BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13691_g2_i1 len=326 path=[352:0-325]

Length=326
                                                                      Score     E

emb|CAE53879.1|  putative aquaporin                                     182   3e-56   Ricinus communis
ref|XP_002519456.1|  tonoplast intrinsic protein, putative              184   1e-55   Ricinus communis
gb|ADO17795.1|  tonoplast intrinsic protein                             184   1e-55   
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg             184   2e-55   
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000          184   2e-55   
gb|KHN21988.1|  Aquaporin TIP1-3                                        184   2e-55   
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1               184   2e-55   
ref|NP_001242707.1|  uncharacterized protein LOC100777419               184   2e-55   
gb|KDP29188.1|  hypothetical protein JCGZ_16577                         183   3e-55   
ref|NP_001267923.1|  aquaporin-like                                     183   3e-55   
gb|AIK66517.1|  putative aquaporin                                      183   3e-55   
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                    183   3e-55   
emb|CAN74049.1|  hypothetical protein VITISV_007330                     183   3e-55   Vitis vinifera
gb|ADB93067.1|  aquaporin                                               183   3e-55   
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                        183   3e-55   
emb|CBI31728.3|  unnamed protein product                                183   4e-55   
gb|AAB51394.2|  tonoplast intrinsic protein bobTIP26-2                  181   4e-55   Brassica oleracea var. botrytis [cauliflower]
gb|KDP29873.1|  hypothetical protein JCGZ_18448                         183   5e-55   
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                   182   6e-55   
emb|CAE53881.1|  aquaporin                                              182   6e-55   Ricinus communis
gb|AAF78757.1|AF271660_1  putative aquaporin TIP3                       182   7e-55   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                        182   7e-55   
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3                182   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3                182   8e-55   Populus trichocarpa [western balsam poplar]
emb|CDY67380.1|  BnaAnng24130D                                          181   1e-54   
ref|XP_003606614.1|  Aquaporin TIP1-1                                   182   1e-54   
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                   182   1e-54   
gb|ACI95283.1|  tonoplast intrinsic protein                             181   2e-54   Sinapis arvensis [charlock mustard]
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                        181   2e-54   
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                        181   2e-54   
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                  181   2e-54   Brassica oleracea var. botrytis [cauliflower]
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg             181   2e-54   
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                  181   2e-54   Brassica oleracea var. botrytis [cauliflower]
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                  181   2e-54   Triticum aestivum [Canadian hard winter wheat]
ref|NP_181221.1|  aquaporin TIP1-1                                      181   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AJA04408.1|  tonoplast intrinsic protein                             181   3e-54   
gb|ACX37451.1|  tonoplast intrinsic protein                             181   3e-54   Hevea brasiliensis [Para rubber tree]
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                  181   3e-54   
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...    181   3e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CAA38633.1|  possible membrane channel protein                      181   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13047.1|  Putative aquaporin TIP1-1                               179   4e-54   
ref|XP_010096653.1|  Aquaporin TIP1-3                                   181   4e-54   
gb|ADE34286.1|  aquaporin TIP1;11                                       178   4e-54   
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1               180   4e-54   
ref|XP_002531118.1|  tonoplast intrinsic protein, putative              180   6e-54   Ricinus communis
ref|XP_010920700.1|  PREDICTED: probable aquaporin TIP1-2               180   6e-54   
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                   180   7e-54   
ref|NP_001284655.1|  aquaporin TIP1-1                                   180   7e-54   
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                        179   8e-54   
dbj|BAP33938.1|  aquaporin                                              180   8e-54   
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg             180   8e-54   
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                        179   9e-54   
gb|KHN32099.1|  Aquaporin TIP1-1                                        179   9e-54   
emb|CDY53270.1|  BnaCnng24720D                                          179   9e-54   
gb|AEV54104.1|  putative tonoplast intrinsic protein 1.6                178   1e-53   
emb|CAA56553.1|  gamma-TIP-like protein                                 179   1e-53   Hordeum vulgare [barley]
gb|KHN30200.1|  Aquaporin TIP1-3                                        179   1e-53   
ref|NP_001238026.1|  nodulin-26                                         179   1e-53   
dbj|BAA12711.1|  VM23                                                   179   1e-53   Raphanus sativus
gb|KDP44188.1|  hypothetical protein JCGZ_05655                         179   1e-53   
emb|CDX83623.1|  BnaC07g23630D                                          179   2e-53   
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                        179   2e-53   
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2                179   2e-53   
gb|ABK96489.1|  unknown                                                 179   2e-53   Populus trichocarpa x Populus deltoides
gb|ACP28878.1|  tonoplast intrinsic protein                             179   2e-53   Gossypium hirsutum [American cotton]
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                    178   3e-53   
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                        178   3e-53   
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                   178   3e-53   
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                   178   3e-53   
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                   178   3e-53   
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1               178   3e-53   
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                        178   3e-53   
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                   178   3e-53   
gb|KDP43963.1|  hypothetical protein JCGZ_05430                         178   4e-53   
ref|XP_008794805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    178   4e-53   
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg             178   4e-53   
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    178   4e-53   
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                   177   5e-53   
ref|XP_007132109.1|  hypothetical protein PHAVU_011G067200g             177   5e-53   
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg             177   5e-53   
gb|AFQ98316.1|  MIP6                                                    177   5e-53   
gb|AFH36344.1|  aquaporin TIP2;2                                        177   6e-53   
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                        177   6e-53   
ref|XP_006291577.1|  hypothetical protein CARUB_v10017730mg             179   8e-53   
ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                        177   8e-53   
gb|ACJ83265.1|  unknown                                                 176   1e-52   Medicago truncatula
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                        177   1e-52   
gb|AAT08702.1|  mitochondrial tonoplast intrinsic protein               176   1e-52   Hyacinthus orientalis [common hyacinth]
ref|NP_001274695.1|  aquaporin TIP1-3-like                              177   1e-52   
gb|AHL24705.1|  tonoplastic intrinsic protein                           173   1e-52   
emb|CDP08994.1|  unnamed protein product                                177   1e-52   
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                   177   1e-52   Brassica napus [oilseed rape]
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                        177   1e-52   
ref|XP_006350747.1|  PREDICTED: aquaporin TIP1-3-like                   177   1e-52   
gb|ABB76813.1|  tonoplast intrinsic protein                             177   1e-52   Olea europaea
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                  176   1e-52   
gb|AGG39699.1|  aquaporin protein AQU21                                 176   1e-52   
gb|AHW81522.1|  ECFP-tagged gamma TIP                                   182   2e-52   
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg                176   2e-52   
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg             176   2e-52   
ref|XP_009152050.1|  PREDICTED: aquaporin TIP1-2                        176   2e-52   
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                        176   2e-52   
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                        176   3e-52   
ref|XP_004985722.1|  PREDICTED: aquaporin TIP1-1-like                   175   3e-52   
emb|CAN69323.1|  hypothetical protein VITISV_032929                     176   3e-52   Vitis vinifera
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1               175   4e-52   
ref|NP_001267926.1|  aquaporin-like                                     175   4e-52   
ref|NP_189283.1|  aquaporin TIP1-2                                      175   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417             175   4e-52   
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1               175   5e-52   
ref|XP_002465859.1|  hypothetical protein SORBIDRAFT_01g047140          175   5e-52   Sorghum bicolor [broomcorn]
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1               179   5e-52   
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1               175   5e-52   
gb|AEV54105.1|  putative tonoplast intrinsic protein 1.5                174   6e-52   
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                   175   6e-52   
sp|P50156.1|TIP11_ORYSJ  RecName: Full=Probable aquaporin TIP1-1;...    175   6e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                        175   7e-52   
gb|ABK23010.1|  unknown                                                 175   7e-52   Picea sitchensis
gb|AAB62692.1|  salt-stress induced tonoplast intrinsic protein         175   7e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AGD98709.1|  aquaporin protein 6                                     174   9e-52   
ref|XP_009421351.1|  PREDICTED: probable aquaporin TIP1-2               174   9e-52   
ref|XP_006649396.1|  PREDICTED: probable aquaporin TIP1-1-like          174   1e-51   
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                        174   1e-51   
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                   174   1e-51   
gb|AGD98716.1|  aquaporin protein 13                                    174   1e-51   
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                   174   1e-51   
gb|AGD98711.1|  aquaporin protein 8                                     174   1e-51   
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                  174   1e-51   
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2                174   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_003552678.1|  PREDICTED: aquaporin TIP1-3-like                   174   2e-51   
gb|KHG16987.1|  Aquaporin TIP1-3 -like protein                          174   2e-51   
ref|XP_003518658.1|  PREDICTED: aquaporin TIP1-3-like                   174   2e-51   
gb|KHN13870.1|  Aquaporin TIP1-3                                        174   2e-51   
gb|ABK25915.1|  unknown                                                 173   2e-51   Picea sitchensis
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                   173   2e-51   
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                        173   2e-51   
ref|XP_007027468.1|  Aquaporin TIP1,6                                   173   3e-51   
ref|XP_009404620.1|  PREDICTED: aquaporin TIP1-1-like                   173   3e-51   
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                    173   3e-51   
ref|XP_007139266.1|  hypothetical protein PHAVU_008G014900g             173   3e-51   
emb|CAB61841.1|  putative gamma tonoplast intrinsic protein (TIP)       172   4e-51   Sporobolus stapfianus [resurrection grass]
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1               172   4e-51   
ref|XP_004307558.1|  PREDICTED: aquaporin TIP1-3-like                   172   5e-51   
gb|KHN33410.1|  Aquaporin TIP1-3                                        169   6e-51   
ref|NP_001241727.1|  aquaporin TIP1.1                                   172   7e-51   
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                         172   8e-51   Lolium perenne [perennial ryegrass]
ref|NP_001104896.1|  aquaporin TIP1-1                                   172   8e-51   Zea mays [maize]
ref|XP_008788076.1|  PREDICTED: aquaporin TIP1-3-like                   172   8e-51   
dbj|BAM44345.1|  vacuolar aluminum transporter                          171   1e-50   
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                        171   1e-50   
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                     171   2e-50   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                  171   2e-50   
ref|XP_004492091.1|  PREDICTED: aquaporin TIP1-3-like                   171   2e-50   
emb|CAC81985.1|  putative aquaporin                                     167   2e-50   Posidonia oceanica
ref|XP_010922400.1|  PREDICTED: aquaporin TIP1-3-like                   171   3e-50   
ref|XP_008357781.1|  PREDICTED: aquaporin TIP1-3-like                   170   4e-50   
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                        170   4e-50   
ref|XP_010456993.1|  PREDICTED: aquaporin TIP1-3-like                   169   5e-50   
gb|AAB17284.1|  tonoplast intrinsic protein                             170   5e-50   Mesembryanthemum crystallinum
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg             170   6e-50   
ref|XP_010669827.1|  PREDICTED: aquaporin TIP1-3-like                   170   6e-50   
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                        169   7e-50   
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                  170   9e-50   
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                   169   1e-49   
ref|XP_002523724.1|  tonoplast intrinsic protein, putative              169   1e-49   Ricinus communis
ref|XP_009338345.1|  PREDICTED: aquaporin TIP1-3-like                   169   1e-49   
ref|XP_009358317.1|  PREDICTED: aquaporin TIP1-3-like                   169   1e-49   
ref|XP_004971442.1|  PREDICTED: probable aquaporin TIP1-2-like          169   1e-49   
ref|XP_009111380.1|  PREDICTED: aquaporin TIP1-3                        169   2e-49   
ref|NP_192056.1|  aquaporin TIP1-3                                      168   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234103.1|  aquaporin-like                                     168   2e-49   
gb|ABK28617.1|  unknown                                                 168   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396348.1|  hypothetical protein EUTSA_v10028907mg             168   2e-49   
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                   168   3e-49   
emb|CAC85291.1|  putative tonoplast intrinsic protein                   168   3e-49   Posidonia oceanica
gb|KFK30698.1|  hypothetical protein AALP_AA6G016000                    168   3e-49   
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                   167   4e-49   
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2               168   4e-49   
ref|XP_008366336.1|  PREDICTED: probable aquaporin TIP1-2               167   4e-49   
ref|XP_002872891.1|  GAMMA-TIP3/TIP1_3                                  167   4e-49   
gb|ACJ53708.1|  tonoplast intrinsic protein 1-1                         167   5e-49   Lolium perenne [perennial ryegrass]
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg             167   5e-49   
ref|XP_007142715.1|  hypothetical protein PHAVU_007G010800g             167   7e-49   
ref|XP_009349744.1|  PREDICTED: aquaporin TIP1-1-like                   167   1e-48   
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                      167   1e-48   Pyrus communis
ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1               166   1e-48   
ref|NP_001045562.1|  Os01g0975900                                       166   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1               166   1e-48   
gb|AAG44946.1|AF290619_1  putative gamma TIP                            166   1e-48   Nicotiana glauca [glaucous tobacco]
gb|AAL16972.1|AF367456_1  gamma-tonoplast intrinsic protein             162   1e-48   Prunus persica
emb|CAE53878.1|  putative aquaporin                                     163   1e-48   Ricinus communis
dbj|BAF95576.1|  tonoplast intrinsic protein                            166   1e-48   Nicotiana tabacum [American tobacco]
gb|EMS45815.1|  putative aquaporin TIP1-1                               164   2e-48   
gb|ACV52008.1|  tonoplast aquaporin 1;1                                 166   2e-48   Daucus carota [Queen Anne's lace]
gb|ACY74345.1|  aquaporin-like protein                                  166   2e-48   Capsicum annuum
ref|XP_003565186.1|  PREDICTED: probable aquaporin TIP1-2               166   3e-48   
gb|ACB71282.1|  tonoplast intrinsic protein                             166   3e-48   Tamarix hispida
ref|XP_010098813.1|  Aquaporin TIP1-1                                   165   3e-48   
dbj|BAD04010.1|  tonoplast intrinsic protein                            165   3e-48   Prunus persica
ref|XP_003536771.1|  PREDICTED: aquaporin TIP1-3-like                   165   3e-48   
gb|ADD59910.1|  aquaporin                                               166   4e-48   Chimonanthus praecox [wintersweet]
ref|XP_008350342.1|  PREDICTED: aquaporin TIP1-1-like                   165   4e-48   
gb|ACF78734.1|  unknown                                                 165   4e-48   Zea mays [maize]
ref|XP_008387528.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    165   4e-48   
gb|ABP35520.1|  tonoplast intrinsic protein                             165   4e-48   Ipomoea batatas [batate]
gb|AEQ29861.1|  aquaporin TIP1                                          165   5e-48   
gb|ACG35910.1|  aquaporin TIP1.2                                        165   5e-48   Zea mays [maize]
ref|XP_008241379.1|  PREDICTED: aquaporin TIP1-1                        165   5e-48   
ref|NP_001105029.1|  aquaporin TIP1-2                                   165   6e-48   Zea mays [maize]
dbj|BAI66439.1|  tonoplast intrinsic protein                            164   6e-48   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ98454.1|  predicted protein                                      164   6e-48   
gb|ABI96817.1|  tonoplast intrinsic protein                             164   7e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EMT32480.1|  Putative aquaporin TIP1-2                               164   8e-48   
dbj|BAP33939.1|  tonoplast intrinsic protein                            164   9e-48   
gb|ABB29477.1|  tonoplast intrinsic protein                             164   9e-48   Panax ginseng [Chinese ginseng]
ref|XP_004497305.1|  PREDICTED: aquaporin TIP1-3-like                   164   9e-48   
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1               164   1e-47   
gb|EAZ15017.1|  hypothetical protein OsJ_04959                          164   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|ADE76384.1|  unknown                                                 164   2e-47   
gb|AAL49753.1|AF452015_1  aquaporin-like protein                        163   2e-47   Petunia x hybrida [garden petunia]
gb|AFK34456.1|  unknown                                                 163   3e-47   
ref|XP_002531978.1|  tonoplast intrinsic protein, putative              162   4e-47   Ricinus communis
gb|ADE34285.1|  aquaporin TIP1;10                                       160   5e-47   
gb|ADE34287.1|  aquaporin TIP1;12                                       160   5e-47   
ref|XP_008795635.1|  PREDICTED: probable aquaporin TIP1-1               162   6e-47   
dbj|BAM15884.1|  putative tonoplast intrinsic protein 1                 159   9e-47   
gb|ADE34288.1|  aquaporin TIP1;13                                       159   9e-47   
gb|AFQ23566.1|  aquaporin TIP1                                          161   9e-47   
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                        161   1e-46   Vitis vinifera
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                          161   1e-46   
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg             161   1e-46   
ref|XP_010685836.1|  PREDICTED: aquaporin TIP1-3-like                   161   1e-46   
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                          161   1e-46   
ref|XP_002459183.1|  hypothetical protein SORBIDRAFT_03g047470          161   2e-46   Sorghum bicolor [broomcorn]
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                   161   2e-46   
ref|XP_010112915.1|  Aquaporin TIP1-3                                   161   2e-46   
ref|XP_006488253.1|  PREDICTED: aquaporin TIP1-3-like                   160   2e-46   
emb|CDP00041.1|  unnamed protein product                                161   2e-46   
ref|XP_004307108.1|  PREDICTED: aquaporin TIP1-1-like                   160   2e-46   
gb|KEH44484.1|  tonoplast intrinsic protein                             160   2e-46   
gb|ADE34283.1|  aquaporin TIP1;7                                        160   3e-46   
