BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13691_g1_i1 len=418 path=[703:0-417]

Length=418
                                                                      Score     E

ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                      84.7    4e-17   
gb|AAX14478.1|  putative tonoplast intrinsic protein                  80.9    2e-16   Gossypium hirsutum [American cotton]
dbj|BAL41683.1|  tonoplast intrinsic protein                          82.0    3e-16   
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...  82.0    4e-16   
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                 81.6    4e-16   
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg           81.6    5e-16   
gb|ACP28878.1|  tonoplast intrinsic protein                           81.6    6e-16   Gossypium hirsutum [American cotton]
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                81.3    6e-16   
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000        81.3    7e-16   
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1             81.3    7e-16   
ref|NP_001284655.1|  aquaporin TIP1-1                                 81.3    8e-16   
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                80.9    9e-16   
gb|ABQ85918.1|  tonoplast intrinsic protein                           79.3    2e-15   
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                80.5    2e-15   
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                      80.1    2e-15   Mimosa pudica [sensitive-plant]
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                79.7    2e-15   
emb|CAA65188.1|  aquaporin                                            76.3    2e-15   Helianthus annuus
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...  79.7    3e-15   Lotus japonicus
emb|CAD33928.1|  tonoplast intrinsic protein                          78.2    3e-15   Cicer arietinum [garbanzo]
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                      79.3    3e-15   
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...  79.3    3e-15   
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg           79.3    3e-15   
dbj|BAL41684.1|  tonoplast intrinsic protein                          79.3    4e-15   
sp|Q9FY14.1|TIP1_MEDTR  RecName: Full=Probable aquaporin TIP-type...  79.0    4e-15   Medicago truncatula
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                 79.0    4e-15   
emb|CDY67380.1|  BnaAnng24130D                                        79.0    4e-15   
sp|P42067.2|TIP1_MEDSA  RecName: Full=Probable aquaporin TIP-type...  79.0    4e-15   Medicago sativa [alfalfa]
ref|XP_004494087.1|  PREDICTED: probable aquaporin TIP-type-like      79.0    4e-15   
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                79.0    5e-15   Brassica oleracea var. botrytis [cauliflower]
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                      79.0    5e-15   
gb|ABB76813.1|  tonoplast intrinsic protein                           79.0    5e-15   Olea europaea
gb|AAB51394.2|  tonoplast intrinsic protein bobTIP26-2                77.8    5e-15   Brassica oleracea var. botrytis [cauliflower]
gb|ACI95283.1|  tonoplast intrinsic protein                           78.6    5e-15   Sinapis arvensis [charlock mustard]
emb|CDY53270.1|  BnaCnng24720D                                        78.6    6e-15   
gb|ACI95284.1|  tonoplast intrinsic protein                           78.6    6e-15   Tulipa gesneriana
ref|XP_010098813.1|  Aquaporin TIP1-1                                 78.6    6e-15   
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                78.6    7e-15   Brassica oleracea var. botrytis [cauliflower]
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                 78.6    7e-15   
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg           78.2    7e-15   
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                      78.2    9e-15   
gb|AFH36344.1|  aquaporin TIP2;2                                      78.2    9e-15   
emb|CDQ12457.1|  tonoplast intrinsic protein 1;1                      77.0    1e-14   
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                77.8    1e-14   
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                      77.8    1e-14   
ref|NP_181221.1|  aquaporin TIP1-1                                    77.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...  77.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AGD98716.1|  aquaporin protein 13                                  77.8    1e-14   
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1             77.8    1e-14   
emb|CAB45653.1|  putative tonoplast intrinsic protein                 77.8    1e-14   Pisum sativum [garden pea]
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                  77.4    1e-14   
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1             77.4    2e-14   
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1             79.0    2e-14   
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                 77.0    2e-14   Brassica napus [oilseed rape]
ref|XP_009152050.1|  PREDICTED: aquaporin TIP1-2                      77.0    2e-14   
