVFSVEGTPTDCVNLGI-HSLLSYRPDLVISG  89

Query  281  INMGSN  298
            +N G+N
Sbjct  90   VNRGAN  95



>gb|AIS52432.1| 5'-nucleotidase SurE [Thermoanaerobacter kivui]
Length=252

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRV-EISGATAFSVAGTPADCASLGISKALF  250
            N+++V V AP+ E+SAVSH+IT    + +K+V E +    ++V GTP+DC  LGI + + 
Sbjct  25   NKYHVIVVAPERERSAVSHAITLHKPLRLKKVKEENNLKIYAVNGTPSDCVKLGI-EVVL  83

Query  251  SSVPDLVISGINMGSN  298
               PDLVISGIN G N
Sbjct  84   GQKPDLVISGINEGLN  99



>ref|WP_026840538.1| stationary phase survival protein SurE [Geobacter bremensis]
Length=248

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 4/66 (6%)
 Frame = +2

Query  101  PDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSVPDLVISG  280
            PD EQSAVSH++T  H +   R+   GA  FSV GTP DC +LGI  +L S  PDLVISG
Sbjct  34   PDREQSAVSHALTLHHPLRAARI---GANVFSVEGTPTDCVNLGI-HSLLSYSPDLVISG  89

Query  281  INMGSN  298
            +N G+N
Sbjct  90   VNRGAN  95



>ref|WP_024334057.1| nucleotidase [Desulfotignum balticum]
Length=250

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATA--FSVAGTPADCASLGISKAL  247
             +  V + APD E+SAVSHSIT  H V + R+E SG     ++V GTPADC  LG+++  
Sbjct  25   QKHQVVMVAPDRERSAVSHSITLHHPVRMHRIE-SGRQKKIYAVDGTPADCVKLGLAEC-  82

Query  248  FSSVPDLVISGINMGSN  298
            F + PD VI+GIN GSN
Sbjct  83   FKTPPDWVIAGINPGSN  99



>ref|NP_001147148.1| acid phosphatase [Zea mays]
 ref|XP_008672805.1| PREDICTED: acid phosphatase isoform X1 [Zea mays]
 gb|ACG25696.1| acid phosphatase [Zea mays]
 gb|ACN25871.1| unknown [Zea mays]
 tpg|DAA57909.1| TPA: acid phosphatase [Zea mays]
Length=401

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  91   RCDVHVCAPESDKPACGYSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  150

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  151  SSPALVISGINTGPN  165



>ref|WP_012648406.1| stationary phase survival protein SurE [Geobacter daltonii]
 ref|YP_002538779.1| stationary phase survival protein SurE [Geobacter daltonii FRC-32]
 sp|B9M4Z4.1|SURE_GEODF RecName: Full=5'-nucleotidase SurE; AltName: Full=Nucleoside 
5'-monophosphate phosphohydrolase [Geobacter daltonii FRC-32]
 gb|ACM21678.1| nucleoside-3'/5'-monophosphate phosphatase and short-chain exopolyphosphatase 
SurE [Geobacter daltonii FRC-32]
Length=248

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSVP  262
             VFV APD EQSAV H++T  H +   ++   G   F+V GTP DC +LGI  +L S  P
Sbjct  28   QVFVIAPDREQSAVGHALTLHHPLRANKI---GENIFAVDGTPTDCVNLGI-HSLLSFKP  83

Query  263  DLVISGINMGSN  298
            D+V+SGIN G+N
Sbjct  84   DIVVSGINRGAN  95



>ref|WP_006965847.1| stationary-phase survival protein SurE [Desulfotignum phosphitoxidans]
 gb|EMS79604.1| stationary-phase survival protein SurE [Desulfotignum phosphitoxidans 
DSM 13687]
Length=250

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATA--FSVAGTPADCASLGISKAL  247
             +  V + APD E+SAVSHSIT  H V + R+E SG     ++V GTPADC  LG+++  
Sbjct  25   QKHQVVMVAPDRERSAVSHSITLHHPVRMHRIE-SGRQKKIYAVDGTPADCVKLGLAEC-  82

Query  248  FSSVPDLVISGINMGSN  298
            F + PD VI+GIN GSN
Sbjct  83   FKTPPDWVIAGINPGSN  99



>ref|WP_013278508.1| stationary phase survival protein SurE [Acetohalobium arabaticum]
 ref|YP_003828128.1| 5'-nucleotidase [Acetohalobium arabaticum DSM 5501]
 gb|ADL13063.1| 5'-nucleotidase ;exopolyphosphatase ;3'-nucleotidase [Acetohalobium 
arabaticum DSM 5501]
Length=256