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                        160   3e-46   Mimosa pudica [sensitive-plant]
emb|CAB39758.1|  major intrinsic protein                                160   4e-46   Picea abies
gb|AAT65835.2|  tonoplast intrinsic protein gamma                       160   4e-46   Salicornia herbacea
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                    160   4e-46   
gb|AAD31847.1|AF133531_1  water channel protein MipI                    160   5e-46   Mesembryanthemum crystallinum
ref|XP_009336482.1|  PREDICTED: aquaporin TIP1-3-like                   156   6e-46   
gb|KHG06645.1|  putative aquaporin TIP1-2                               159   6e-46   
ref|XP_004294610.1|  PREDICTED: aquaporin TIP1-1-like                   159   9e-46   
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                   159   9e-46   
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                   159   1e-45   
gb|ABR68795.1|  aquaporin gamma-TIP                                     159   1e-45   Gossypium hirsutum [American cotton]
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                   159   1e-45   
ref|XP_011089424.1|  PREDICTED: aquaporin TIP1-3-like                   159   1e-45   
gb|AFS50011.1|  hypothetical protein                                    158   2e-45   
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                        158   2e-45   Mimosa pudica [sensitive-plant]
ref|XP_006645407.1|  PREDICTED: probable aquaporin TIP1-2-like          158   2e-45   
gb|AEV54106.1|  putative tonoplast intrinsic protein 1.8                157   3e-45   
gb|AEF59492.1|  aquaporin-like protein                                  158   3e-45   
gb|ADE34284.1|  aquaporin TIP1;9                                        155   3e-45   
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    157   4e-45   
gb|AFU51578.1|  aquaporin                                               157   5e-45   
gb|ADF32096.1|  aquaporin                                               157   6e-45   
dbj|BAA31516.1|  SAMIPB                                                 152   6e-45   Tripolium pannonicum [sea starwort]
ref|XP_011028266.1|  PREDICTED: aquaporin TIP1-1-like                   157   7e-45   
ref|XP_006384960.1|  nodulin-26 family protein                          155   3e-44   
ref|XP_004149825.1|  PREDICTED: aquaporin TIP1-3-like                   155   3e-44   
ref|XP_003555811.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        155   3e-44   
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                        155   4e-44   Vitis vinifera
ref|XP_002314305.2|  nodulin-26 family protein                          155   4e-44   Populus trichocarpa [western balsam poplar]
dbj|BAG15863.1|  aquaporin                                              153   5e-44   Bruguiera gymnorhiza [Burma mangrove]
emb|CDP07030.1|  unnamed protein product                                154   7e-44   
gb|AEW46425.1|  putative tonoplast intrinsic protein 1.1                153   1e-43   
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2               153   1e-43   
ref|XP_008463493.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        153   1e-43   
gb|ABK22410.1|  unknown                                                 153   2e-43   Picea sitchensis
gb|AEV54107.1|  putative tonoplast intrinsic protein 1.7                152   2e-43   
ref|XP_002299893.1|  nodulin-26 family protein                          153   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011072095.1|  PREDICTED: probable aquaporin TIP3-2               153   2e-43   
gb|AHI54565.1|  tonoplastic intrinsic protein                           153   3e-43   
ref|XP_002314201.1|  nodulin-26 family protein                          152   3e-43   
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2               152   3e-43   
ref|XP_006605823.1|  PREDICTED: aquaporin TIP1-3-like isoform X2        152   4e-43   
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...    152   5e-43   
gb|AAN40746.1|  tonoplast intrinsic protein                             152   5e-43   
emb|CAA64952.1|  tonoplast intrinsic protein                            152   6e-43   
dbj|BAA31520.1|  SAMIPF                                                 147   6e-43   
gb|AEW46426.1|  putative tonoplast intrinsic protein 1.2                150   8e-43   
gb|ABK22242.1|  unknown                                                 151   8e-43   
gb|AHJ09607.1|  aquaporin protein 26                                    151   8e-43   
ref|XP_010248450.1|  PREDICTED: aquaporin TIP3-1-like                   151   1e-42   
gb|ABQ85918.1|  tonoplast intrinsic protein                             149   1e-42   
gb|ADU25490.1|  tonoplastic intrinsic protein                           150   1e-42   
ref|XP_010248431.1|  PREDICTED: aquaporin TIP3-1-like                   151   2e-42   
gb|KEH21895.1|  tonoplast intrinsic protein                             150   3e-42   
gb|AGV54720.1|  water-selective transport intrinsic membrane prot...    149   3e-42   
emb|CAA06335.1|  aquaporin-like protein                                 150   4e-42   
ref|XP_003542571.1|  PREDICTED: aquaporin TIP1-1-like                   149   5e-42   
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g             149   7e-42   
gb|AHA84270.1|  nodulin-26                                              149   8e-42   
ref|XP_008800430.1|  PREDICTED: aquaporin TIP3-1-like                   148   1e-41   
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                   148   1e-41   
gb|EYU22320.1|  hypothetical protein MIMGU_mgv1a012158mg                149   1e-41   
ref|XP_009772297.1|  PREDICTED: probable aquaporin TIP3-2               148   1e-41   
ref|XP_009625471.1|  PREDICTED: probable aquaporin TIP3-2               148   2e-41   
ref|XP_009397951.1|  PREDICTED: aquaporin TIP3-1-like                   147   3e-41   
ref|XP_010687268.1|  PREDICTED: aquaporin TIP3-1-like                   147   3e-41   
gb|EPS60922.1|  hypothetical protein M569_13880                         147   3e-41   
ref|NP_001237062.1|  uncharacterized protein LOC100527509               147   3e-41   
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                   147   3e-41   
gb|KDP37268.1|  hypothetical protein JCGZ_06324                         147   4e-41   
ref|XP_008797218.1|  PREDICTED: aquaporin TIP3-1-like                   147   4e-41   
emb|CAB55837.1|  delta tonoplast intrinsic protein                      147   4e-41   
gb|ABH09331.1|  putative aquaporin                                      147   4e-41   
emb|CAB95746.2|  putative aquaporin                                     147   5e-41   
ref|NP_001267958.1|  aquaporin TIP2;1                                   147   5e-41   
gb|EPS57548.1|  hypothetical protein M569_17268                         147   5e-41   
gb|AAF78758.1|AF271661_1  putative aquaporin TIP1                       147   5e-41   
ref|XP_004299427.1|  PREDICTED: aquaporin TIP2-3-like                   146   6e-41   
ref|XP_007205767.1|  hypothetical protein PRUPE_ppa010367mg             146   6e-41   
dbj|BAL41683.1|  tonoplast intrinsic protein                            146   7e-41   
gb|AAF78759.1|AF271662_1  putative aquaporin TIP2                       142   7e-41   
gb|ACI95284.1|  tonoplast intrinsic protein                             146   7e-41   
gb|EYU19323.1|  hypothetical protein MIMGU_mgv1a023438mg                145   8e-41   
ref|XP_008437066.1|  PREDICTED: probable aquaporin TIP2-2               146   1e-40   
ref|NP_177462.1|  aquaporin TIP3-1                                      146   1e-40   
gb|AAD31848.1|AF133532_1  water channel protein MipK                    145   1e-40   
ref|XP_010933299.1|  PREDICTED: aquaporin TIP3-1-like                   145   1e-40   
ref|XP_004152399.1|  PREDICTED: aquaporin TIP2-3-like                   145   1e-40   
ref|XP_010918027.1|  PREDICTED: aquaporin TIP3-1-like                   145   1e-40   
emb|CAA65185.1|  aquaporin                                              145   2e-40   
ref|XP_002452808.1|  hypothetical protein SORBIDRAFT_04g032900          145   2e-40   
gb|ACU16456.1|  unknown                                                 145   3e-40   
ref|XP_006351524.1|  PREDICTED: probable aquaporin TIP3-2-like          145   3e-40   
ref|NP_001274301.1|  probable aquaporin TIP3-2-like                     145   3e-40   
ref|XP_008222876.1|  PREDICTED: probable aquaporin TIP1-2               144   3e-40   
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2-like          145   3e-40   
emb|CBI36103.3|  unnamed protein product                                142   4e-40   
emb|CCI55670.1|  EaTIP2,1                                               144   4e-40   
gb|ADE34290.1|  aquaporin TIP2;4                                        141   4e-40   
gb|ADW66151.1|  tonoplast intrinsic protein 1-1                         141   4e-40   
gb|ADE34291.1|  aquaporin TIP2;5                                        141   4e-40   
ref|XP_009597545.1|  PREDICTED: probable aquaporin TIP3-2               144   4e-40   
gb|ABA56492.1|  putative tonoplast intrinsic protein                    144   4e-40   
gb|EPS67611.1|  aquaporin-like protein                                  144   7e-40   
ref|XP_010471374.1|  PREDICTED: aquaporin TIP3-1                        144   8e-40   
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680          144   9e-40   
ref|XP_009767160.1|  PREDICTED: probable aquaporin TIP3-2               144   9e-40   
ref|XP_006390582.1|  hypothetical protein EUTSA_v10019492mg             144   1e-39   
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2               143   1e-39   
dbj|BAL41684.1|  tonoplast intrinsic protein                            143   1e-39   
gb|AFK48554.1|  unknown                                                 143   1e-39   
ref|XP_004241485.1|  PREDICTED: probable aquaporin TIP3-2               143   1e-39   
ref|XP_003626979.1|  Aquaporin TIP2-1                                   143   2e-39   
dbj|BAO18638.1|  tonoplast intrinsic protein 3;1                        142   2e-39   
ref|XP_004953349.1|  PREDICTED: aquaporin TIP2-1-like                   142   2e-39   
gb|ACU18941.1|  unknown                                                 142   2e-39   
ref|XP_006347387.1|  PREDICTED: probable aquaporin TIP3-2-like          143   2e-39   
ref|XP_011080630.1|  PREDICTED: aquaporin TIP2-1                        142   2e-39   
gb|KDP39884.1|  hypothetical protein JCGZ_03415                         142   2e-39   
ref|XP_010540050.1|  PREDICTED: probable aquaporin TIP3-2               143   2e-39   
gb|AFK35772.1|  unknown                                                 142   2e-39   
ref|XP_009346282.1|  PREDICTED: probable aquaporin TIP-type             142   2e-39   
ref|XP_003517415.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      142   2e-39   
ref|XP_010037056.1|  PREDICTED: probable aquaporin TIP3-2               142   2e-39   
gb|AGV54343.1|  tonoplast intrinsic protein                             142   2e-39   
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                   142   2e-39   
gb|EAY95084.1|  hypothetical protein OsI_16900                          140   3e-39   
ref|XP_009384464.1|  PREDICTED: probable aquaporin TIP2-1               142   3e-39   
ref|XP_010428229.1|  PREDICTED: aquaporin TIP3-1-like                   142   3e-39   
gb|KDP46476.1|  hypothetical protein JCGZ_08448                         142   3e-39   
ref|XP_006301877.1|  hypothetical protein CARUB_v10022350mg             142   3e-39   
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...    142   4e-39   
ref|XP_004976439.1|  PREDICTED: aquaporin TIP2-3-like                   142   4e-39   
gb|AFK47280.1|  unknown                                                 142   4e-39   
gb|KFK41757.1|  hypothetical protein AALP_AA2G168300                    142   5e-39   
ref|XP_002887476.1|  alpha-tonoplast intrinsic protein                  142   5e-39   
gb|ACZ06860.1|  tonoplast intrinsic protein                             141   5e-39   
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg             142   5e-39   
tpg|DAA33871.1|  TPA: aquaporin TIP2;2                                  141   5e-39   
gb|AAB04557.1|  delta-tonoplast intrinsic protein                       141   5e-39   
ref|NP_001238338.1|  uncharacterized protein LOC100527333               141   5e-39   
gb|ADE34289.1|  aquaporin TIP2;3                                        141   5e-39   
ref|XP_006441499.1|  hypothetical protein CICLE_v10021799mg             142   5e-39   
gb|KHG26174.1|  Aquaporin TIP2-1 -like protein                          141   5e-39   
ref|XP_006478158.1|  PREDICTED: probable aquaporin TIP3-2-like          141   6e-39   
ref|XP_002515999.1|  tonoplast intrinsic protein, putative              141   6e-39   
gb|ABK21457.1|  unknown                                                 141   6e-39   
gb|ABK22530.1|  unknown                                                 141   6e-39   
ref|XP_009389231.1|  PREDICTED: aquaporin TIP3-1-like                   141   6e-39   
gb|EPS62187.1|  nodulin-26                                              141   6e-39   
ref|XP_008669054.1|  PREDICTED: aquaporin TIP2-3-like                   141   6e-39   
ref|XP_009127978.1|  PREDICTED: aquaporin TIP3-1                        142   6e-39   
gb|AAD31849.1|AF133533_1  water channel protein MipL                    140   7e-39   
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                        141   7e-39   
gb|ABK26146.1|  unknown                                                 141   7e-39   
gb|ACU16412.1|  unknown                                                 142   7e-39   
emb|CAC39085.2|  putative aquaporin                                     140   7e-39   
ref|XP_010416107.1|  PREDICTED: aquaporin TIP3-1-like                   141   7e-39   
ref|XP_002448289.1|  hypothetical protein SORBIDRAFT_06g024590          141   8e-39   
emb|CAA65184.1|  aquaporin                                              141   8e-39   
ref|XP_009382435.1|  PREDICTED: probable aquaporin TIP2-1               141   8e-39   
ref|XP_010258877.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      141   9e-39   
ref|XP_003536182.1|  PREDICTED: probable aquaporin TIP-type alpha       141   9e-39   
ref|XP_009104826.1|  PREDICTED: aquaporin TIP3-1-like                   141   1e-38   
ref|NP_001047632.1|  Os02g0658100                                       140   1e-38   
ref|XP_009355907.1|  PREDICTED: probable aquaporin TIP3-2               140   1e-38   
ref|XP_008375083.1|  PREDICTED: probable aquaporin TIP3-2               140   1e-38   
emb|CDY11123.1|  BnaC06g23750D                                          141   1e-38   
dbj|BAA19129.1|  unnamed protein product                                140   1e-38   
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     140   1e-38   
ref|XP_006398438.1|  hypothetical protein EUTSA_v10001007mg             140   1e-38   
ref|XP_009101423.1|  PREDICTED: aquaporin TIP2-3                        140   1e-38   
gb|ABD65010.1|  tonoplast intrinsic protein, putative                   140   1e-38   
ref|NP_001105032.1|  aquaporin TIP3-1                                   140   1e-38   
ref|XP_010322694.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    140   1e-38   
gb|AFU51579.1|  aquaporin                                               140   2e-38   
ref|XP_003597702.1|  Aquaporin                                          140   2e-38   
gb|ACJ86062.1|  unknown                                                 140   2e-38   
emb|CDX77768.1|  BnaC07g20220D                                          140   2e-38   
gb|ABD64981.1|  tonoplast intrinsic protein, putative                   140   2e-38   
ref|XP_011046111.1|  PREDICTED: probable aquaporin TIP3-2               140   2e-38   
gb|AFK49181.1|  unknown                                                 140   2e-38   
ref|XP_006647629.1|  PREDICTED: probable aquaporin TIP2-1-like          140   2e-38   
ref|NP_001242116.1|  uncharacterized protein LOC100803901               140   2e-38   
ref|XP_006356145.1|  PREDICTED: aquaporin TIP2-1-like                   140   2e-38   
emb|CDY20190.1|  BnaA01g28120D                                          140   2e-38   
gb|AHA50083.1|  tonoplast intrinsic protein                             140   2e-38   
gb|AAC04386.1|  delta-TIP homolog                                       135   2e-38   
emb|CDP09981.1|  unnamed protein product                                140   2e-38   
ref|XP_010933649.1|  PREDICTED: probable aquaporin TIP2-1               140   2e-38   
emb|CDY63821.1|  BnaC01g44580D                                          140   2e-38   
emb|CDX96453.1|  BnaA07g30640D                                          140   2e-38   
dbj|BAO18637.1|  tonoplast intrinsic protein 2;5                        140   2e-38   
gb|AAO86710.1|  tonoplast water channel                                 140   2e-38   
ref|XP_011017549.1|  PREDICTED: probable aquaporin TIP3-2               140   2e-38   
ref|XP_009114826.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    140   2e-38   
gb|AGD98715.1|  aquaporin protein 12                                    140   2e-38   
sp|P33560.1|TIP_ANTMA  RecName: Full=Probable aquaporin TIP-type;...    140   2e-38   
ref|NP_001104907.1|  aquaporin TIP2-3                                   140   2e-38   
gb|ACG44020.1|  aquaporin TIP2.1                                        140   2e-38   
gb|EPS72940.1|  hypothetical protein M569_01821                         140   2e-38   
gb|AEZ52401.1|  aquaporin                                               140   2e-38   
gb|AEI83501.1|  Major intrinsic protein                                 140   2e-38   
gb|ABK94373.1|  unknown                                                 140   2e-38   
emb|CDX97733.1|  BnaA05g23460D                                          140   2e-38   
gb|KHG25791.1|  putative aquaporin TIP-type                             140   2e-38   
ref|XP_009615916.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      140   2e-38   
ref|XP_010545684.1|  PREDICTED: aquaporin TIP2-1                        140   2e-38   
ref|XP_002298233.1|  delta-tonoplast intrinsic family protein           139   3e-38   
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                        139   3e-38   
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...    139   3e-38   
ref|XP_007144382.1|  hypothetical protein PHAVU_007G151600g             140   3e-38   
emb|CDY30146.1|  BnaC05g37160D                                          139   3e-38   
gb|KDO61412.1|  hypothetical protein CISIN_1g038895mg                   138   3e-38   
ref|XP_007099759.1|  Beta-tonoplast intrinsic protein                   140   3e-38   
ref|XP_010465638.1|  PREDICTED: aquaporin TIP2-1                        139   3e-38   
emb|CDY66321.1|  BnaCnng50290D                                          140   3e-38   
ref|NP_199556.1|  aquaporin TIP2-3                                      139   3e-38   
dbj|BAD90704.1|  tonoplast intrinsic protein 2;1                        139   3e-38   
ref|XP_008796116.1|  PREDICTED: aquaporin TIP2-3                        139   3e-38   
pir||T10251  membrane protein MP23 precursor - cucurbit                 140   3e-38
ref|XP_006426917.1|  hypothetical protein CICLE_v10026351mg             138   4e-38   
emb|CDY28932.1|  BnaA02g25440D                                          138   4e-38   
ref|XP_009146158.1|  PREDICTED: aquaporin TIP2-1                        140   4e-38   
ref|XP_002525663.1|  tonoplast intrinsic protein, putative              139   4e-38   
ref|XP_007039804.1|  Tonoplast intrinsic protein 2,3                    139   4e-38   
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                   139   4e-38   
ref|XP_011072396.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    138   5e-38   
ref|XP_004971257.1|  PREDICTED: aquaporin TIP2-1-like isoform X1        139   5e-38   
ref|XP_010254028.1|  PREDICTED: aquaporin TIP2-1                        139   5e-38   
ref|XP_008373770.1|  PREDICTED: probable aquaporin TIP-type             139   6e-38   
ref|NP_001241721.1|  aquaporin TIP3.1                                   139   6e-38   
ref|XP_006440295.1|  hypothetical protein CICLE_v10021867mg             139   6e-38   
ref|XP_009377878.1|  PREDICTED: aquaporin TIP2-1                        139   6e-38   
ref|XP_008342659.1|  PREDICTED: aquaporin TIP2-1                        139   6e-38   
ref|XP_006477173.1|  PREDICTED: probable aquaporin TIP2-2-like          139   6e-38   
ref|XP_006372647.1|  aquaporin TIP-type alpha family protein            139   6e-38   
tpg|DAA49507.1|  TPA: aquaporin TIP3-2                                  139   6e-38   
ref|NP_001105030.1|  aquaporin TIP2-1                                   139   7e-38   
ref|XP_006298401.1|  hypothetical protein CARUB_v10014472mg             139   7e-38   
emb|CDY59296.1|  BnaA06g40020D                                          139   7e-38   
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     139   7e-38   
ref|XP_010487476.1|  PREDICTED: aquaporin TIP2-1-like                   139   7e-38   
ref|XP_010504014.1|  PREDICTED: aquaporin TIP2-1-like                   139   7e-38   
ref|XP_009128968.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    139   7e-38   
emb|CDX82410.1|  BnaA03g34110D                                          139   7e-38   
ref|XP_010529962.1|  PREDICTED: probable aquaporin TIP2-2 isoform X1    139   7e-38   
dbj|BAF01204.1|  membrane channel protein-like                          139   7e-38   
gb|ABX79971.1|  aquaporin                                               137   7e-38   
ref|XP_009135480.1|  PREDICTED: aquaporin TIP2-1-like                   138   7e-38   
ref|XP_010449630.1|  PREDICTED: probable aquaporin TIP2-2               138   7e-38   
ref|XP_004302879.1|  PREDICTED: aquaporin TIP2-1-like                   138   8e-38   
ref|XP_010434682.1|  PREDICTED: probable aquaporin TIP2-2               138   8e-38   
ref|XP_010459395.1|  PREDICTED: probable aquaporin TIP3-2               139   8e-38   
gb|AAB53329.1|  Rb7                                                     138   8e-38   
ref|NP_001274703.1|  TIP protein                                        138   8e-38   
ref|XP_010476946.1|  PREDICTED: probable aquaporin TIP3-2               139   8e-38   
gb|KHG24233.1|  putative aquaporin TIP3-2 -like protein                 138   8e-38   
ref|XP_002882988.1|  delta tonoplast intrinsic protein                  138   9e-38   