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                      77.0    2e-14   
dbj|BAA12711.1|  VM23                                                 77.0    2e-14   Raphanus sativus
emb|CDX83623.1|  BnaC07g23630D                                        77.0    2e-14   
emb|CAE53881.1|  aquaporin                                            77.0    2e-14   Ricinus communis
ref|XP_002519456.1|  tonoplast intrinsic protein, putative            77.0    2e-14   Ricinus communis
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                      77.0    2e-14   
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                      76.6    2e-14   
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g           76.6    3e-14   
emb|CAN69323.1|  hypothetical protein VITISV_032929                   76.6    3e-14   Vitis vinifera
ref|XP_006649396.1|  PREDICTED: probable aquaporin TIP1-1-like        76.6    3e-14   
sp|P50156.1|TIP11_ORYSJ  RecName: Full=Probable aquaporin TIP1-1;...  76.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007027468.1|  Aquaporin TIP1,6                                 76.6    3e-14   
gb|AFU51578.1|  aquaporin                                             76.6    3e-14   
ref|XP_002465859.1|  hypothetical protein SORBIDRAFT_01g047140        76.3    4e-14   Sorghum bicolor [broomcorn]
emb|CBI30163.3|  unnamed protein product                              75.9    4e-14   
ref|NP_001236728.1|  nodulin-26                                       75.9    5e-14   
gb|AHW81522.1|  ECFP-tagged gamma TIP                                 78.2    5e-14   
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                  75.9    5e-14   
ref|NP_001267926.1|  aquaporin-like                                   75.9    5e-14   
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                 75.9    6e-14   
gb|AGD98709.1|  aquaporin protein 6                                   75.9    6e-14   
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                   75.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417           75.1    9e-14   
ref|NP_189283.1|  aquaporin TIP1-2                                    75.1    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                      75.1    9e-14   
gb|AAB62692.1|  salt-stress induced tonoplast intrinsic protein       75.5    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AHA84270.1|  nodulin-26                                            75.1    9e-14   
gb|AFS50011.1|  hypothetical protein                                  75.1    1e-13   
gb|ACX37451.1|  tonoplast intrinsic protein                           75.1    1e-13   Hevea brasiliensis [Para rubber tree]
ref|XP_006291577.1|  hypothetical protein CARUB_v10017730mg           75.1    1e-13   
ref|XP_007205767.1|  hypothetical protein PRUPE_ppa010367mg           74.7    1e-13   
ref|XP_008222876.1|  PREDICTED: probable aquaporin TIP1-2             74.7    1e-13   
emb|CAA56553.1|  gamma-TIP-like protein                               74.7    1e-13   Hordeum vulgare [barley]
gb|ACV52008.1|  tonoplast aquaporin 1;1                               74.7    1e-13   Daucus carota [Queen Anne's lace]
gb|AJA04408.1|  tonoplast intrinsic protein                           74.7    1e-13   
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                74.7    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                       74.7    1e-13   Lolium perenne [perennial ryegrass]
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1             74.3    2e-13   
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg           74.3    2e-13   
gb|AFQ98316.1|  MIP6                                                  74.3    2e-13   
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                 74.3    2e-13   
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                 74.3    2e-13   
gb|AHA50083.1|  tonoplast intrinsic protein                           74.3    2e-13   
dbj|BAP33938.1|  aquaporin                                            73.9    2e-13   
emb|CDO19477.1|  tonoplast intrinsec protein                          72.4    2e-13   
gb|KDP29188.1|  hypothetical protein JCGZ_16577                       73.9    3e-13   
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1             73.9    3e-13   
emb|CAC85291.1|  putative tonoplast intrinsic protein                 73.9    3e-13   Posidonia oceanica
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                 73.6    3e-13   
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                 73.6    3e-13   
ref|XP_002299893.1|  nodulin-26 family protein                        73.6    3e-13   Populus trichocarpa [western balsam poplar]
ref|NP_001241727.1|  aquaporin TIP1.1                                 73.6    3e-13   
emb|CDO19482.1|  tonoplast intrinsec protein                          71.6    4e-13   
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                 73.6    4e-13   
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1             73.6    4e-13   
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                      73.6    4e-13   
dbj|BAF95576.1|  tonoplast intrinsic protein                          73.6    4e-13   Nicotiana tabacum [American tobacco]