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVA--GTPADCASLGISKALFSSV  259
            V V APD EQSA  H+IT    + VK V    A A S+A  GTPADC  LGI +A+    
Sbjct  31   VLVVAPDREQSATGHAITLHRPLRVKEVNYDSADAESLAVNGTPADCVKLGI-EAILEEK  89

Query  260  PDLVISGINMGSN  298
            PD+VISGIN G N
Sbjct  90   PDIVISGINRGPN  102



>ref|XP_008672799.1| PREDICTED: acid phosphatase isoform X2 [Zea mays]
 ref|XP_008672800.1| PREDICTED: acid phosphatase isoform X2 [Zea mays]
 ref|XP_008672801.1| PREDICTED: acid phosphatase isoform X2 [Zea mays]
Length=428

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  91   RCDVHVCAPESDKPACGYSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  150

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  151  SSPALVISGINTGPN  165



>emb|CDM83776.1| unnamed protein product [Triticum aestivum]
 emb|CDM83810.1| unnamed protein product [Triticum aestivum]
Length=393

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++    HSIT R  V    V  +GA AF ++GTP D  SL +S  LFS 
Sbjct  88   RCDVHVCAPESDKPVCGHSITIRETVSATSVHFTGAKAFEISGTPVDSISLALSGRLFSW  147

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN GSN
Sbjct  148  SAPALVISGINTGSN  162



>ref|XP_002521387.1| acid phosphatase, putative [Ricinus communis]
 gb|EEF41055.1| acid phosphatase, putative [Ricinus communis]
Length=398

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSV  259
            +NV VCAP S++S   HS+T +  + V  VE++GATAF VAGTP DC SL +S ALFS  
Sbjct  92   YNVHVCAPQSDKSVSGHSVTLQETISVNSVEMNGATAFEVAGTPVDCVSLALSGALFSWS  151

Query  260  PDLVISGINM  289
              L++S  NM
Sbjct  152  KPLLVS-FNM  160



>ref|XP_008672802.1| PREDICTED: acid phosphatase isoform X3 [Zea mays]
 tpg|DAA57908.1| TPA: hypothetical protein ZEAMMB73_590171 [Zea mays]
Length=425

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++ A  +SIT R  +    V+ +GA AF ++GTP DC SL +S  LF  
Sbjct  91   RCDVHVCAPESDKPACGYSITIRETITATSVDFTGAKAFEISGTPVDCVSLALSGRLFPW  150

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  151  SSPALVISGINTGPN  165



>ref|XP_003529777.1| PREDICTED: uncharacterized protein LOC100814744 [Glycine max]
Length=363

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-SV  259
            +V VC P S++SA +HS+T    V     +I+GATAF V+GTP DC SL +S ALFS S 
Sbjct  68   DVHVCVPQSDKSASAHSVTRGVTVEAFSAQINGATAFEVSGTPVDCVSLALSGALFSWSK  127

Query  260  PDLVISGINMGSN  298
            P LVISGIN GS+
Sbjct  128  PMLVISGINRGSS  140



>ref|XP_007135537.1| hypothetical protein PHAVU_010G137700g [Phaseolus vulgaris]
 gb|ESW07531.1| hypothetical protein PHAVU_010G137700g [Phaseolus vulgaris]
Length=388

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-S  256
            ++V VC P S++S   HS+T    V      I GATAF V+GTP DC SL +S ALFS S
Sbjct  92   YDVHVCVPQSDKSVSGHSLTLGETVEASSALIDGATAFEVSGTPVDCISLALSGALFSWS  151

Query  257  VPDLVISGINMGSN  298
             P LVISGIN GS+
Sbjct  152  KPVLVISGINRGSS  165



>ref|WP_013175383.1| stationary phase survival protein SurE [Syntrophothermus lipocalidus]
 ref|YP_003702546.1| stationary-phase survival protein SurE [Syntrophothermus lipocalidus 
DSM 12680]
 gb|ADI01981.1| stationary-phase survival protein SurE [Syntrophothermus lipocalidus 
DSM 12680]
Length=258