>emb|CAE53879.1| putative aquaporin [Ricinus communis]
Length=141

 Score =   182 bits (462),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYW AQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  9    GAFVGGNITLLRGILYWFAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  68

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  69   MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  117



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score =   184 bits (468),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ADO17795.1| tonoplast intrinsic protein [Jatropha curcas]
Length=252

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006436063.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 ref|XP_006486051.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|ESR49303.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 gb|KDO67730.1| hypothetical protein CISIN_1g025464mg [Citrus sinensis]
Length=252

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITLLR ILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV + NA+VFEIV
Sbjct  91   GAFVGGHITLLRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITLLRGILYWIAQLLG+V AC LLKF+TGGL TS FGLSGV   NA VFEIVM
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGAVVACGLLKFATGGLTTSAFGLSGVSVWNAFVFEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKGSLG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  TFGLVYTVYATAIDPKKGSLGIIAPIAIGFIVGANILAGGAFTGASMN  198



>gb|KHN21988.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+I+LLRGILYWIAQLLGSV ACLLLKF+TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHISLLRGILYWIAQLLGSVVACLLLKFATGGLETSAFSLSPGVGAANALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_009411359.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITLLRGILYWIAQLLGS  ACLLL+FSTGGLET  FGLSGV A  ALV EIVM
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLRFSTGGLETGTFGLSGVSAWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GG F+GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGPFSGASMN  198



>ref|NP_001242707.1| uncharacterized protein LOC100777419 [Glycine max]
 gb|ACU17836.1| unknown [Glycine max]
Length=252

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+I+LLRGILYWIAQLLGSV ACLLLKF+TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHISLLRGILYWIAQLLGSVVACLLLKFATGGLETSAFSLSPGVGAANALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|NP_001267923.1| aquaporin-like [Vitis vinifera]
 gb|ABH09329.1| putative aquaporin [Vitis vinifera]
 gb|AAW02943.2| aquaporin [Vitis vinifera]
Length=251

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AIK66517.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_007009482.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY18292.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGLETS F LS  V A NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLETSAFSLSSDVSAWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CAN74049.1| hypothetical protein VITISV_007330 [Vitis vinifera]
Length=251

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    F LS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTTGGLAVPAFSLSAGVGTLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANI AGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIFAGGAFTGASMN  199



>emb|CBI31728.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AAB51394.2| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=175

 Score =   181 bits (458),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  15   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  74

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  75   MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  123



>gb|KDP29873.1| hypothetical protein JCGZ_18448 [Jatropha curcas]
Length=252

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLK++TGGLETS F LS GV A NA+VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKYATGGLETSAFALSSGVSAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004505892.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score =   182 bits (463),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITL+RG+LYWIAQLLGSV ACLLLK +TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHITLIRGLLYWIAQLLGSVVACLLLKIATGGLETSAFSLSSGVGATNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score =   182 bits (463),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYW AQLLGS  ACLLLKFSTGGL TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWFAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AAF78757.1|AF271660_1 putative aquaporin TIP3 [Vitis cinerea var. helleri x Vitis rupestris]
Length=251

 Score =   182 bits (463),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFLGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_011022886.1| PREDICTED: aquaporin TIP1-3 [Populus euphratica]
Length=252