ref|NP_001104896.1|  aquaporin TIP1-1                                 73.6    4e-13   Zea mays [maize]
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                 73.6    4e-13   
ref|XP_004985722.1|  PREDICTED: aquaporin TIP1-1-like                 73.6    4e-13   
ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1             73.6    4e-13   
ref|XP_002523724.1|  tonoplast intrinsic protein, putative            73.2    4e-13   Ricinus communis
ref|XP_004294610.1|  PREDICTED: aquaporin TIP1-1-like                 73.2    4e-13   
ref|XP_009404620.1|  PREDICTED: aquaporin TIP1-1-like                 73.2    4e-13   
ref|XP_008366336.1|  PREDICTED: probable aquaporin TIP1-2             73.2    5e-13   
ref|XP_009338345.1|  PREDICTED: aquaporin TIP1-3-like                 73.2    5e-13   
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                      73.2    5e-13   
gb|AAG44946.1|AF290619_1  putative gamma TIP                          73.2    5e-13   Nicotiana glauca [glaucous tobacco]
gb|ACN30999.1|  unknown                                               72.8    5e-13   Zea mays [maize]
emb|CDO19476.1|  tonoplast intrinsic protein                          70.9    7e-13   
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg              72.4    9e-13   
gb|ABB29477.1|  tonoplast intrinsic protein                           72.4    9e-13   Panax ginseng [Chinese ginseng]
gb|ADB93067.1|  aquaporin                                             72.4    9e-13   
emb|CDO19481.1|  tonoplast intrinsec protein                          70.5    1e-12   
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                      72.4    1e-12   
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                 72.4    1e-12   
gb|AHJ09607.1|  aquaporin protein 26                                  72.4    1e-12   
gb|ADU25490.1|  tonoplastic intrinsic protein                         72.0    1e-12   
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                      72.0    1e-12   Mimosa pudica [sensitive-plant]
gb|KDP43963.1|  hypothetical protein JCGZ_05430                       72.0    1e-12   
gb|AHI54565.1|  tonoplastic intrinsic protein                         72.0    1e-12   
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                      72.0    1e-12   Vitis vinifera
ref|XP_008357781.1|  PREDICTED: aquaporin TIP1-3-like                 72.0    1e-12   
ref|XP_009358317.1|  PREDICTED: aquaporin TIP1-3-like                 72.0    1e-12   
dbj|BAG15863.1|  aquaporin                                            71.6    1e-12   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                 71.6    1e-12   
ref|XP_009421351.1|  PREDICTED: probable aquaporin TIP1-2             71.6    2e-12   
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2              71.6    2e-12   Populus trichocarpa [western balsam poplar]
emb|CAB61841.1|  putative gamma tonoplast intrinsic protein (TIP)     71.6    2e-12   Sporobolus stapfianus [resurrection grass]
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                 71.6    2e-12   
emb|CDP08994.1|  unnamed protein product                              71.2    2e-12   
gb|ABP35520.1|  tonoplast intrinsic protein                           71.2    2e-12   Ipomoea batatas [batate]
emb|CAA38633.1|  possible membrane channel protein                    71.2    2e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM15884.1|  putative tonoplast intrinsic protein 1               70.5    2e-12   
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                 71.2    3e-12   
ref|XP_002531118.1|  tonoplast intrinsic protein, putative            70.9    3e-12   Ricinus communis
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                        70.9    3e-12   
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                    70.9    3e-12   Pyrus communis
ref|XP_006833429.1|  hypothetical protein AMTR_s00109p00145020        70.5    3e-12   
gb|AFQ23566.1|  aquaporin TIP1                                        70.5    3e-12   
gb|KDP44188.1|  hypothetical protein JCGZ_05655                       70.5    4e-12   
ref|XP_010112915.1|  Aquaporin TIP1-3                                 70.1    5e-12   
gb|AEQ29861.1|  aquaporin TIP1                                        70.1    5e-12   
gb|AAB17284.1|  tonoplast intrinsic protein                           70.1    5e-12   Mesembryanthemum crystallinum
ref|XP_002314305.2|  nodulin-26 family protein                        70.1    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_008350342.1|  PREDICTED: aquaporin TIP1-1-like                 70.1    5e-12   
ref|NP_001274695.1|  aquaporin TIP1-3-like                            70.1    5e-12   
ref|XP_009349744.1|  PREDICTED: aquaporin TIP1-1-like                 70.1    6e-12   
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1             70.1    6e-12   
gb|AAL49753.1|AF452015_1  aquaporin-like protein                      69.7    7e-12   Petunia x hybrida [garden petunia]
ref|XP_008795635.1|  PREDICTED: probable aquaporin TIP1-1             69.7    7e-12   
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                  69.7    7e-12   
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                 69.7    7e-12   