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFS--VAGTPADCASLGISKALFSS  256
             V+V APD E+S   HSIT    +  +RVE+ G++A +  + GTPADC  LGIS AL   
Sbjct  28   EVYVVAPDRERSGTGHSITVFSPIKAQRVEVPGSSALAWVIDGTPADCVKLGIS-ALIPK  86

Query  257  VPDLVISGINMGSN  298
             PD V+SG+N G+N
Sbjct  87   TPDYVVSGVNRGAN  100



>ref|WP_035422548.1| MULTISPECIES: stationary phase survival protein SurE [unclassified 
Atribacteria]
Length=257

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISGAT-AFSVAGTPADCASLGISKALFSSVP  262
            V V APD E+S + H+IT R  + +++V+I+G    FS+ GTPADC  +G+ + +    P
Sbjct  30   VMVIAPDRERSTIGHAITLRKPLRIRKVKINGNFWGFSLDGTPADCVIIGLLEIMKDEKP  89

Query  263  DLVISGINMGSN  298
            DL++SGIN G N
Sbjct  90   DLIVSGINRGPN  101



>ref|WP_011939473.1| stationary phase survival protein SurE [Geobacter uraniireducens]
 ref|YP_001231369.1| stationary phase survival protein SurE [Geobacter uraniireducens 
Rf4]
 sp|A5G4S8.1|SURE_GEOUR RecName: Full=5'-nucleotidase SurE; AltName: Full=Nucleoside 
5'-monophosphate phosphohydrolase [Geobacter uraniireducens 
Rf4]
 gb|ABQ26796.1| 5'-nucleotidase / 3'-nucleotidase [Geobacter uraniireducens Rf4]
Length=248

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSVPD  265
            V+V APD EQSAV H++T  H +   R+E      F+V GTP DC +LGI  +L S  PD
Sbjct  29   VYVVAPDREQSAVGHALTLHHPLRATRIE---NNIFAVDGTPTDCVNLGI-HSLLSFKPD  84

Query  266  LVISGINMGSN  298
            +V+SGIN G N
Sbjct  85   IVVSGINRGGN  95



>ref|WP_018205883.1| hypothetical protein [Atribacteria bacterium SCGC AB-164-P05]
Length=256

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  86   VFVCAPDSEQSAVSHSITWRHAVPVKRVEISGAT-AFSVAGTPADCASLGISKALFSSVP  262
            V V APD E+S + H+IT R  + +++V+I+G    FS+ GTPADC  +G+ + +    P
Sbjct  29   VMVIAPDRERSTIGHAITLRKPLRIRKVKINGNFWGFSLDGTPADCVIIGLLEIMKDEKP  88

Query  263  DLVISGINMGSN  298
            DL++SGIN G N
Sbjct  89   DLIVSGINRGPN  100



>ref|XP_007012796.1| Survival protein SurE-like phosphatase/nucleotidase isoform 3 
[Theobroma cacao]
 gb|EOY30415.1| Survival protein SurE-like phosphatase/nucleotidase isoform 3 
[Theobroma cacao]
Length=327

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            S  RF++ VCAP S++S   HS+T R  V V  VE++GATAF V+GTP DC SL +S AL
Sbjct  88   SDGRFSLHVCAPQSDKSVAGHSVTVRETVAVCSVEMNGATAFEVSGTPVDCVSLALSGAL  147

Query  248  FS  253
            FS
Sbjct  148  FS  149



>ref|WP_003446796.1| stationary phase survival protein SurE [Clostridium pasteurianum]
 gb|ELP58343.1| stationary phase survival protein SurE [Clostridium pasteurianum 
DSM 525 = ATCC 6013]
 gb|KER12958.1| Survival protein SurE-like phosphatase/nucleotidase [Clostridium 
pasteurianum DSM 525 = ATCC 6013]
 gb|AJA49323.1| 5'-nucleotidase SurE [Clostridium pasteurianum DSM 525 = ATCC 
6013]
 gb|AJA53311.1| 5'-nucleotidase SurE [Clostridium pasteurianum DSM 525 = ATCC 
6013]
Length=251

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG--ATAFSVAGTPADCASLGISKALFS  253
            + + + APDSE+SA  HSIT    + VK+V++ G  + A+SV GTPADC  +G+ K +  
Sbjct  27   YEITIVAPDSEKSACGHSITISRPLLVKKVKLEGINSNAYSVTGTPADCVRIGMVKLVEK  86