 Score =   182 bits (463),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GGNITLLR ILYWIAQLLGSV ACLLLKFSTGGLET  FGLS GVGA NA+VFEIV
Sbjct  91   GALIGGNITLLRSILYWIAQLLGSVVACLLLKFSTGGLETPAFGLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_002316308.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|ABK94058.1| unknown [Populus trichocarpa]
 gb|EEF02479.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GGNITLLR ILYWIAQLLGSV ACLLLKF+TGGLET  FGLS GVGA NALVFEIV
Sbjct  91   GALIGGNITLLRSILYWIAQLLGSVVACLLLKFATGGLETPAFGLSSGVGAWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GGNITLLR ILYWIAQLLGSV ACLLLKFSTGGLET  FGLS GVGA NA+VFEIV
Sbjct  91   GALIGGNITLLRSILYWIAQLLGSVVACLLLKFSTGGLETPAFGLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CDY67380.1| BnaAnng24130D [Brassica napus]
 emb|CDY66645.1| BnaAnng22640D [Brassica napus]
Length=221

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  61   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  120

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  121  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  169



>ref|XP_003606614.1| Aquaporin TIP1-1 [Medicago truncatula]
 gb|AES88811.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITL+RG+LYWIAQLLGSV ACLLLK +TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHITLIRGLLYWIAQLLGSVVACLLLKIATGGLETSAFSLSSGVGATNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GGNITLLR ILYWIAQLLGSV ACLLLKF+TGGLET  FGLS GVGA NALVFEIV
Sbjct  91   GALMGGNITLLRSILYWIAQLLGSVVACLLLKFATGGLETPAFGLSSGVGAWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|AAD10494.1| gamma-type tonoplast intrinsic protein [Triticum aestivum]
Length=250

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYWIAQLLGS AAC LL+FSTGGL T  FGLSG+GA  A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWIAQLLGSTAACFLLRFSTGGLPTGTFGLSGIGAWEAVVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF+GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFSGASMN  198



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|AJA04408.1| tonoplast intrinsic protein [Chorispora bungeana]
Length=252

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRG+LYWIAQLLGSV AC LL+F+TGGL    FGLS GVG+LNA VFEIV
Sbjct  92   GAFVGGNITLLRGVLYWIAQLLGSVVACFLLQFATGGLPVPAFGLSEGVGSLNAFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>gb|ACX37451.1| tonoplast intrinsic protein [Hevea brasiliensis]
Length=252

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFSTGGL T+GF LS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTAGFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPPFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|EMT13047.1| Putative aquaporin TIP1-1 [Aegilops tauschii]
Length=213

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS AAC LL+FSTGGL T  FGL+G+GA  A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTAACFLLRFSTGGLPTGTFGLTGIGAWEAVVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF+GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFSGASMN  198



>ref|XP_010096653.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXB65321.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGLETS F LS GV   NAL+FEIV
Sbjct  91   GAFLGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLETSAFALSSGVSTWNALIFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG +APIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIVAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ADE34286.1| aquaporin TIP1;11, partial [Gossypium hirsutum]
Length=179

 Score =   178 bits (452),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKFSTGGL TS F LS GVGA NA+VFEIV
Sbjct  53   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFSTGGLTTSAFALSSGVGAWNAVVFEIV  112

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAP+AIGFIVGANILAGGAF GASMN
Sbjct  113  MTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIVGANILAGGAFDGASMN  161



>ref|XP_009382161.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITLLRGILYWIAQLLGS  ACLLL+FSTGGLET  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLRFSTGGLETGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GG F GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGPFDGASMN  198



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+IT +R ILYWIAQLLGSV ACLLLKFSTGGLETS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITFIRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPLAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010920700.1| PREDICTED: probable aquaporin TIP1-2 [Elaeis guineensis]
Length=253

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL+T+ F LS  V A NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLKTAAFSLSTDVSAWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILYWIAQLLGS  ACLLLKF+TGGL TS F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLFRGILYWIAQLLGSTVACLLLKFATGGLTTSAFSLSSGVTVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|NP_001284655.1| aquaporin TIP1-1 [Cucumis melo]
 gb|AGW99230.1| aquaporin TIP1-1 [Cucumis melo]
Length=250

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 100/109 (92%), Gaps = 2/109 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGI+YWIAQLLGSV ACLLLKF TG L T  FGLS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGIIYWIAQLLGSVVACLLLKFVTG-LPTGSFGLSAGVGELNAFVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  198



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGLE   FGLS GVG  NALV EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTTGGLEIGAFGLSDGVGVGNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDP KGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPNKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAP33938.1| aquaporin [Triticum aestivum]
Length=250

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYWIAQLLGS AAC LL+FSTGGL T  FGL+G+GA  A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWIAQLLGSTAACFLLRFSTGGLPTGTFGLTGIGAWEAVVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF+GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFSGASMN  198



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQL GSV ACLLLKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLAGSVVACLLLKFATGGLVVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score =   179 bits (455),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV AC LLKF+TGGLE   FGLS GVG  NALV EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACFLLKFTTGGLEIGTFGLSDGVGVGNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|KHN32099.1| Aquaporin TIP1-1 [Glycine soja]
Length=252

 Score =   179 bits (455),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+I+LLRGILYWIAQLLGSV ACLLLKF+T GLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHISLLRGILYWIAQLLGSVVACLLLKFATVGLETSAFSLSPGVGAANALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGG F+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGKLGIIAPIAIGFIVGANILAGGTFSGASMN  199



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score =   179 bits (455),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLVVPAFGLSAGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGA+ILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGADILAGGAFSGASMN  199



>gb|AEV54104.1| putative tonoplast intrinsic protein 1.6 [Populus deltoides x 
Populus x canadensis]
Length=215

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGS  ACLLLKF+TGGLETS F LS GVG  NA V EIV
Sbjct  73   GAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTTGGLETSAFALSSGVGVWNAFVLEIV  132

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  133  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  181



>emb|CAA56553.1| gamma-TIP-like protein [Hordeum vulgare subsp. vulgare]
 dbj|BAI66434.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90879.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS AAC LL+FSTGGL T  FGL+G+GA  A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTAACFLLRFSTGGLPTGTFGLTGIGAWEAVVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF+GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFSGASMN  198



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKF+TGGLETS F LS GV A NALVFEIV
Sbjct  91   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFATGGLETSAFALSPGVEAGNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKF+TGGLETS F LS GV A NALVFEIV
Sbjct  91   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFATGGLETSAFALSPGVEAGNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAA12711.1| VM23 [Raphanus sativus]
 emb|CDY13639.1| BnaA06g32840D [Brassica napus]
Length=253

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GV +LN  VFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLAVPAFGLSAGVESLNGFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYW+ QLLGSV ACLLLKF+TGGLETS F LS GV + NALVFEIV
Sbjct  91   GAFVGGHITLMRSILYWVGQLLGSVVACLLLKFATGGLETSAFALSSGVSSWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDP+KG+LGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPRKGNLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CDX83623.1| BnaC07g23630D [Brassica napus]
Length=253

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GV +LN  VFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLAVPAFGLSAGVESLNGFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+TGGL TS F LS GV   NA V EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATGGLTTSAFSLSSGVSVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGS  ACLLLKF+TGGLETS F LS GVG  NA V EIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTTGGLETSAFALSSGVGVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGS  ACLLLKF+TGGLETS F LS GVG  NA V EIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTTGGLETSAFALSSGVGVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+TG L    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATGDLAVPAFGLSSGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPLAIGFIVGANILAGGAFDGASMN  199



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLK +TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKVATGGLVVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAVDPKAGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>ref|XP_010502579.1| PREDICTED: aquaporin TIP1-2 [Camelina sativa]
Length=253

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LN LVFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEAIPAFGLSAGVGSLNGLVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_010514297.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LN LVFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEAIPAFGLSAGVGSLNGLVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_010031004.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW50265.1| hypothetical protein EUGRSUZ_J00051 [Eucalyptus grandis]
Length=252

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGLETS F LS  V   NALVFEIV
Sbjct  91   GAFLGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLETSAFSLSSDVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010425366.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LN LVFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEAIPAFGLSAGVGSLNGLVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_008801219.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNITLLRGILYWIAQLLGS  ACLLL+FSTGGL T  FGL+GV    ALV EIVM
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSTVACLLLRFSTGGLSTGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPK+GSLGTIAPIAIGFIVGAN+LAGGAF GASMN
Sbjct  151  TFGLVYTVYATALDPKRGSLGTIAPIAIGFIVGANVLAGGAFDGASMN  198



>ref|XP_009337569.1| PREDICTED: aquaporin TIP1-3 [Pyrus x bretschneideri]
Length=252

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGG ET+GF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGWETAGFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGLIVGANILAGGAFDGASMN  199



>ref|XP_004143284.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN48203.1| hypothetical protein Csa_6G448110 [Cucumis sativus]
Length=250

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 2/109 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGI+YWIAQLLGSV ACLLLKF TG L T  F LS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGIIYWIAQLLGSVVACLLLKFVTG-LPTGSFALSAGVGELNAFVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  198



>gb|KDP43963.1| hypothetical protein JCGZ_05430 [Jatropha curcas]
Length=254

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFST G+ TS F LS GV   NALVFEIV
Sbjct  94   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTHGMTTSAFALSSGVNVWNALVFEIV  153

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DP+KG LGTIAPIAIGFIVGAN+LAGGAF GASMN
Sbjct  154  MTFGLVYTVYATAIDPRKGQLGTIAPIAIGFIVGANVLAGGAFEGASMN  202



>ref|XP_008794805.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin TIP1-2 [Phoenix 
dactylifera]
Length=252

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL+TS F LS  V   NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLKTSAFSLSTDVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDPKKGNLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  ACLLLKF T G  TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004168293.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1-like [Cucumis 
sativus]
Length=250

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 99/109 (91%), Gaps = 2/109 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGI+YWIAQLLGSV ACLLLKF TG L T  F LS GVG LNA VFEIV
Sbjct  91   GAFVGGNITLLRGIIYWIAQLLGSVVACLLLKFVTG-LPTGSFALSAGVGELNAFVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  198



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGG+E   F LS GVG  NALV EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTTGGMEIGAFSLSDGVGVGNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  199



>ref|XP_007132109.1| hypothetical protein PHAVU_011G067200g [Phaseolus vulgaris]
 gb|ESW04103.1| hypothetical protein PHAVU_011G067200g [Phaseolus vulgaris]
Length=252

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRG+LYWIAQLLGSV AC LLKF+TGG ETS F LS GVG+ NALVFEIV
Sbjct  91   GAFIGGHITLLRGLLYWIAQLLGSVVACFLLKFATGGSETSAFSLSPGVGSANALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGQLGIIAPMAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006395549.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
 gb|ESQ32835.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
Length=253

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV AC LL F+TGGL    FGLS GVG+LNA VFEIV
Sbjct  92   GAFLGGNITLLRGILYWIAQLLGSVVACFLLTFATGGLAVPAFGLSAGVGSLNAFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>gb|AFQ98316.1| MIP6 [Eutrema halophilum]
Length=253

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV AC LL F+TGGL    FGLS GVG+LNA VFEIV
Sbjct  92   GAFLGGNITLLRGILYWIAQLLGSVVACFLLTFATGGLAVPAFGLSAGVGSLNAFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+T G+ TS F LS GVG  NA V EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATNGMTTSAFSLSSGVGVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGG+E   F LS GVG  NALV EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTTGGMEIGAFSLSNGVGVGNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  199



>ref|XP_006291577.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
 gb|EOA24475.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
Length=298

 Score =   179 bits (453),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G F+GGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LNA VFEIV
Sbjct  137  GVFIGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNAFVFEIV  196

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  197  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  245



>ref|XP_011077300.1| PREDICTED: aquaporin TIP1-1 [Sesamum indicum]
Length=252

 Score =   177 bits (449),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLG+V ACLLLKF+TGGL TS F LS GV   NA +FE V
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGAVVACLLLKFTTGGLTTSAFALSSGVSVWNAFIFETV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+GSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACJ83265.1| unknown [Medicago truncatula]
Length=223

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITL+RG+LY IAQLLGSV ACLLLK +TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHITLIRGLLYCIAQLLGSVVACLLLKIATGGLETSAFSLSSGVGATNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_011018806.1| PREDICTED: aquaporin TIP1-1 [Populus euphratica]
Length=252

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGS  ACLLLKF+TGGLETS F LS GV   NA V EIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTTGGLETSAFALSSGVSVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AAT08702.1| mitochondrial tonoplast intrinsic protein [Hyacinthus orientalis]
Length=220

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNITL RG+LYW+AQLLGS AACLLL+FSTG  ET  FGLSGV   NALV EIVM
Sbjct  90   GAFLGGNITLFRGLLYWVAQLLGSTAACLLLRFSTGE-ETGSFGLSGVSVWNALVLEIVM  148

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  149  TFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  196



>ref|NP_001274695.1| aquaporin TIP1-3-like [Solanum lycopersicum]
 dbj|BAO18633.1| tonoplast intrinsic protein 1;2 [Solanum lycopersicum]
Length=253

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R +LYWIAQLLGSV AC+LLKFSTGGLETS F LS GV   NA+VFEIV
Sbjct  91   GAFVGGHITLFRSVLYWIAQLLGSVVACVLLKFSTGGLETSAFALSSGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AHL24705.1| tonoplastic intrinsic protein, partial [Rosa hybrid cultivar]
Length=143

 Score =   173 bits (439),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYW+AQLLGS  ACLLLKF+T G  TS F LS GVG  NA VFEIV
Sbjct  25   GAFVGGNISLLRGILYWVAQLLGSTVACLLLKFATNGQTTSAFALSSGVGVWNAFVFEIV  84

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G++GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  85   MTFGLVYTVYATAVDPKRGNVGTIAPIAIGFIVGANILAGGAFDGASMN  133



>emb|CDP08994.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLR +LYWIAQLLG+V ACLLLKFSTGGLET+ F LS GV   NALVFEIV
Sbjct  91   GAFLGGHITLLRSVLYWIAQLLGAVVACLLLKFSTGGLETAAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDPKKGDLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AAD39372.1|AF118381_1 tonoplast intrinsic protein [Brassica napus]
Length=253