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg           69.7    7e-12   
ref|XP_010920700.1|  PREDICTED: probable aquaporin TIP1-2             69.7    8e-12   
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2             69.7    8e-12   
gb|AFK34456.1|  unknown                                               69.7    8e-12   
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                        69.7    8e-12   
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                 69.7    9e-12   
gb|AAD31847.1|AF133531_1  water channel protein MipI                  69.3    1e-11   Mesembryanthemum crystallinum
gb|EYU37031.1|  hypothetical protein MIMGU_mgv1a016968mg              67.4    1e-11   
ref|XP_010049101.1|  PREDICTED: aquaporin TIP4-1                      69.3    1e-11   
ref|XP_006396348.1|  hypothetical protein EUTSA_v10028907mg           69.3    1e-11   
gb|AGG39699.1|  aquaporin protein AQU21                               69.3    1e-11   
gb|AGD98711.1|  aquaporin protein 8                                   69.3    1e-11   
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg           69.3    1e-11   
emb|CAA64952.1|  tonoplast intrinsic protein                          69.3    1e-11   Tulipa gesneriana
ref|XP_011089424.1|  PREDICTED: aquaporin TIP1-3-like                 69.3    1e-11   
gb|ADW66151.1|  tonoplast intrinsic protein 1-1                       68.2    1e-11   
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                      68.9    1e-11   
dbj|BAD04010.1|  tonoplast intrinsic protein                          68.9    1e-11   Prunus persica
ref|XP_006350747.1|  PREDICTED: aquaporin TIP1-3-like                 68.9    1e-11   
ref|XP_008788076.1|  PREDICTED: aquaporin TIP1-3-like                 68.9    1e-11   
ref|XP_007150288.1|  hypothetical protein PHAVU_005G141100g           68.9    1e-11   
emb|CDO19480.1|  tonoplast intrinsec protein                          67.4    1e-11   
gb|AGK27806.1|  AQP1                                                  68.9    1e-11   
gb|ACY74345.1|  aquaporin-like protein                                68.9    2e-11   Capsicum annuum
ref|NP_001234103.1|  aquaporin-like                                   68.9    2e-11   
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                      68.9    2e-11   
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2              68.9    2e-11   
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                 68.6    2e-11   
ref|NP_001238026.1|  nodulin-26                                       68.6    2e-11   
gb|ABK96489.1|  unknown                                               68.6    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                 68.6    2e-11   
ref|XP_004307108.1|  PREDICTED: aquaporin TIP1-1-like                 68.2    2e-11   
ref|XP_003542571.1|  PREDICTED: aquaporin TIP1-1-like                 68.2    2e-11   
ref|XP_008387528.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...  68.2    2e-11   
gb|KHN30200.1|  Aquaporin TIP1-3                                      68.2    3e-11   
ref|XP_011019624.1|  PREDICTED: aquaporin TIP4-1                      68.2    3e-11   
ref|XP_002309548.1|  aquaporin TIP4.1 family protein                  68.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                 68.2    3e-11   
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2             68.2    3e-11   
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2             68.2    3e-11   
ref|XP_010456993.1|  PREDICTED: aquaporin TIP1-3-like                 67.8    3e-11   
ref|XP_010922400.1|  PREDICTED: aquaporin TIP1-3-like                 68.2    3e-11   
gb|KHG06645.1|  putative aquaporin TIP1-2                             67.8    3e-11   
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                      67.8    4e-11   
gb|ACF78734.1|  unknown                                               67.8    4e-11   Zea mays [maize]
ref|NP_001105029.1|  aquaporin TIP1-2                                 67.4    4e-11   Zea mays [maize]
gb|AAB47180.1|  root-specific protein homolog {clone CHEM 8}          64.7    4e-11   
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg           67.4    4e-11   
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                      67.4    4e-11   
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                      67.4    5e-11   
ref|XP_010096653.1|  Aquaporin TIP1-3                                 67.4    5e-11   
ref|XP_002516539.1|  tonoplast intrinsic protein, putative            67.4    5e-11   Ricinus communis
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                      67.4    5e-11   
ref|XP_009772083.1|  PREDICTED: aquaporin TIP1-1-like                 65.9    5e-11   
ref|XP_009111380.1|  PREDICTED: aquaporin TIP1-3                      67.4    6e-11   
dbj|BAM44345.1|  vacuolar aluminum transporter                        67.4    6e-11   
ref|XP_002314201.1|  nodulin-26 family protein                        67.0    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003606614.1|  Aquaporin TIP1-1                                 67.0    6e-11   
gb|ADE34283.1|  aquaporin TIP1;7                                      67.0    7e-11   