Query  254  SVPDLVISGINMGSN  298
             + D+V+SGIN+G+N
Sbjct  87   DI-DMVVSGINIGAN  100



>ref|WP_038268174.1| hypothetical protein [[Clostridium] litorale]
 gb|KDR94192.1| 5'-nucleotidase SurE [ [[Clostridium] litorale DSM 5388]
Length=257

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG---ATAFSVAGTPADCASLGISKALFS  253
            NVFV APDSE+SA+ H+IT    +  + +   G     A++V GTPADC  LGI   L  
Sbjct  28   NVFVVAPDSEKSAIGHAITMHTPLKAREMNFHGLDSVKAYAVNGTPADCVKLGIEAILKD  87

Query  254  SVPDLVISGINMGSN  298
               D+VISGIN GSN
Sbjct  88   VNIDIVISGINNGSN  102



>ref|WP_003870656.1| MULTISPECIES: stationary phase survival protein SurE [Thermoanaerobacter]
 gb|EGD51317.1| stationary-phase survival protein SurE [Thermoanaerobacter ethanolicus 
JW 200]
 gb|EIW01202.1| 5''/3''-nucleotidase SurE [Thermoanaerobacter siderophilus SR4]
 gb|EMT40285.1| 5''/3''-nucleotidase SurE [Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=252

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRV-EISGATAFSVAGTPADCASLGISKALF  250
            +++ V V AP+ E+SA+SH+IT    + +K+V E  G   ++V GTP+DC  LGI   + 
Sbjct  25   DKYKVTVVAPEKERSAISHAITLHKPLRLKKVKEEDGLKIYAVNGTPSDCVKLGIE-VVL  83

Query  251  SSVPDLVISGINMGSN  298
               PD++ISGIN G N
Sbjct  84   EEKPDIIISGINEGLN  99



>ref|WP_004100941.1| stationary phase survival protein SurE [Thermosipho africanus]
 ref|YP_002334773.1| stationary phase survival protein SurE [Thermosipho africanus 
TCF52B]
 sp|B7IH68.1|SURE_THEAB RecName: Full=5'-nucleotidase SurE; AltName: Full=Nucleoside 
5'-monophosphate phosphohydrolase [Thermosipho africanus TCF52B]
 gb|ACJ75432.1| 5'/3'-nucleotidase SurE [Thermosipho africanus TCF52B]
 gb|EKF50090.1| stationary phase survival protein SurE [Thermosipho africanus 
H17ap60334]
Length=255

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +2

Query  71   TNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEI-SGATAFSVAGTPADCASLGISKAL  247
            + ++ V V AP++EQSAV H+IT R  + +++++I      +SV+GTPADC  +GI   L
Sbjct  24   SKKYKVTVVAPETEQSAVGHAITLRLPLWLRKLDINENFEIYSVSGTPADCVKMGIDVVL  83

Query  248  FSSVPDLVISGINMGSN  298
                PDL+ISGIN G+N
Sbjct  84   -GEKPDLLISGINRGNN  99



>gb|KGX86740.1| stationary phase survival protein SurE [Pontibacillus litoralis 
JSM 072002]
Length=271

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEI--SGATAFSVAGTPADCASLGISKALFSS  256
            +V+V  PD E+SA SHSIT RH +  ++V    +G  A+SV GT ADC  L +  AL   
Sbjct  28   DVYVVCPDQERSAASHSITLRHPIKAEKVHWFGTGVQAWSVNGTTADCVKLALD-ALLDD  86

Query  257  VPDLVISGINMGSN  298
             PD VISGIN+G N
Sbjct  87   KPDYVISGINIGPN  100



>ref|WP_036834241.1| stationary phase survival protein SurE, partial [Pontibacillus 
litoralis]
Length=255

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVEI--SGATAFSVAGTPADCASLGISKALFSS  256
            +V+V  PD E+SA SHSIT RH +  ++V    +G  A+SV GT ADC  L +  AL   
Sbjct  28   DVYVVCPDQERSAASHSITLRHPIKAEKVHWFGTGVQAWSVNGTTADCVKLALD-ALLDD  86

Query  257  VPDLVISGINMGSN  298
             PD VISGIN+G N
Sbjct  87   KPDYVISGINIGPN  100



>ref|XP_007012794.1| Acid phosphatase, putative isoform 1 [Theobroma cacao]
 gb|EOY30413.1| Acid phosphatase, putative isoform 1 [Theobroma cacao]
Length=389