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRG+LYWIAQLLGSV ACLLLKF+TGGL    FGLS GV +LN  VFEIV
Sbjct  92   GAFLGGNITLLRGLLYWIAQLLGSVVACLLLKFATGGLAVPAFGLSAGVESLNGFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_009129499.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
 emb|CDY48983.1| BnaA02g28130D [Brassica napus]
 emb|CDY28539.1| BnaC02g36210D [Brassica napus]
Length=253

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRG+LYWIAQLLGSV AC LL+F+TGGL    FGLS GVG LN LVFEIV
Sbjct  92   GAFLGGNITLLRGLLYWIAQLLGSVVACFLLQFATGGLAVPAFGLSAGVGTLNGLVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_006350747.1| PREDICTED: aquaporin TIP1-3-like [Solanum tuberosum]
Length=253

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R +LYWIAQLLGSV AC+LLKFSTGGLETS F LS GV   NA+VFEIV
Sbjct  91   GAFVGGHITLFRSVLYWIAQLLGSVVACVLLKFSTGGLETSAFALSSGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea]
Length=252

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R I+YWIAQLLGSV ACLLLKF+TGGLETS F LS GV   NA++FEIV
Sbjct  91   GAFVGGHITLFRSIMYWIAQLLGSVIACLLLKFATGGLETSAFALSSGVTVWNAVIFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+TG L    FGLS GVG  NALVFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATGDLAVPAFGLSSGVGVSNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGSLGTIAP+AIGFI GANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSLGTIAPLAIGFIEGANILAGGAFDGASMN  199



>gb|AGG39699.1| aquaporin protein AQU21 [Camellia sinensis]
Length=252

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQ LGS+ ACLLLKF+TGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFLGGNITLLRGILYWIAQCLGSIVACLLLKFATGGLETSAFSLSIGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF G SMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIIAPIAIGFIVGANILAGGAFDGGSMN  199



>gb|AHW81522.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-c]
 gb|AHW81534.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-n]
Length=494

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACL+LKF+TGGL    FGLS GVG LNA VFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  199



>gb|EYU18933.1| hypothetical protein MIMGU_mgv1a012390mg [Erythranthe guttata]
Length=252

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+I+L R ILYWIAQLLGSV ACLLL F+TGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFVGGHISLFRSILYWIAQLLGSVVACLLLNFATGGLETSAFALSSGVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGVIAPIAIGFIVGANILAGGAFTGASMN  199



>ref|XP_007218847.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
 gb|EMJ20046.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
Length=252

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGG ET+ F LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGWETAAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGLIVGANILAGGAFDGASMN  199



>ref|XP_009152050.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
Length=253

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGSV ACLLLKF+TGGL    FGLS GV +LN  VFEIV
Sbjct  92   GAFVGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLAVPAFGLSAGVESLNGFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGA +GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGASSGASMN  200



>ref|XP_008343557.1| PREDICTED: aquaporin TIP1-3 [Malus domestica]
Length=252

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGG ET+ F LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGWETAXFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGLIVGANILAGGAFDGASMN  199



>ref|XP_008233574.1| PREDICTED: aquaporin TIP1-3 [Prunus mume]
Length=252

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGG ET+ F LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSVVACLLLKFATGGWETAAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGLIVGANILAGGAFDGASMN  199



>ref|XP_004985722.1| PREDICTED: aquaporin TIP1-1-like [Setaria italica]
Length=249

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RGILYWIAQLLGS  AC LL+FSTGGL T  FGL+G+    ALV EIVM
Sbjct  90   GAFVGGNITLFRGILYWIAQLLGSTVACFLLRFSTGGLPTGTFGLTGISVWEALVLEIVM  149

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  150  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  197



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFST G+ TS F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTNGMTTSAFSLSSGVTVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010911210.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITLLRGILYW AQLLGS  AC LL+FSTGGL T  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLLRGILYWFAQLLGSTIACFLLRFSTGGLSTGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPK+G+LGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKRGNLGTIAPIAIGFIVGANILAGGAFDGASMN  198



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKFST G+ TS F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTNGMTTSAFSLSSGVTVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|NP_189283.1| aquaporin TIP1-2 [Arabidopsis thaliana]
 sp|Q41963.2|TIP12_ARATH RecName: Full=Aquaporin TIP1-2; AltName: Full=Gamma-tonoplast 
intrinsic protein 2; Short=Gamma-TIP2; AltName: Full=Salt stress-induced 
tonoplast intrinsic protein; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=AtTIP1;2; Contains: RecName: 
Full=Aquaporin TIP1-2, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16271.1|AF428341_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 gb|AAL31945.1|AF419613_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAB01832.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
 gb|AAL84998.1| AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAH30470.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77174.1| aquaporin TIP1-2 [Arabidopsis thaliana]
Length=253

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G  +GGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LNALVFEIV
Sbjct  92   GVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_002876978.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53237.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G  +GGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LNALVFEIV
Sbjct  92   GVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            G F+GGNITLLR I+YWIAQLLGS  ACLLL++STGGL T  F LSGV    ALV EIVM
Sbjct  91   GVFIGGNITLLRSIIYWIAQLLGSTVACLLLRYSTGGLSTGSFALSGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  198



>ref|XP_002465859.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
 gb|EER92857.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
Length=250

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS  AC LL+FSTGGL T  FGL+GV    A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGLATGTFGLTGVSVWEAVVMEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAFTGASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFTGASMN  198



>ref|XP_008788358.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=414

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITLLRGILYWIAQLLGS  AC LL+FSTGGL T  FGL+G+    ALV EIVM
Sbjct  255  GAFVGGNITLLRGILYWIAQLLGSTIACFLLRFSTGGLSTGTFGLTGISVWEALVLEIVM  314

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  315  TFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMN  362



>ref|XP_010933183.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNITLLRGILYWIAQLLGS AACLLL+F TGGL T  FGL+GV    A V EIVM
Sbjct  91   GAFIGGNITLLRGILYWIAQLLGSTAACLLLRFCTGGLATGTFGLTGVTVWEAFVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPK+GSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKRGSLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>gb|AEV54105.1| putative tonoplast intrinsic protein 1.5 [Populus deltoides x 
Populus x canadensis]
Length=216

 Score =   174 bits (440),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITL RGILYWIAQLLGS  ACLLLKF TGGLETS F LS GVG  NA V EIV
Sbjct  74   GAFIGGNITLFRGILYWIAQLLGSTVACLLLKFVTGGLETSAFALSTGVGVWNAFVLEIV  133

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANIL GGAF GASMN
Sbjct  134  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILVGGAFDGASMN  182



>ref|XP_011089965.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=259

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            G FVGGNITL RGILY IAQLLGSV ACLLL F+TGGLET  F LSGV   +A VFEIVM
Sbjct  100  GLFVGGNITLFRGILYIIAQLLGSVVACLLLTFTTGGLETPAFSLSGVSVWSAFVFEIVM  159

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKG LGTIAPIAIGFIVGANILAGGAFTGASMN
Sbjct  160  TFGLVYTVYATAVDPKKGDLGTIAPIAIGFIVGANILAGGAFTGASMN  207



>sp|P50156.1|TIP11_ORYSJ RecName: Full=Probable aquaporin TIP1-1; AltName: Full=Tonoplast 
intrinsic protein 1-1; Short=OsTIP1;1; AltName: Full=rTIP1 
[Oryza sativa Japonica Group]
 gb|AAK98737.1|AC090485_16 Tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAA05017.1| gamma-Tip [Oryza sativa]
 gb|ABF93961.1| aquaporin TIP-type, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY88537.1| hypothetical protein OsI_10010 [Oryza sativa Indica Group]
 gb|EAZ25574.1| hypothetical protein OsJ_09399 [Oryza sativa Japonica Group]
 gb|ABP48112.1| water channel protein [Oryza sativa Japonica Group]
 dbj|BAG96434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   175 bits (443),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYWIAQLLGS  AC LL+FSTGGL T  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>ref|XP_009780564.1| PREDICTED: aquaporin TIP1-3 [Nicotiana sylvestris]
Length=252

 Score =   175 bits (443),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R +LYWIAQLLGSV AC+LLKF+TGGLETS F LS GV   NA+VFEIV
Sbjct  91   GAFVGGHITLFRSVLYWIAQLLGSVVACVLLKFATGGLETSAFALSTGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABK23010.1| unknown [Picea sitchensis]
Length=253

 Score =   175 bits (443),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITLLRGILYW AQL+G+  ACLLLKF+TGGL TS F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGHITLLRGILYWFAQLIGATVACLLLKFTTGGLSTSAFSLSSGVGVGNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGSLGTIAPI IGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSLGTIAPICIGFIVGANILAGGAFDGASMN  199



>gb|AAB62692.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
Length=273

 Score =   175 bits (444),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G  +GGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GVG+LNALVFEIV
Sbjct  112  GVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIV  171

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK GSLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  172  MTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMN  220



>gb|AGD98709.1| aquaporin protein 6 [Camellia sinensis]
Length=252

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLR ILYWIAQ LGSV ACLLLKF+TGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFLGGHITLLRSILYWIAQCLGSVVACLLLKFATGGLETSAFSLSSGVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAF  ASMN
Sbjct  151  MTFGLVYTVYATALDPKKGDLGIIAPIAIGFIVGANILAGGAFDDASMN  199



>ref|XP_009421351.1| PREDICTED: probable aquaporin TIP1-2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAF+GGNI+L+RGILYWIAQLLGSV ACLLLK +TGGLETS F LS  V   NA+VFEIV
Sbjct  91   GAFLGGNISLIRGILYWIAQLLGSVVACLLLKLATGGLETSAFSLSSDVSVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDP+KG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPRKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006649396.1| PREDICTED: probable aquaporin TIP1-1-like [Oryza brachyantha]
Length=250

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS  AC LL+FSTGGL T  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGLATGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>ref|XP_009624595.1| PREDICTED: aquaporin TIP1-3 [Nicotiana tomentosiformis]
Length=252

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R +LYWIAQLLGSV AC+LLKF+TGGLETS F LS GV   NA+VFEIV
Sbjct  91   GAFVGGHITLFRSVLYWIAQLLGSVVACVLLKFATGGLETSAFALSTGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK+G+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKRGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010043596.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 ref|XP_010042712.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW85618.1| hypothetical protein EUGRSUZ_B02403 [Eucalyptus grandis]
Length=252

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAFVGG+ITL R +LYW+AQLLGSV ACLLLKFSTGG+ETS F LS  V   NALVFEIV
Sbjct  91   GAFVGGHITLSRSVLYWVAQLLGSVVACLLLKFSTGGMETSAFSLSSDVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIVAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGS+ ACLLLKFST G+ TS F LS GV   NA VFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSIVACLLLKFSTNGMSTSAFSLSSGVSVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004304478.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  ACLLLKF T G  TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+GS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AGD98711.1| aquaporin protein 8 [Camellia sinensis]
Length=252

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQ LGS+ ACLLLKF+TGGLETS F LS GV    ALVFEIV
Sbjct  91   GAFLGGNITLLRGILYWIAQCLGSIVACLLLKFATGGLETSAFSLSIGVSVWKALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF G SMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIIAPIAIGFIVGANILAGGAFDGGSMN  199



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+T GL    FGLS GVGALNA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATSGLGVPAFGLSSGVGALNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G+LG IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGNLGVIAPLAIGLIVGANILAGGAFDGASMN  199



>ref|XP_002322910.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93416.1| unknown [Populus trichocarpa]
 gb|ABK93851.1| unknown [Populus trichocarpa]
 gb|EEF04671.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITL RGILYWIAQLLGS  ACLLLKF TGGLETS F LS GVG  NA V EIV
Sbjct  91   GAFIGGNITLFRGILYWIAQLLGSTVACLLLKFVTGGLETSAFALSTGVGVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILVGGAFDGASMN  199



>ref|XP_003552678.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
Length=252

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQL GSV AC+LLK +TGG+ETSGF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRSILYWIAQLFGSVVACILLKHATGGMETSGFSLSPGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+ G +APIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNAGVVAPIAIGFIVGANILVGGAFDGASMN  199



>gb|KHG16987.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLR   YWIAQLLGSV ACLLLKF+TGG+ETS F LS GV   NAL+FEIV
Sbjct  91   GAFIGGHITLLRSFWYWIAQLLGSVVACLLLKFATGGMETSAFALSSGVSTWNALIFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIV ANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVAANILAGGAFDGASMN  199



>ref|XP_003518658.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN27207.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLGSV AC+LLK +TGG+ET+GF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRSILYWIAQLLGSVVACILLKSATGGMETTGFSLSPGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGVVAPIAIGFIVGANILVGGAFDGASMN  199



>gb|KHN13870.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQL GSV AC+LLK +TGG+ETSGF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRSILYWIAQLFGSVVACILLKHATGGMETSGFSLSPGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+ G +APIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNAGVVAPIAIGFIVGANILVGGAFDGASMN  199



>gb|ABK25915.1| unknown [Picea sitchensis]
Length=253

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA VGG+ITLLRGILYWIAQL+G+  ACLLLK++TGGL TS F LS GVG  NALVFEIV
Sbjct  91   GALVGGHITLLRGILYWIAQLIGATVACLLLKYTTGGLSTSAFSLSSGVGVGNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LGTIAPI IGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGTLGTIAPICIGFIVGANILAGGAFDGASMN  199



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITL RG+LYWIAQLLGS  ACLLLKF TGGLETS F LS GVG  NA V EIV
Sbjct  91   GAFIGGNITLFRGVLYWIAQLLGSTVACLLLKFVTGGLETSAFALSSGVGVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGANILVGGAFDGASMN  199



>ref|XP_003558815.1| PREDICTED: aquaporin TIP1-1 [Brachypodium distachyon]
Length=250

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNITL RG+LYW+AQLLGS AAC LL+FSTGGL T  FGL+GV    ALV EIVM
Sbjct  91   GAFLGGNITLFRGLLYWVAQLLGSTAACFLLRFSTGGLPTGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGS+GTIAP+AIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSIGTIAPLAIGFIVGANILVGGAFDGASMN  198



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+T GL    FGLS GVG  NA VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATNGLSIPAFGLSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKGS+G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGSVGVIAPLAIGLIVGANILAGGAFEGASMN  199



>ref|XP_009404620.1| PREDICTED: aquaporin TIP1-1-like [Musa acuminata subsp. malaccensis]
Length=252