ref|XP_008241379.1|  PREDICTED: aquaporin TIP1-1                      67.0    7e-11   
gb|ACB71282.1|  tonoplast intrinsic protein                           67.0    8e-11   Tamarix hispida
ref|XP_007012110.1|  Tonoplast intrinsic protein 4,1                  66.6    8e-11   
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3              66.6    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                      66.6    8e-11   
ref|XP_006384960.1|  nodulin-26 family protein                        66.6    9e-11   
gb|ADF32096.1|  aquaporin                                             66.6    1e-10   
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1             66.6    1e-10   
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                 66.2    1e-10   
ref|XP_011028266.1|  PREDICTED: aquaporin TIP1-1-like                 66.6    1e-10   
ref|XP_008801471.1|  PREDICTED: probable aquaporin TIP4-3             66.2    1e-10   
emb|CAN66944.1|  hypothetical protein VITISV_020091                   66.2    1e-10   Vitis vinifera
ref|XP_002872891.1|  GAMMA-TIP3/TIP1_3                                66.2    1e-10   
gb|KDP29873.1|  hypothetical protein JCGZ_18448                       65.9    2e-10   
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1             65.9    2e-10   
gb|EPS60922.1|  hypothetical protein M569_13880                       65.9    2e-10   
gb|KFK30698.1|  hypothetical protein AALP_AA6G016000                  65.9    2e-10   
gb|AEV54107.1|  putative tonoplast intrinsic protein 1.7              65.5    2e-10   
ref|XP_006645407.1|  PREDICTED: probable aquaporin TIP1-2-like        65.9    2e-10   
gb|KHG13169.1|  Aquaporin TIP4-1 -like protein                        65.5    2e-10   
tpg|DAA33872.1|  TPA: aquaporin TIP4;1                                65.5    2e-10   
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                      65.9    2e-10   
gb|ABK22410.1|  unknown                                               65.9    2e-10   Picea sitchensis
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                 65.9    2e-10   
ref|XP_002531978.1|  tonoplast intrinsic protein, putative            65.9    2e-10   Ricinus communis
ref|XP_007144382.1|  hypothetical protein PHAVU_007G151600g           65.5    2e-10   
gb|ABR68795.1|  aquaporin gamma-TIP                                   65.5    2e-10   Gossypium hirsutum [American cotton]
ref|XP_002283964.1|  PREDICTED: aquaporin TIP4-1                      66.2    3e-10   Vitis vinifera
ref|XP_008794805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  65.5    3e-10   
ref|NP_001237062.1|  uncharacterized protein LOC100527509             65.5    3e-10   
ref|XP_010102384.1|  Aquaporin TIP4-1                                 65.5    3e-10   
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg           65.1    3e-10   
ref|NP_192056.1|  aquaporin TIP1-3                                    65.1    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28617.1|  unknown                                               65.1    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AEW46425.1|  putative tonoplast intrinsic protein 1.1              64.7    4e-10   
ref|XP_010248450.1|  PREDICTED: aquaporin TIP3-1-like                 65.1    4e-10   
gb|ACJ53708.1|  tonoplast intrinsic protein 1-1                       64.7    4e-10   Lolium perenne [perennial ryegrass]
ref|XP_010685836.1|  PREDICTED: aquaporin TIP1-3-like                 64.7    4e-10   
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                      64.7    4e-10   Vitis vinifera
gb|ADE76384.1|  unknown                                               64.7    4e-10   
ref|XP_004971442.1|  PREDICTED: probable aquaporin TIP1-2-like        64.7    5e-10   
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3              64.7    5e-10   Populus trichocarpa [western balsam poplar]
ref|NP_001045562.1|  Os01g0975900                                     64.7    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459183.1|  hypothetical protein SORBIDRAFT_03g047470        64.3    6e-10   Sorghum bicolor [broomcorn]
ref|XP_004307558.1|  PREDICTED: aquaporin TIP1-3-like                 64.3    6e-10   
gb|KDP34186.1|  hypothetical protein JCGZ_07757                       64.3    6e-10   
emb|CDP07030.1|  unnamed protein product                              64.3    6e-10   
gb|AAT65835.2|  tonoplast intrinsic protein gamma                     64.3    7e-10   Salicornia herbacea
gb|ACG35910.1|  aquaporin TIP1.2                                      64.3    7e-10   Zea mays [maize]
gb|ABI96817.1|  tonoplast intrinsic protein                           64.3    7e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ACV60358.1|  putative tonoplast intrinsic protein                  63.9    7e-10   Camellia sinensis [black tea]
gb|AFK41698.1|  unknown                                               63.9    8e-10   
ref|XP_010687268.1|  PREDICTED: aquaporin TIP3-1-like                 64.3    8e-10   
gb|AEV54106.1|  putative tonoplast intrinsic protein 1.8              63.5    8e-10   
dbj|BAJ98454.1|  predicted protein                                    63.9    9e-10   
gb|AEW46426.1|  putative tonoplast intrinsic protein 1.2              63.5    1e-09   