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            S  RF++ VCAP S++S   HS+T R  V V  VE++GATAF V+GTP DC SL +S AL
Sbjct  88   SDGRFSLHVCAPQSDKSVAGHSVTVRETVAVCSVEMNGATAFEVSGTPVDCVSLALSGAL  147

Query  248  FS  253
            FS
Sbjct  148  FS  149



>ref|WP_036732936.1| 5'-nucleotidase [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFD42381.1| 5'-nucleotidase [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI36267.1| 5'-nucleotidase [Peptococcaceae bacterium SCADC1_2_3]
Length=250

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFSSV  259
              ++V APD E+SA  H IT    + VK V+IS    ++V GTPADC  L I +AL    
Sbjct  29   IELYVAAPDRERSAAGHGITVHRPLRVKTVDISFGQEWAVDGTPADCVKLAI-EALLPEP  87

Query  260  PDLVISGINMGSN  298
            PDLVI+GIN G N
Sbjct  88   PDLVITGINQGPN  100



>ref|WP_022772160.1| 5'-nucleotidase [Butyrivibrio sp. AE2015]
Length=239

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRVE--ISGATAFSVAGTPADCASLGISKALFSS  256
             V+V APD ++SA SHSIT RH + V   +  + G  A+S +GTPADC  +G S ++   
Sbjct  30   EVYVIAPDDQRSAASHSITLRHGIDVYPYDFPVEGVKAYSCSGTPADCVRVG-SLSVMPK  88

Query  257  VPDLVISGINMGSN  298
             PD+V+SGIN G N
Sbjct  89   KPDIVMSGINFGYN  102



>ref|WP_013756591.1| multifunctional protein surE [Thermodesulfobium narugense]
 ref|YP_004438001.1| multifunctional protein surE [Thermodesulfobium narugense DSM 
14796]
 gb|AEE14870.1| Multifunctional protein surE [Thermodesulfobium narugense DSM 
14796]
Length=251

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +2

Query  71   TNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGAT-AFSVAGTPADCASLGISKAL  247
            + R  ++V AP+ E+SA SHS+T    +  K VEI GA  A+   GTP+DC  L +  AL
Sbjct  24   SKRHEIYVVAPERERSAASHSLTLHKPLRAKEVEIYGARGAWETNGTPSDCVKLAMY-AL  82

Query  248  FSSVPDLVISGINMGSN  298
                PDL+ISGIN G+N
Sbjct  83   LPRKPDLLISGINRGAN  99



>ref|XP_007012795.1| Acid phosphatase isoform 2, partial [Theobroma cacao]
 gb|EOY30414.1| Acid phosphatase isoform 2, partial [Theobroma cacao]
Length=349

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKAL  247
            S  RF++ VCAP S++S   HS+T R  V V  VE++GATAF V+GTP DC SL +S AL
Sbjct  88   SDGRFSLHVCAPQSDKSVAGHSVTVRETVAVCSVEMNGATAFEVSGTPVDCVSLALSGAL  147

Query  248  FS  253
            FS
Sbjct  148  FS  149



>ref|WP_027434485.1| hypothetical protein [Lachnospiraceae bacterium AB2028]
Length=238

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  68   STNRFNVFVCAPDSEQSAVSHSITWRHAVPV--KRVEISGATAFSVAGTPADCASLGISK  241
            + N   V+V APD ++SA+SHSIT    + V    ++I G TAF+  GTPADC ++G+ K
Sbjct  25   AVNYGEVYVVAPDGQRSAMSHSITCTKPIKVWEYDMQIEGVTAFACTGTPADCVNIGV-K  83

Query  242  ALFSSVPDLVISGINMGSN  298
             L    PD V SGIN G N
Sbjct  84   QLLPRTPDFVFSGINRGYN  102



>ref|WP_014455967.1| 5'/3'-nucleotidase SurE [Spirochaeta africana]
 ref|YP_005475691.1| 5'/3'-nucleotidase SurE [Spirochaeta africana DSM 8902]
 gb|AFG37984.1| 5'/3'-nucleotidase SurE [Spirochaeta africana DSM 8902]
Length=254

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS  253
            +  +V+V APD E+S +SHS++ R  +   RVE  G   F+V G+PADC  +GI+  +  
Sbjct  25   DHHDVWVIAPDGERSGMSHSLSLRDPI---RVERLGPQQFAVGGSPADCVIVGITGLMEG  81