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAF+GGNITLLRGILYWIAQLLGSV ACLLLKF+TGGLET+ F LS  V   NALVFEIV
Sbjct  91   GAFLGGNITLLRGILYWIAQLLGSVVACLLLKFATGGLETTPFSLSSSVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG IAP+AIG +VGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGIIAPLAIGLVVGANILAGGAFDGASMN  199



>gb|KFK33580.1| hypothetical protein AALP_AA5G032300 [Arabis alpina]
Length=253

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGL-SGVGALNALVFEIV  148
            GA +GGNITLLRGILYWIAQLLGSV AC LL+F+TGGL    FGL +GVG+LNALV EIV
Sbjct  92   GALLGGNITLLRGILYWIAQLLGSVVACFLLQFATGGLPVPAFGLGAGVGSLNALVLEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGG F+GASMN
Sbjct  152  MTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGPFSGASMN  200



>ref|XP_007139266.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
 gb|ESW11260.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
Length=252

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLR ILYWIAQLLGSV AC+LLK +TGG+ETSGF LS GV   NAL+FE+V
Sbjct  91   GAFVGGNITLLRSILYWIAQLLGSVVACILLKSATGGMETSGFSLSPGVSVWNALIFEVV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIGF+VGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGFLVGANILVGGAFDGASMN  199



>emb|CAB61841.1| putative gamma tonoplast intrinsic protein (TIP) [Sporobolus 
stapfianus]
Length=250

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNI+L R ILYWIAQLLGS+ ACLLL+F TGGL T  FGL+G+    ALV EIVM
Sbjct  90   GAFLGGNISLFRSILYWIAQLLGSIVACLLLRFVTGGLPTGTFGLTGISVWEALVLEIVM  149

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  150  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  197



>ref|XP_009401846.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRG+LYW+AQLLGS AACLLL F+TGGLET  FGLS GVG   ALV E V
Sbjct  91   GAFVGGNITLLRGVLYWVAQLLGSTAACLLLHFATGGLETGTFGLSSGVGVWEALVLEAV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDP++GSLG IAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPRRGSLGAIAPIAIGFIVGANILVGGAFDGASMN  199



>ref|XP_004307558.1| PREDICTED: aquaporin TIP1-3-like [Fragaria vesca subsp. vesca]
Length=252

 Score =   172 bits (437),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR  LYWIAQLLGSV ACLLLKF+TGGLET+ F LS GV   NALVFEIV
Sbjct  91   GAFLGGNITLLRASLYWIAQLLGSVVACLLLKFATGGLETAAFSLSSGVSIWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGIVAPIAIGLIVGANILAGGAFDGASMN  199



>gb|KHN33410.1| Aquaporin TIP1-3 [Glycine soja]
Length=162

 Score =   169 bits (429),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKF+TGGLETS F LS GV A NALVFEIV
Sbjct  50   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFATGGLETSAFALSPGVEAGNALVFEIV  109

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG I PIAIGFIVGANILAGG F G+S  
Sbjct  110  MTFGLVYTVYATAVDPKKGDLGIIPPIAIGFIVGANILAGGTFDGSSCQ  158



>ref|NP_001241727.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG25449.1| aquaporin TIP1.1 [Zea mays]
Length=250

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS  AC LL+FSTGG  T  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>gb|ACJ53709.1| tonoplast intrinsic protein 1-2 [Lolium perenne]
Length=249

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGNITL RG+LYWIAQLLGS AAC LL+F+TGGL T  F LSGV    ALV EIVM
Sbjct  90   GAFLGGNITLFRGLLYWIAQLLGSTAACFLLRFATGGLPTGFFALSGVSCWEALVLEIVM  149

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKG LGTIAPIAIGFIVGANIL GGAF+GASMN
Sbjct  150  TFGLVYTVYATAVDPKKGELGTIAPIAIGFIVGANILVGGAFSGASMN  197



>ref|NP_001104896.1| aquaporin TIP1-1 [Zea mays]
 sp|O64964.1|TIP11_MAIZE RecName: Full=Aquaporin TIP1-1; AltName: Full=Tonoplast intrinsic 
protein 1-1; AltName: Full=ZmTIP1-1; AltName: Full=ZmTIP1;1; 
Short=ZmTIP1 [Zea mays]
 gb|AAC09245.1| tonoplast intrinsic protein [Zea mays]
 gb|AAO86709.1| tonoplast water channel [Zea mays]
 gb|ACF85770.1| unknown [Zea mays]
 gb|ACF85962.1| unknown [Zea mays]
 gb|ACG23904.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG24935.1| aquaporin TIP1.1 [Zea mays]
 gb|ACN31200.1| unknown [Zea mays]
 gb|ACN33327.1| unknown [Zea mays]
Length=250

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYW+AQLLGS  AC LL+FSTGG  T  FGL+GV    ALV EIVM
Sbjct  91   GAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGLTGVSVWEALVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>ref|XP_008788076.1| PREDICTED: aquaporin TIP1-3-like [Phoenix dactylifera]
Length=252

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAFVGGNITLLR ILYW+AQLLGSV AC+LLKF TGG++T+ F +S  V  +NA VFEIV
Sbjct  91   GAFVGGNITLLRAILYWMAQLLGSVVACILLKFGTGGMKTAAFAVSADVTPMNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAM44345.1| vacuolar aluminum transporter [Hydrangea macrophylla]
Length=252

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNIT LR ILYWIAQLLGSV ACLLLKF+TGGLETS F LS  V   NALVFEIV
Sbjct  91   GAFLGGNITFLRSILYWIAQLLGSVVACLLLKFATGGLETSAFALSSNVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYA AVDPKKG+LG IAPIAIGFIVGANIL GGAF G SMN
Sbjct  151  MTFGLVYTVYALAVDPKKGNLGIIAPIAIGFIVGANILVGGAFDGGSMN  199



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF+TGGL TS F LS GV   NA V EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVACLLLKFATGGLTTSAFSLSSGVSVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG++G +AP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNIGIVAPMAIGFIVGANILAGGAFDGASMN  199



>gb|AAC62397.1| gamma tonoplast intrinsic protein 2 [Arabidopsis thaliana]
Length=253

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G  +GGNITLLRGILYWIAQLLGSVAAC LL F+TGG     FGLS GV +LNALVFEIV
Sbjct  92   GVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVRSLNALVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK  SLGTIAPIAIGFIVGANILAGGAF+GASMN
Sbjct  152  MTFGLVYTVYATAVDPKNASLGTIAPIAIGFIVGANILAGGAFSGASMN  200



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  ACLLLKF+T  +    FGLS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSTVACLLLKFATSDMTVPAFGLSSGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004492091.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=250

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLGSV AC+LLK +TGG+ETS F +S  +   NALVFEIV
Sbjct  91   GAFMGGNITLLRSILYWIAQLLGSVVACILLKSATGGMETSAFAISSDISVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +APIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNVGVVAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CAC81985.1| putative aquaporin [Posidonia oceanica]
Length=142

 Score =   167 bits (423),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNIT LRGILYW  QLLGS+ ACLLLKF TGG+ T GF +SGV   NALVFEIVM
Sbjct  13   GAFVGGNITFLRGILYWHGQLLGSIVACLLLKFVTGGMTTGGFAVSGVSVWNALVFEIVM  72

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKG++GTIAP+AIG IV ANI  GG FTGASMN
Sbjct  73   TFGLVYTVYATAIDPKKGAIGTIAPLAIGLIVAANIFDGGVFTGASMN  120



>ref|XP_010922400.1| PREDICTED: aquaporin TIP1-3-like [Elaeis guineensis]
Length=252

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAFVGGN+TLLR ILYWIAQLLGSV AC+LLKF+TGG++T+ F +S  V  +NA V EIV
Sbjct  91   GAFVGGNVTLLRAILYWIAQLLGSVVACILLKFATGGMKTAAFAVSADVTPMNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_008357781.1| PREDICTED: aquaporin TIP1-3-like [Malus domestica]
Length=252

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+IT +R ILYWIAQL+G+V ACLLLKF+TGGLETS F LS GV   NALV EIV
Sbjct  91   GAFIGGHITFVRTILYWIAQLIGAVVACLLLKFATGGLETSAFSLSSGVSVWNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATAVDPKKGS+GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  151  ITFGLVYTVYATAVDPKKGSIGTIAPIAIGFIVGANILVAGAFDGASMN  199



>ref|XP_010554597.1| PREDICTED: aquaporin TIP1-3 [Tarenaya hassleriana]
Length=253

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLR ILYWIAQLLGSV ACLLLK  TGGLETS F LS GV   NA+V EIV
Sbjct  91   GAFVGGNITLLRAILYWIAQLLGSVVACLLLKIGTGGLETSAFALSSGVTPWNAVVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGVIAPLAIGLIVGANILAGGAFDGASMN  199



>ref|XP_010456993.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=238

 Score =   169 bits (429),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ETS F LS GV   NA++FEIV
Sbjct  77   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETSAFSLSYGVTPWNAVIFEIV  136

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  137  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  185



>gb|AAB17284.1| tonoplast intrinsic protein [Mesembryanthemum crystallinum]
Length=253

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAF+GGNI+LLRGI+YWIAQL GS  ACLLLKF+TGGLETS F LS  V   NALVFEIV
Sbjct  91   GAFIGGNISLLRGIVYWIAQLAGSSVACLLLKFATGGLETSAFALSADVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+D K+G+LG IAPIAIGFIVGANIL GGAFTGASMN
Sbjct  151  MTFGLVYTVYATAIDHKRGNLGIIAPIAIGFIVGANILVGGAFTGASMN  199



>ref|XP_006286822.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
 gb|EOA19720.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
Length=252

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ETS F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETSAFSLSYGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|XP_010669827.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSG-VGALNALVFEIV  148
            GAFVGG+IT LR ILYWI QLLGSV AC LL F+TGG+E S F LSG V + NALVFEIV
Sbjct  91   GAFVGGHITFLRAILYWIGQLLGSVVACFLLHFATGGMEVSAFALSGGVTSWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYA AVDPKKG+LGTIAPIAIGFIVGANILAGG F GASMN
Sbjct  151  MTFGLVYTVYALAVDPKKGNLGTIAPIAIGFIVGANILAGGPFDGASMN  199



>ref|XP_010428353.1| PREDICTED: aquaporin TIP1-3 [Camelina sativa]
Length=252

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ETS F LS GV   NA++FEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETSAFSLSYGVTPWNAVIFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  ACLLLKF+T  +    FGLS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSTVACLLLKFATSDMTVPAFGLSSGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIVGANILAGGAFDGASMN  199



>ref|XP_010422715.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=252

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ETS F LS GV   NA++FEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETSAFSLSYGVTPWNAVIFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|XP_002523724.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF38664.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRGILYWIAQLLGS  ACLLLKFST G+ TS F LS GV   NA VFEIV
Sbjct  92   GAFLGGNISLLRGILYWIAQLLGSTVACLLLKFSTHGMTTSAFALSSGVNVWNAFVFEIV  151

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKK  +G IAP+AIGF+VGANILAGGAF GASMN
Sbjct  152  MTFGLVYTVYATAIDPKKSEVGIIAPLAIGFVVGANILAGGAFEGASMN  200



>ref|XP_009338345.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+IT +R ILYWIAQL+G+V ACLLLKF+TGGLETS F LS GVG  NA+V EIV
Sbjct  91   GAFIGGHITFVRTILYWIAQLIGAVIACLLLKFATGGLETSAFSLSSGVGVWNAVVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATAVDPKKG++GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  151  ITFGLVYTVYATAVDPKKGNIGTIAPIAIGFIVGANILVAGAFDGASMN  199



>ref|XP_009358317.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+IT +R ILYWI+QL+G+V ACLLLKF+TGGLETS F LS GV   NALV EIV
Sbjct  91   GAFIGGHITFVRTILYWISQLIGAVVACLLLKFATGGLETSAFSLSSGVSVWNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATAVDPKKGS+GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  151  ITFGLVYTVYATAVDPKKGSIGTIAPIAIGFIVGANILVAGAFDGASMN  199



>ref|XP_004971442.1| PREDICTED: probable aquaporin TIP1-2-like [Setaria italica]
Length=252

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGNITLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_009111380.1| PREDICTED: aquaporin TIP1-3 [Brassica rapa]
 emb|CDY69446.1| BnaA09g51590D [Brassica napus]
 emb|CDY07142.1| BnaCnng01570D [Brassica napus]
Length=252

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ET+ F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSHGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|NP_192056.1| aquaporin TIP1-3 [Arabidopsis thaliana]
 sp|O82598.1|TIP13_ARATH RecName: Full=Aquaporin TIP1-3; AltName: Full=Gamma-tonoplast 
intrinsic protein 3; Short=Gamma-TIP3; AltName: Full=Tonoplast 
intrinsic protein 1-3; Short=AtTIP1;3; Contains: RecName: 
Full=Aquaporin TIP1-3, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAC62778.1| F11O4.1 [Arabidopsis thaliana]
 emb|CAB77717.1| putative water channel protein [Arabidopsis thaliana]
 gb|ABE66039.1| major intrinsic family protein/MIP family protein [Arabidopsis 
thaliana]
 gb|AEE82031.1| aquaporin TIP1-3 [Arabidopsis thaliana]
Length=252

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ET+ F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|NP_001234103.1| aquaporin-like [Solanum lycopersicum]
 dbj|BAD95790.1| similar to aquaporin [Solanum lycopersicum]
 dbj|BAO18632.1| tonoplast intrinsic protein 1;1 [Solanum lycopersicum]
Length=250

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY IAQLLGS AAC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  90   GAFVGGNITLFRGILYIIAQLLGSTAACALLEFATGGMSTGSFALSAGVSVWNAFVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  198



>gb|ABK28617.1| unknown [Arabidopsis thaliana]
Length=253

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ET+ F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|XP_006396348.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
 gb|ESQ37801.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
Length=252

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITL+R ILYWIAQLLG+V ACLLLK STGG+ET+ F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLMRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|XP_006347203.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=250

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY IAQLLGS AAC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  90   GAFVGGNITLFRGILYIIAQLLGSTAACALLEFATGGMSTGSFALSAGVSVWNAFVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  198