ref|XP_007137210.1|  hypothetical protein PHAVU_009G108800g           63.5    1e-09   
gb|AAN40746.1|  tonoplast intrinsic protein                           63.5    1e-09   
gb|EPS62187.1|  nodulin-26                                            63.5    1e-09   
ref|XP_010540050.1|  PREDICTED: probable aquaporin TIP3-2             63.9    1e-09   
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg           63.5    1e-09   
ref|XP_004291186.1|  PREDICTED: aquaporin TIP4-1-like                 63.5    1e-09   
emb|CBI31728.3|  unnamed protein product                              63.5    1e-09   
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                  63.2    1e-09   
ref|XP_010917707.1|  PREDICTED: probable aquaporin TIP4-3             63.5    2e-09   
ref|XP_007226030.1|  hypothetical protein PRUPE_ppa010453mg           63.2    2e-09   
ref|XP_010088608.1|  Aquaporin TIP4-1                                 63.2    2e-09   
ref|XP_010248431.1|  PREDICTED: aquaporin TIP3-1-like                 63.2    2e-09   
ref|NP_001242569.1|  uncharacterized protein LOC100793258             62.8    2e-09   
ref|XP_006581008.1|  PREDICTED: uncharacterized protein LOC100793...  62.8    2e-09   
ref|XP_008220070.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...  62.8    2e-09   
ref|XP_009346073.1|  PREDICTED: aquaporin TIP4-1-like                 62.8    2e-09   
gb|ABR17761.1|  unknown                                               62.8    2e-09   
dbj|BAI66439.1|  tonoplast intrinsic protein                          62.8    3e-09   
gb|EMT32480.1|  Putative aquaporin TIP1-2                             62.8    3e-09   
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                      62.8    3e-09   
gb|EAZ15017.1|  hypothetical protein OsJ_04959                        62.4    3e-09   
gb|ABK22242.1|  unknown                                               62.4    3e-09   
gb|KHG24233.1|  putative aquaporin TIP3-2 -like protein               62.4    3e-09   
ref|XP_003565186.1|  PREDICTED: probable aquaporin TIP1-2             62.4    3e-09   
ref|XP_007150651.1|  hypothetical protein PHAVU_005G170300g           62.0    4e-09   
ref|XP_010549592.1|  PREDICTED: probable aquaporin TIP3-2             62.4    4e-09   
ref|NP_001242707.1|  uncharacterized protein LOC100777419             62.0    4e-09   
ref|XP_009367463.1|  PREDICTED: aquaporin TIP4-1-like                 62.0    4e-09   
ref|XP_008393878.1|  PREDICTED: aquaporin TIP4-1                      62.0    4e-09   
gb|KHN21988.1|  Aquaporin TIP1-3                                      62.0    5e-09   
emb|CDM84344.1|  unnamed protein product                              61.2    5e-09   
gb|KHN10202.1|  Aquaporin TIP4-1                                      62.0    5e-09   
ref|XP_003522708.1|  PREDICTED: aquaporin TIP4-1                      62.0    5e-09   
gb|AEZ52401.1|  aquaporin                                             62.0    5e-09   
ref|XP_009389231.1|  PREDICTED: aquaporin TIP3-1-like                 62.0    5e-09   
gb|KDO37395.1|  hypothetical protein CISIN_1g037978mg                 60.5    5e-09   
gb|ACU19038.1|  unknown                                               61.6    5e-09   
gb|AEI83501.1|  Major intrinsic protein                               61.6    5e-09   
ref|XP_004486769.1|  PREDICTED: aquaporin TIP2-1-like isoform X2      61.6    6e-09   
gb|ABE68722.1|  putative major intrinsic protein                      60.8    6e-09   
ref|XP_004486768.1|  PREDICTED: aquaporin TIP2-1-like isoform X1      61.6    6e-09   
ref|XP_009355907.1|  PREDICTED: probable aquaporin TIP3-2             61.6    6e-09   
ref|XP_004137540.1|  PREDICTED: probable aquaporin TIP3-2-like        62.0    6e-09   
gb|ABE68719.1|  delta-TIP-like protein                                60.5    7e-09   
gb|KHN32099.1|  Aquaporin TIP1-1                                      61.6    7e-09   
ref|XP_010037056.1|  PREDICTED: probable aquaporin TIP3-2             61.6    7e-09   
gb|EPS72940.1|  hypothetical protein M569_01821                       61.2    7e-09   
pir||T10253  membrane protein MP28 - cucurbit                         61.6    8e-09
ref|XP_008375083.1|  PREDICTED: probable aquaporin TIP3-2             61.2    8e-09   
emb|CAD41593.3|  OSJNBb0034G17.15                                     63.5    8e-09   
emb|CDY26214.1|  BnaA06g12030D                                        61.6    8e-09   
ref|XP_009149235.1|  PREDICTED: probable aquaporin TIP3-2             61.6    8e-09   
gb|AEX12954.1|  hypothetical protein CL1686Contig1_03                 58.9    8e-09   
ref|XP_006450671.1|  hypothetical protein CICLE_v10009294mg           61.2    8e-09   
gb|EYU21481.1|  hypothetical protein MIMGU_mgv1a010922mg              62.0    9e-09   
pir||T10251  membrane protein MP23 precursor - cucurbit               61.6    9e-09
ref|XP_003588369.1|  Aquaporin TIP4-1                                 60.5    9e-09   
emb|CAA65184.1|  aquaporin                                            61.2    9e-09   
ref|XP_008437248.1|  PREDICTED: probable aquaporin TIP3-2             61.6    9e-09   
gb|AEX12951.1|  hypothetical protein CL1686Contig1_03                 58.5    9e-09   
ref|XP_003543633.1|  PREDICTED: aquaporin TIP2-1                      60.8    1e-08   