Query  254  SVPDLVISGINMGSN  298
            S PD+V+SGIN+G N
Sbjct  82   SPPDVVLSGINLGPN  96



>ref|WP_005584758.1| 5'-nucleotidase SurE [Clostridium ultunense]
 emb|CCQ94848.1| 5'-nucleotidase SurE [Clostridium ultunense Esp]
Length=250

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISG--ATAFSVAGTPADCASLGISKALFS  253
            + + + AP+ ++SA S +IT   ++ VK VE+ G  + A+SV+GTPADC  +G+ K L  
Sbjct  27   YEIIIVAPEDQRSAQSQAITISKSLIVKEVELEGIKSKAYSVSGTPADCVRIGLDK-LIE  85

Query  254  SVPDLVISGINMGSN  298
               DLVISGINMG N
Sbjct  86   KPIDLVISGINMGLN  100



>gb|AGO87874.1| stationary phase survival protein SurE [uncultured bacterium 
FGYC_13M19]
Length=252

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  83   NVFVCAPDSEQSAVSHSITWRHAVPVKRV-EISGATAFSVAGTPADCASLGISKALFSSV  259
            NV V AP++E+SAV H+IT    + V+ +   +G   F+V GTPADC  +G+ +AL  + 
Sbjct  29   NVIVVAPNTEKSAVGHAITIADPIRVEPLNRTNGFQGFAVNGTPADCVKIGV-QALMDTK  87

Query  260  PDLVISGINMGSN  298
            PD+++SGINMGSN
Sbjct  88   PDIIVSGINMGSN  100



>ref|WP_015617057.1| 5'/3'-nucleotidase SurE [Clostridium pasteurianum]
 ref|YP_007942459.1| 5'/3'-nucleotidase SurE [Clostridium pasteurianum BC1]
 gb|AGK98782.1| 5'/3'-nucleotidase SurE [Clostridium pasteurianum BC1]
Length=251

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +2

Query  80   FNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGAT--AFSVAGTPADCASLGISKALFS  253
            + + V APDSE+SA  HSIT    + VKRV+I      A+SV GTPADC  +G+ K +  
Sbjct  27   YELTVVAPDSERSACGHSITISQPLTVKRVKIDDLKSPAYSVTGTPADCVRIGMVKLVDK  86

Query  254  SVPDLVISGINMGSN  298
             + D+V+SGIN+G+N
Sbjct  87   DI-DMVVSGINIGAN  100



>dbj|BAJ94333.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  77   RFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGATAFSVAGTPADCASLGISKALFS-  253
            R +V VCAP+S++    HSIT R  V    V  +GA AF ++GTP D  SL +S  LFS 
Sbjct  89   RCDVHVCAPESDKPVCGHSITIRETVSATSVHFAGAKAFEISGTPVDSVSLALSGRLFSW  148

Query  254  SVPDLVISGINMGSN  298
            S P LVISGIN G N
Sbjct  149  SAPALVISGINAGPN  163



>ref|WP_014451274.1| stationary phase survival protein SurE [Fervidobacterium pennivorans]
 ref|YP_005470941.1| 5'/3'-nucleotidase SurE [Fervidobacterium pennivorans DSM 9078]
 gb|AFG34822.1| 5'/3'-nucleotidase SurE [Fervidobacterium pennivorans DSM 9078]
Length=259

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +2

Query  71   TNRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEI-SGATAFSVAGTPADCASLGISKAL  247
            + + NV V AP+SEQSAV H+IT R  + V++++I      ++V+GTPADC  +G+    
Sbjct  24   SEKHNVVVVAPESEQSAVGHAITLRLPLWVRKLDIKENFEMYAVSGTPADCVKIGLDVVY  83

Query  248  FSS--VPDLVISGINMGSN  298
                 VPDLV+SGIN G N
Sbjct  84   KDKGIVPDLVVSGINRGEN  102



>ref|WP_041081957.1| stationary phase survival protein SurE [Thermotoga profunda]
Length=254

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +2

Query  74   NRFNVFVCAPDSEQSAVSHSITWRHAVPVKRVEISGA-TAFSVAGTPADCASLGISKALF  250
             + N+ V AP+SEQSA  H+IT R  + VK+VE+ G    ++  GTPADC  +G+ + L 
Sbjct  25   KKHNILVVAPESEQSATGHAITVRMPIWVKKVEVVGDFPIYATTGTPADCVKIGV-EVLA  83

Query  251  SSVPDLVISGINMGSN  298
                DLVISGIN G N
Sbjct  84   KKTVDLVISGINYGHN  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533915589554