>emb|CAC85291.1| putative tonoplast intrinsic protein [Posidonia oceanica]
Length=250

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNIT LRGILYW  QLLGS+ ACLLLKF TGG+ T GF +SGV   NALVFEIVM
Sbjct  91   GAFVGGNITFLRGILYWHGQLLGSIVACLLLKFVTGGMTTGGFAVSGVSVWNALVFEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKG++GTIAP+AIG IV ANI  GG FTGASMN
Sbjct  151  TFGLVYTVYATAIDPKKGAIGTIAPLAIGLIVAANIFVGGVFTGASMN  198



>gb|KFK30698.1| hypothetical protein AALP_AA6G016000 [Arabis alpina]
Length=252

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLG+V ACLLLK STGG+ET  F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETGAFSLSHGVEPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMN  199



>ref|XP_010033163.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW52713.1| hypothetical protein EUGRSUZ_J02074 [Eucalyptus grandis]
Length=251

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ++YWIAQ  GSV ACLLLKF+TGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFVGGHITLARSVMYWIAQCAGSVVACLLLKFATGGLETSAFSLSSGVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG++G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNIGIIAPLAIGLIVGANILAGGAFDGASMN  199



>ref|XP_010696310.1| PREDICTED: probable aquaporin TIP1-2 [Beta vulgaris subsp. vulgaris]
Length=254

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGL-SGVGALNALVFEIV  148
            GAFVGGNITLL GI+YWIAQLLGSVAAC LLKF+TGGLET+ F   + V A NALV EIV
Sbjct  91   GAFVGGNITLLNGIVYWIAQLLGSVAACALLKFATGGLETAAFACATDVSAWNALVMEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG++G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNIGIIAPLAIGLIVGANILAGGAFDGASMN  199



>ref|XP_008366336.1| PREDICTED: probable aquaporin TIP1-2 [Malus domestica]
Length=252

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+IT +R ILYWIAQL+G+V ACLLLK +TGGLETS F LS GVG  NA+V EIV
Sbjct  91   GAFIGGHITFVRTILYWIAQLIGAVIACLLLKLATGGLETSAFSLSSGVGVWNAVVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATAVDPKKGS+GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  151  ITFGLVYTVYATAVDPKKGSIGTIAPIAIGFIVGANILVAGAFDGASMN  199



>ref|XP_002872891.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49150.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR +LYWIAQLLG+V ACLLLK STGG+ET+ F LS GV   NA+VFEIV
Sbjct  91   GAFIGGNITLLRAVLYWIAQLLGAVVACLLLKVSTGGMETAAFSLSHGVTPWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G +AP+AIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIVAPLAIGLIVGANILVGGAFDGASMN  199



>gb|ACJ53708.1| tonoplast intrinsic protein 1-1 [Lolium perenne]
Length=252

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LGTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_007202475.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
 gb|EMJ03674.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
Length=252

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  AC LL+F+T    TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSAVACGLLRFATNYQTTSAFALSEGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK+GS+GTIAPIAIGF+VGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKRGSVGTIAPIAIGFVVGANILAGGAFDGASMN  199



>ref|XP_007142715.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
 gb|ESW14709.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
Length=252

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLL+ ILYWIAQLLGSV AC LL ++TGG+ET+GF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLKSILYWIAQLLGSVVACFLLNYTTGGMETTGFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G++G +AP+AIG +VGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGNVGVVAPLAIGLVVGANILVGGAFDGASMN  199



>ref|XP_009349744.1| PREDICTED: aquaporin TIP1-1-like [Pyrus x bretschneideri]
Length=252

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRGILYWIAQLLG+  AC LLKF T G  T+ F LS GVG  NA VFEIV
Sbjct  91   GAFIGGNISLLRGILYWIAQLLGATVACGLLKFVTNGQTTAAFSLSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAB12722.1| gamma tonoplast intrinsic protein [Pyrus communis]
Length=252

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRGILYWIAQLLG+  AC LLKF T G  T+ F LS GVG  NA VFEIV
Sbjct  91   GAFIGGNISLLRGILYWIAQLLGATVACGLLKFVTNGQTTAAFSLSSGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK GS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKNGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_009613493.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY IAQLLGS  AC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLFRGILYIIAQLLGSTVACFLLEFATGGMSTGAFALSAGVSVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  199



>ref|NP_001045562.1| Os01g0975900 [Oryza sativa Japonica Group]
 sp|Q94CS9.1|TIP12_ORYSJ RecName: Full=Probable aquaporin TIP1-2; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=OsTIP1;2 [Oryza sativa Japonica 
Group]
 dbj|BAB63833.1| tonoplast membrane integral protein [Oryza sativa Japonica Group]
 dbj|BAC79358.1| tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF07476.1| Os01g0975900 [Oryza sativa Japonica Group]
 dbj|BAG99409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=252

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+L++ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_009800738.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
 emb|CAA69353.1| aquaporin 1 [Nicotiana tabacum]
Length=251

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY +AQLLGS  AC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLFRGILYIVAQLLGSTVACFLLEFATGGMSTGAFALSAGVSVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  199



>gb|AAG44946.1|AF290619_1 putative gamma TIP [Nicotiana glauca]
Length=251

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY +AQLLGS  AC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLFRGILYIVAQLLGSTVACFLLEFATGGMSTGAFALSAGVSVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  199



>gb|AAL16972.1|AF367456_1 gamma-tonoplast intrinsic protein [Prunus persica]
Length=136

 Score =   162 bits (411),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+L+R +LYWIAQLLG+V ACLLL+F+TGGLETS F LS GV   NA+V EIV
Sbjct  11   GAFIGGNISLVRSVLYWIAQLLGAVIACLLLRFATGGLETSAFSLSSGVSVWNAVVLEIV  70

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATA+DPKKG++G IAPI IGFIVGANIL  GAF GASMN
Sbjct  71   ITFGLVYTVYATALDPKKGNIGIIAPIVIGFIVGANILVAGAFDGASMN  119



>emb|CAE53878.1| putative aquaporin [Ricinus communis]
Length=141

 Score =   163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV + NA+VFEIV
Sbjct  9    GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIV  68

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  69   MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  117



>dbj|BAF95576.1| tonoplast intrinsic protein [Nicotiana tabacum]
Length=251

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITL RGILY IAQLLGS  AC LL+F+TGG+ T  F LS GV   NA VFEIV
Sbjct  91   GAFVGGNITLFRGILYIIAQLLGSTVACFLLEFATGGMSTGAFALSAGVSVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  199



>gb|EMS45815.1| putative aquaporin TIP1-1 [Triticum urartu]
Length=201

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL RG+LYWIAQLLGS AAC LL+FSTGGL T  FGLSG+GA  A+V EIVM
Sbjct  91   GAFVGGNITLFRGLLYWIAQLLGSTAACFLLRFSTGGLPTGTFGLSGIGAWEAVVLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL  34
            TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL
Sbjct  151  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANIL  187



>gb|ACV52008.1| tonoplast aquaporin 1;1 [Daucus carota]
Length=251

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNITL++GILY IAQ LGS  ACLLL F+TGG+ TS F LSGV   +A VFEIVM
Sbjct  91   GAFVGGNITLVKGILYVIAQCLGSTVACLLLSFTTGGMPTSAFALSGVSIWSAFVFEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYA AVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  151  TFGLVYTVYAVAVDPKKGDLGIIAPIAIGFIVGANILAGGAFTGASMN  198



>gb|ACY74345.1| aquaporin-like protein [Capsicum annuum]
Length=250

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGGNIT  RG+LY IAQLLGS AAC LL F+TGG+ T  F +SGV   +ALVFEIVM
Sbjct  90   GAFVGGNITFFRGLLYIIAQLLGSTAACALLVFATGGMSTGSFAVSGVTVWSALVFEIVM  149

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  TFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  197



>ref|XP_003565186.1| PREDICTED: probable aquaporin TIP1-2 [Brachypodium distachyon]
Length=252

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LL+ I+YW+AQLLGS AACLLL+ STGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFIGGNISLLKAIVYWVAQLLGSTAACLLLQISTGGASVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACB71282.1| tonoplast intrinsic protein [Tamarix hispida]
Length=252

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+I+LLR ILYWIAQ LGSV ACLLLKF+TGGL TS F LS  V   NALV EIV
Sbjct  91   GAFIGGHISLLRSILYWIAQCLGSVVACLLLKFATGGLTTSAFALSSDVTVWNALVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAP+AIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPMAIGFIVGANILVGGAFDGASMN  199



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  A LLLKF TGGL    F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSTVAALLLKFVTGGLAVPTFNLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            +TFGLVYTVYATAVDPKKG+LG IAPIAIGFIVGANILA G F GASMN
Sbjct  151  ITFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGANILAAGPFDGASMN  199



>dbj|BAD04010.1| tonoplast intrinsic protein [Prunus persica]
Length=252

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  AC LL+F+     TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSAVACGLLRFAPNYQTTSAFALSEGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK+GS+GTIAPIAIGF+VGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKRGSVGTIAPIAIGFVVGANILAGGAFDGASMN  199



>ref|XP_003536771.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN37323.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITLLR ILYWIAQLLGSV AC+LLK +TGG+ETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGNITLLRSILYWIAQLLGSVVACILLKVATGGMETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLV+TVYAT VDPKKG++G I PIAIG IVGANIL GGAF GASMN
Sbjct  151  MTFGLVHTVYATTVDPKKGNVGVIGPIAIGSIVGANILVGGAFDGASMN  199



>gb|ADD59910.1| aquaporin [Chimonanthus praecox]
Length=269

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+L RGILYWIAQLLG+  ACLLLKF T G+ TS F LS G    NA V EIV
Sbjct  91   GAFVGGNISLFRGILYWIAQLLGATVACLLLKFCTRGMTTSAFSLSAGESVWNAFVMEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGS+GTIAP+AIGFIVGANILAGGAF G SMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSVGTIAPLAIGFIVGANILAGGAFDGGSMN  199



>ref|XP_008350342.1| PREDICTED: aquaporin TIP1-1-like [Malus domestica]
Length=252

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRG+LYWIAQLLG+  AC LLK  T G  T+ F LS GVG  NA VFEIV
Sbjct  91   GAFIGGNISLLRGLLYWIAQLLGATVACGLLKLVTNGQTTAAFSLSPGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACF78734.1| unknown [Zea mays]
 gb|AFW83841.1| aquaporin TIP1-2 [Zea mays]
Length=254

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA+NA+V E+V
Sbjct  91   GAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAAIGAFSLSAGVGAMNAVVLEMV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_008387528.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Malus domestica]
Length=252

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRG+LYWIAQLLG+  AC LLK  T G  T+ F LS GVG  NA VFEIV
Sbjct  91   GAFIGGNISLLRGLLYWIAQLLGATVACGLLKLVTNGQTTAAFSLSPGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABP35520.1| tonoplast intrinsic protein [Ipomoea batatas]
Length=251

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAFVGG+ITLLR ++YWIAQLLGSV ACLLLKF+TGGLET  FGLSGVG  NA+VFEIVM
Sbjct  91   GAFVGGHITLLRSVVYWIAQLLGSVVACLLLKFATGGLETPAFGLSGVGPWNAVVFEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  TFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  198



>gb|AEQ29861.1| aquaporin TIP1 [Malus prunifolia]
Length=252

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNI+LLRG+LYWIAQLLG+  AC LLK  T G  T+ F LS GVG  NA VFEIV
Sbjct  91   GAFIGGNISLLRGLLYWIAQLLGATVACGLLKLVTNGQTTAAFSLSPGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKGS+GTIAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGSVGTIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ACG35910.1| aquaporin TIP1.2 [Zea mays]
Length=254

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA+NA+V E+V
Sbjct  91   GAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAAIGAFSLSAGVGAMNAVVLEMV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_008241379.1| PREDICTED: aquaporin TIP1-1 [Prunus mume]
Length=252

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LLRGILYWIAQLLGS  AC LLKF+T    TS F LS GVG  NA VFEIV
Sbjct  91   GAFVGGNISLLRGILYWIAQLLGSAVACGLLKFATNYQTTSAFALSEGVGVWNAFVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK+GS+GTIAPIAIG +VGAN+LAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKRGSVGTIAPIAIGLVVGANVLAGGAFDGASMN  199



>ref|NP_001105029.1| aquaporin TIP1-2 [Zea mays]
 sp|Q9ATM0.1|TIP12_MAIZE RecName: Full=Aquaporin TIP1-2; AltName: Full=Tonoplast intrinsic 
protein 1-2; AltName: Full=ZmTIP1-2; AltName: Full=ZmTIP1;2 
[Zea mays]
 gb|AAK26767.1| tonoplast membrane integral protein ZmTIP1-2 [Zea mays]
 gb|ACG36209.1| aquaporin TIP1.2 [Zea mays]
Length=254

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA+NA+V E+V
Sbjct  91   GAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAI66439.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 gb|ADW85674.1| tonoplast intrinsic protein TIP1;3 [Hordeum vulgare]
 dbj|BAJ87160.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   164 bits (416),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAJ98454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   164 bits (416),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABI96817.1| tonoplast intrinsic protein [Triticum aestivum]
Length=252

 Score =   164 bits (416),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|EMT32480.1| Putative aquaporin TIP1-2 [Aegilops tauschii]
Length=252

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+LL+ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLLKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSAGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAP33939.1| tonoplast intrinsic protein [Triticum aestivum]
Length=252

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+L++ ++YW+AQLLGSV ACLLLK +TGG     F LS GVG  NA+VFEIV
Sbjct  91   GAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGEAVGAFSLSVGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDLGVIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ABB29477.1| tonoplast intrinsic protein [Panax ginseng]
Length=250

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            GAF+GGN+TL+RGILY IAQLLGS  ACLLL F+TGG   S F LSGV   +A VFEIVM
Sbjct  91   GAFIGGNLTLIRGILYIIAQLLGSTVACLLLSFATGGSPISAFALSGVSVWSAFVFEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATA+DPKKG LG IAPIAIG IVGANILAGGAFTGASMN
Sbjct  151  TFGLVYTVYATAIDPKKGELGIIAPIAIGLIVGANILAGGAFTGASMN  198