ref|XP_004164504.1|  PREDICTED: probable aquaporin TIP3-2-like        62.0    1e-08   
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2-like        61.2    1e-08   
ref|XP_003518658.1|  PREDICTED: aquaporin TIP1-3-like                 60.8    1e-08   
ref|XP_002525663.1|  tonoplast intrinsic protein, putative            60.8    1e-08   
ref|XP_006488253.1|  PREDICTED: aquaporin TIP1-3-like                 60.8    1e-08   
emb|CDP16197.1|  unnamed protein product                              60.8    1e-08   
ref|XP_008365156.1|  PREDICTED: aquaporin TIP4-1-like                 60.8    1e-08   
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg           60.8    1e-08   
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2             60.8    1e-08   
ref|XP_004492091.1|  PREDICTED: aquaporin TIP1-3-like                 60.8    1e-08   
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                 60.5    1e-08   
gb|KHM98732.1|  Aquaporin TIP2-1                                      60.5    1e-08   
ref|NP_001240119.1|  uncharacterized protein LOC100817754             60.5    1e-08   
gb|AFK33796.1|  unknown                                               60.5    1e-08   
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                 60.5    1e-08   
ref|XP_004498471.1|  PREDICTED: aquaporin TIP4-1-like                 60.5    1e-08   
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680        60.5    1e-08   
ref|XP_004166637.1|  PREDICTED: aquaporin TIP1-3-like                 59.3    1e-08   
gb|ACN40807.1|  unknown                                               60.5    2e-08   
ref|XP_006476050.1|  PREDICTED: aquaporin TIP4-1-like                 60.5    2e-08   
gb|AFK39772.1|  unknown                                               60.5    2e-08   
ref|NP_001267923.1|  aquaporin-like                                   60.5    2e-08   
ref|XP_011081801.1|  PREDICTED: aquaporin TIP4-1                      60.5    2e-08   
gb|AFN53680.1|  hypothetical protein                                  62.4    2e-08   
gb|AES58620.2|  major intrinsic protein (MIP) family transporter      60.5    2e-08   
ref|XP_002890250.1|  beta-tonoplast intrinsic protein                 60.5    2e-08   
emb|CAN74049.1|  hypothetical protein VITISV_007330                   60.5    2e-08   
gb|AIK66517.1|  putative aquaporin                                    60.5    2e-08   
gb|KDP46476.1|  hypothetical protein JCGZ_08448                       60.5    2e-08   
gb|AAF78757.1|AF271660_1  putative aquaporin TIP3                     60.5    2e-08   
ref|XP_009127978.1|  PREDICTED: aquaporin TIP3-1                      60.5    2e-08   
emb|CDY66321.1|  BnaCnng50290D                                        60.5    2e-08   
ref|XP_010669827.1|  PREDICTED: aquaporin TIP1-3-like                 60.1    2e-08   
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                      60.1    2e-08   
gb|EYU20444.1|  hypothetical protein MIMGU_mgv1a012577mg              60.1    2e-08   
gb|EPS67611.1|  aquaporin-like protein                                60.1    2e-08   
ref|XP_002961672.1|  hypothetical protein SELMODRAFT_165030           59.7    3e-08   
ref|XP_008800430.1|  PREDICTED: aquaporin TIP3-1-like                 60.1    3e-08   
gb|KEH21895.1|  tonoplast intrinsic protein                           59.7    3e-08   
gb|KDR15027.1|  Neurogenic protein big brain                          61.2    3e-08   
ref|XP_009104826.1|  PREDICTED: aquaporin TIP3-1-like                 60.1    3e-08   
emb|CDY19176.1|  BnaC05g13770D                                        60.1    3e-08   
emb|CDY11123.1|  BnaC06g23750D                                        60.1    3e-08   
gb|AFP49893.1|  integral protein b                                    59.7    3e-08   
ref|XP_008463493.1|  PREDICTED: aquaporin TIP1-3-like isoform X1      59.7    3e-08   
gb|ACU19274.1|  unknown                                               59.7    3e-08   
ref|NP_173223.1|  beta-tonoplast intrinsic protein                    59.7    3e-08   
ref|XP_002962158.1|  hypothetical protein SELMODRAFT_165035           59.3    3e-08   
ref|XP_006303840.1|  hypothetical protein CARUB_v10012552mg           59.7    3e-08   
dbj|BAO18638.1|  tonoplast intrinsic protein 3;1                      59.3    4e-08   
ref|XP_009617337.1|  PREDICTED: aquaporin TIP2-1                      59.3    4e-08   
ref|XP_010102791.1|  putative aquaporin TIP3-2                        59.3    4e-08   
ref|XP_009105968.1|  PREDICTED: aquaporin TIP3-1-like                 59.7    4e-08   
emb|CDX96453.1|  BnaA07g30640D                                        59.7    4e-08   
ref|XP_010476946.1|  PREDICTED: probable aquaporin TIP3-2             59.7    4e-08   
gb|ENN74136.1|  hypothetical protein YQE_09109                        60.8    4e-08   
ref|XP_011070446.1|  PREDICTED: aquaporin TIP4-1-like                 59.7    4e-08   
emb|CDX72962.1|  BnaC06g34100D                                        59.3    4e-08   
ref|NP_001274296.1|  MIP                                              59.3    4e-08   
ref|XP_004241485.1|  PREDICTED: probable aquaporin TIP3-2             59.3    4e-08   
ref|XP_010526110.1|  PREDICTED: aquaporin TIP4-1                      59.3    4e-08   