>ref|XP_004497305.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNIT LR ILYWIAQLLGSVAAC++L   TGG+ETS F LS GV   NALVFEIV
Sbjct  91   GAFIGGNITFLRSILYWIAQLLGSVAACIILNSCTGGMETSAFSLSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+LG +AP+AIG +VGANIL GG F GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNLGVVAPLAIGCVVGANILVGGVFDGASMN  199



>ref|XP_009592994.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGL-SGVGALNALVFEIV  148
            GAF+GGNIT  RGILY IAQLLGS  ACLLLKF+TGGL T  F L SG+   NALVFEIV
Sbjct  91   GAFIGGNITFFRGILYIIAQLLGSTVACLLLKFATGGLSTGAFALCSGLSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG LG IAPI+IGFIVGANILAGG F GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGELGVIAPISIGFIVGANILAGGPFDGASMN  199



>gb|EAZ15017.1| hypothetical protein OsJ_04959 [Oryza sativa Japonica Group]
Length=252

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNI+L++ ++YW+AQLLGSV ACLLLK +TGG     F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAG AF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGCAFDGASMN  199



>gb|ADE76384.1| unknown [Picea sitchensis]
Length=253

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA VGG+ITLLRGILYW+ QL+G+  ACLLL F+TGGL T+ F LS GVG  NALVFEIV
Sbjct  91   GALVGGHITLLRGILYWLVQLIGATVACLLLDFTTGGLSTTAFSLSSGVGVGNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG+L TIAP+ IGFIV ANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGTLATIAPLCIGFIVSANILAGGAFDGASMN  199



>gb|AAL49753.1|AF452015_1 aquaporin-like protein [Petunia x hybrida]
Length=250

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNIT  RGILY IAQLLGS AAC +L+F+TG + T  F LS GVG  NALVFEIV
Sbjct  91   GAFIGGNITFFRGILYIIAQLLGSTAACFILEFTTG-MSTGSFALSDGVGVWNALVFEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG LG IAPIAIGFIVGANILAGGAFTGASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMN  198



>gb|AFK34456.1| unknown [Lotus japonicus]
Length=252

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITL+RG+LYWIAQLLGSV ACLLLKF+TGGLETS F LS GVGA NALVFEIV
Sbjct  91   GAFIGGHITLIRGLLYWIAQLLGSVVACLLLKFATGGLETSAFSLSSGVGASNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_002531978.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF30414.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG+ITLLRGILYWIAQLLGSV ACLLLKFSTGGLETS F LS GV + NA+VFEIV
Sbjct  91   GAFIGGHITLLRGILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|ADE34285.1| aquaporin TIP1;10, partial [Gossypium hirsutum]
Length=179

 Score =   160 bits (404),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGGL TS F LS GVGA NA+VFEIV
Sbjct  53   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGLTTSAFALSSGVGAWNAVVFEIV  112

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  113  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  161



>gb|ADE34287.1| aquaporin TIP1;12, partial [Gossypium hirsutum]
Length=179

 Score =   160 bits (404),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGG+ TS F LS GVGA NA+VFEIV
Sbjct  53   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGMTTSAFSLSSGVGAWNAVVFEIV  112

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  113  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  161



>ref|XP_008795635.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            G F+GG ITLLRGILYWIAQ LGS  ACLLL+ STGGL T  FGL+GVG   AL+ EIVM
Sbjct  91   GVFIGGRITLLRGILYWIAQFLGSTVACLLLRLSTGGLATGTFGLTGVGVWEALLLEIVM  150

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVD  KGSL T+APIAIGFIVGANILAGG F GASMN
Sbjct  151  TFGLVYTVYATAVDTNKGSLQTMAPIAIGFIVGANILAGGPFDGASMN  198



>dbj|BAM15884.1| putative tonoplast intrinsic protein 1, partial [Pyrus pyrifolia 
var. culta]
Length=166

 Score =   159 bits (402),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = -3

Query  312  GGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIVMTFG  136
            GG+I  +R ILYWIAQL+G+V ACLLLKF+TGGLETS F LS GV   NALV EIV+TFG
Sbjct  9    GGHIAFVRTILYWIAQLIGAVVACLLLKFATGGLETSAFSLSSGVSVWNALVLEIVITFG  68

Query  135  LVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            LVYTVYATAVDPK G++GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  69   LVYTVYATAVDPKNGNIGTIAPIAIGFIVGANILVAGAFDGASMN  113



>gb|ADE34288.1| aquaporin TIP1;13, partial [Gossypium hirsutum]
Length=179

 Score =   159 bits (403),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGG+ TS F LS GVGA NA+VFEIV
Sbjct  53   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGMTTSAFSLSSGVGAWNAVVFEIV  112

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  113  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  161



>gb|AFQ23566.1| aquaporin TIP1 [Hedychium coronarium]
Length=249

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G FVGGNITL R I YWIAQLLGS  ACLLL+F+TG L T  FGLS GVG   A+V EIV
Sbjct  91   GVFVGGNITLFRAIWYWIAQLLGSTVACLLLRFTTG-LATGTFGLSTGVGVWQAVVLEIV  149

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG+LGTIAPIAIGFIVGANIL GGAF GASMN
Sbjct  150  MTFGLVYTVYATAVDPKKGTLGTIAPIAIGFIVGANILVGGAFDGASMN  198



>ref|XP_002274538.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
Length=251

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGNITLLRGILYWIAQLLGS  ACLLLKF T G+ TS F +S GV   NA V EIV
Sbjct  91   GAFVGGNITLLRGILYWIAQLLGSAVACLLLKFCTHGMTTSAFAISSGVTVWNAFVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DP+KG++G IAP+AIG IV ANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPRKGNVGIIAPLAIGLIVAANILAGGAFDGASMN  199



>gb|KHG14163.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGGL TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGLTTSAFALSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006424746.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
 gb|ESR37986.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
Length=250

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+IT +R ILYWIAQLLGSV ACLLLKFSTGGLETS F LS GVGA NA+VFEIV
Sbjct  89   GAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIV  148

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  149  MTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMN  197



>ref|XP_010685836.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG I+  R ILYWIAQ LG+V ACLLL FSTGGL TS F LS GV   NALVFEIV
Sbjct  91   GAFLGGKISFFRTILYWIAQCLGAVVACLLLSFSTGGLPTSAFALSSGVTVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G +G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKRGDIGIIAPLAIGLIVGANILAGGAFDGASMN  199



>gb|KHG11211.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKFSTGGL TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFSTGGLTTSAFSLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_002459183.1| hypothetical protein SORBIDRAFT_03g047470 [Sorghum bicolor]
 gb|EES04303.1| hypothetical protein SORBIDRAFT_03g047470 [Sorghum bicolor]
Length=258

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGGN++L++ ++YW+AQLLGSV AC+LLK +TGG    GF LS GVGA NA+V E+V
Sbjct  93   GAFVGGNMSLVKAVVYWVAQLLGSVVACILLKMATGGAAVGGFSLSAGVGAWNAVVLEMV  152

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDP KG LG IAPIAIGFIVGANILAGGAF GASMN
Sbjct  153  MTFGLVYTVYATAVDPNKGDLGVIAPIAIGFIVGANILAGGAFDGASMN  201



>ref|XP_011088796.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=255

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLSGVGALNALVFEIVM  145
            G FVGGNITL RGILY IAQLLGS+ ACLLL F+TGG     F +SGV   +A VFEIVM
Sbjct  98   GLFVGGNITLFRGILYIIAQLLGSIVACLLLSFTTGGWAIPAFTVSGVSVWSAFVFEIVM  157

Query  144  TFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            TFGLVYTVYATAVDPKKG +G IAPIAIGFIVGANILAGG FTGASMN
Sbjct  158  TFGLVYTVYATAVDPKKGEIGVIAPIAIGFIVGANILAGGVFTGASMN  205



>ref|XP_010112915.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXC35064.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLK STGGLETS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITLIRSILYWIAQLLGSVVACLLLKISTGGLETSAFALSDGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_006488253.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|KDO72973.1| hypothetical protein CISIN_1g025600mg [Citrus sinensis]
Length=250

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+IT +R ILYWIAQLLGSV ACLLLKFSTGGLETS F LS GVGA NA+VFEIV
Sbjct  89   GAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIV  148

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPK+G++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  149  MTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMN  197



>emb|CDP00041.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GGNITLLR I YWIAQLLGS  ACLLLK +TGGLET  F LS GV   NALV E V
Sbjct  91   GALIGGNITLLRSISYWIAQLLGSTVACLLLKLATGGLETPAFTLSSGVSVGNALVLEAV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G +AP+AIGFIVGANIL GGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGVVAPLAIGFIVGANILVGGAFDGASMN  199



>ref|XP_004307108.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            G F+GGNITL+RGILYWIAQLLGSV ACLLLK +TGGL  S F LS GVGA NA+VFEIV
Sbjct  91   GLFLGGNITLIRGILYWIAQLLGSVVACLLLKLATGGLTISAFSLSTGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKK-GSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVD +  G++  IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDKRSAGNISIIAPIAIGFIVGANILAGGAFDGASMN  200



>gb|KEH44484.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNIT LR ILYWIAQLLG+V AC+LL   T G+ETSGF LS GV   NALVFEIV
Sbjct  91   GAFIGGNITFLRSILYWIAQLLGAVVACILLNSCTAGMETSGFALSSGVSVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPK+G++G +AP+AIG IVGANIL GG F GASMN
Sbjct  151  MTFGLVYTVYATAIDPKRGNVGVVAPLAIGCIVGANILVGGVFDGASMN  199



>gb|ADE34283.1| aquaporin TIP1;7 [Gossypium hirsutum]
Length=252

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGG+ TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGMTTSAFSLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>dbj|BAD90703.1| tonoplast intrinsic protein 1;2 [Mimosa pudica]
Length=252

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+I+LLR ILYWIAQLLG V ACLLLKF+TGGLETS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHISLLRSILYWIAQLLGCVVACLLLKFATGGLETSAFALSAGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>emb|CAB39758.1| major intrinsic protein [Picea abies]
Length=253

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GA +GG+I++LRGILYWIAQLLG+V A LLLKF+T G  TS F +S GVG+ NA+V EIV
Sbjct  91   GALMGGHISILRGILYWIAQLLGAVVASLLLKFTTNGRSTSPFAVSSGVGSWNAVVLEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+D K+GSLGTIAP+AIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDAKRGSLGTIAPLAIGFIVGANILAGGAFDGASMN  199



>gb|AAT65835.2| tonoplast intrinsic protein gamma [Salicornia herbacea]
Length=254

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGL-SGVGALNALVFEIV  148
            GAF+GGNITLL GI+YWIAQLLGS  ACLLLKFSTGGL+TS F L  G     A V EIV
Sbjct  91   GAFIGGNITLLNGIVYWIAQLLGSTVACLLLKFSTGGLQTSAFALCEGETVWGAFVMEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG++G IAP+AIG IVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDPKKGNIGIIAPLAIGLIVGANILAGGAFDGASMN  199



>ref|XP_007016527.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY34146.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+I+L+R ILYWIAQLLGSV ACLLLKFSTGGL TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHISLVRSILYWIAQLLGSVVACLLLKFSTGGLTTSAFSLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>gb|AAD31847.1|AF133531_1 water channel protein MipI [Mesembryanthemum crystallinum]
Length=252

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GG I+L R ILYWIAQ LG+V ACLLL F+TGGL TS F LS G+   NALVFEIV
Sbjct  91   GAFLGGKISLPRTILYWIAQCLGAVVACLLLSFATGGLPTSAFALSSGITVWNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAP+AIG IV ANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVAANILAGGAFDGASMN  199



>ref|XP_009336482.1| PREDICTED: aquaporin TIP1-3-like, partial [Pyrus x bretschneideri]
Length=153

 Score =   156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -3

Query  306  NITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIVMTFGLV  130
            +IT +R IL W+AQL+G+V ACLLLKF+TGGLETS F LS GV   NALV EIV+TFGLV
Sbjct  30   HITFVRTILSWLAQLIGAVVACLLLKFATGGLETSAFSLSSGVSVWNALVLEIVITFGLV  89

Query  129  YTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            YTVYATAVDPKKGS+GTIAPIAIGFIVGANIL  GAF GASMN
Sbjct  90   YTVYATAVDPKKGSIGTIAPIAIGFIVGANILVAGAFDGASMN  132



>gb|KHG06645.1| putative aquaporin TIP1-2 [Gossypium arboreum]
Length=252

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL+R ILYWIAQLLGSV ACLLLKFSTGG+ TS F LS GVGA NA+VFEIV
Sbjct  91   GAFVGGHITLVRSILYWIAQLLGSVVACLLLKFSTGGMTTSAFSLSSGVGAWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAIDPKKGNIGIIAPIAIGFIVGANILAGGAFDGASMN  199



>ref|XP_004294610.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score =   159 bits (402),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAF+GGNITL+R ILYWIAQLLGSV ACLLLKF+TGG+  S F LS GVG  NA+VFEIV
Sbjct  91   GAFLGGNITLVRSILYWIAQLLGSVVACLLLKFATGGMTISAFSLSTGVGVWNAVVFEIV  150

Query  147  MTFGLVYTVYATAVDPKK-GSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATA+D +  G++  IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATALDKRSAGNISIIAPIAIGFIVGANILAGGAFDGASMN  200



>ref|XP_011089824.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=252

 Score =   159 bits (402),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  324  GAFVGGNITLLRGILYWIAQLLGSVAACLLLKFSTGGLETSGFGLS-GVGALNALVFEIV  148
            GAFVGG+ITL R ILYWIAQLLGSV ACLLLKF+TGGLETS F LS GV   NALVFEIV
Sbjct  91   GAFVGGHITLFRSILYWIAQLLGSVVACLLLKFATGGLETSAFALSSGVTVTNALVFEIV  150

Query  147  MTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFTGASMN  1
            MTFGLVYTVYATAVDPKKG +G IAPIAIGFIVGANILAGGAF GASMN
Sbjct  151  MTFGLVYTVYATAVDPKKGDIGIIAPIAIGFIVGANILAGGAFDGASMN  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522986485888