ref|XP_006372647.1|  aquaporin TIP-type alpha family protein          59.3    4e-08   
ref|XP_004149825.1|  PREDICTED: aquaporin TIP1-3-like                 59.3    4e-08   
ref|XP_010459395.1|  PREDICTED: probable aquaporin TIP3-2             59.3    4e-08   
gb|ERL94267.1|  hypothetical protein D910_11548                       60.8    5e-08   
ref|XP_010498157.1|  PREDICTED: probable aquaporin TIP3-2             59.3    5e-08   
ref|XP_011017549.1|  PREDICTED: probable aquaporin TIP3-2             59.3    5e-08   
gb|ACF84391.1|  unknown                                               59.3    5e-08   
gb|EMS54366.1|  putative aquaporin TIP3-2                             59.3    5e-08   
gb|ACG39579.1|  aquaporin TIP4.1                                      59.3    5e-08   
ref|NP_001105641.1|  aquaporin TIP4-4                                 58.9    5e-08   
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                      58.9    5e-08   
ref|XP_009793775.1|  PREDICTED: aquaporin TIP2-1-like                 58.9    6e-08   
ref|XP_008445019.1|  PREDICTED: aquaporin TIP4-1                      58.9    6e-08   
ref|XP_008380900.1|  PREDICTED: aquaporin TIP2-1-like                 58.9    6e-08   
ref|XP_011080630.1|  PREDICTED: aquaporin TIP2-1                      58.5    6e-08   
ref|XP_004164037.1|  PREDICTED: aquaporin TIP4-1-like                 58.9    6e-08   
ref|XP_002457071.1|  hypothetical protein SORBIDRAFT_03g000790        58.9    6e-08   
ref|XP_006652544.1|  PREDICTED: probable aquaporin TIP3-2-like        58.9    6e-08   
ref|XP_004150285.1|  PREDICTED: aquaporin TIP4-1-like                 58.9    6e-08   
emb|CDP09981.1|  unnamed protein product                              58.9    7e-08   
ref|XP_010918027.1|  PREDICTED: aquaporin TIP3-1-like                 58.9    7e-08   
gb|KFK38977.1|  hypothetical protein AALP_AA3G184100                  58.5    7e-08   
tpg|DAA52750.1|  TPA: aquaporin TIP4-4                                58.9    7e-08   
ref|XP_002515999.1|  tonoplast intrinsic protein, putative            58.5    8e-08   
ref|XP_010417358.1|  PREDICTED: aquaporin TIP4-1-like isoform X1      58.5    8e-08   
ref|XP_010429588.1|  PREDICTED: aquaporin TIP4-1                      58.5    8e-08   
ref|XP_010098111.1|  Aquaporin TIP2-1                                 58.5    8e-08   
emb|CAB39758.1|  major intrinsic protein                              58.5    8e-08   
ref|XP_010933299.1|  PREDICTED: aquaporin TIP3-1-like                 58.5    9e-08   
ref|XP_002530651.1|  tonoplast intrinsic protein, putative            57.8    9e-08   
ref|XP_005735052.1|  PREDICTED: aquaporin-4-like isoform X1           59.3    9e-08   
ref|XP_010777188.1|  PREDICTED: aquaporin-4-like                      58.9    9e-08   
emb|CAB55837.1|  delta tonoplast intrinsic protein                    58.5    9e-08   
gb|AIA82918.1|  AQPTIP                                                58.5    9e-08   
ref|XP_005735053.1|  PREDICTED: aquaporin-4-like isoform X2           58.9    9e-08   
ref|NP_001105032.1|  aquaporin TIP3-1                                 58.5    9e-08   
ref|XP_003597702.1|  Aquaporin                                        58.5    9e-08   
ref|XP_006838210.1|  hypothetical protein AMTR_s00106p00152160        56.6    9e-08   
gb|EEE54177.1|  hypothetical protein OsJ_00995                        57.8    9e-08   
ref|XP_002878889.1|  TIP4_1                                           58.2    1e-07   
emb|CDQ12452.1|  tonoplast intrinsic protein 3;1                      57.4    1e-07   
ref|XP_002446824.1|  hypothetical protein SORBIDRAFT_06g023240        58.5    1e-07   
ref|XP_006441499.1|  hypothetical protein CICLE_v10021799mg           58.2    1e-07   
ref|NP_180152.1|  aquaporin TIP4-1                                    58.2    1e-07   
emb|CDY35336.1|  BnaA04g15110D                                        57.0    1e-07   
ref|XP_010249612.1|  PREDICTED: aquaporin TIP4-1                      58.2    1e-07   
ref|XP_003635679.1|  PREDICTED: probable aquaporin TIP-type           56.6    1e-07   
ref|XP_006347387.1|  PREDICTED: probable aquaporin TIP3-2-like        58.2    1e-07   
emb|CAA65186.1|  aquaporin                                            58.2    1e-07   
emb|CDX81850.1|  BnaC08g37510D                                        58.5    1e-07   
gb|KFK32564.1|  hypothetical protein AALP_AA6G259500                  58.2    1e-07   
gb|AIK66518.1|  putative aquaporin                                    58.2    1e-07   
ref|XP_008669132.1|  PREDICTED: probable aquaporin TIP3-2             58.2    1e-07   
gb|KFK42314.1|  hypothetical protein AALP_AA2G239800                  57.8    1e-07   
ref|XP_002277904.2|  PREDICTED: probable aquaporin TIP-type           58.2    1e-07   
ref|XP_007139266.1|  hypothetical protein PHAVU_008G014900g           58.2    1e-07   
ref|XP_004982756.1|  PREDICTED: aquaporin TIP3-1-like                 58.2    1e-07   
dbj|BAJ90417.1|  predicted protein                                    57.0    1e-07   
gb|AEV54105.1|  putative tonoplast intrinsic protein 1.5              57.4    1e-07   
gb|AFK36325.1|  unknown                                               57.8    1e-07   
ref|XP_011031897.1|  PREDICTED: probable aquaporin TIP2-2             57.8    1e-07   
ref|XP_009117640.1|  PREDICTED: probable aquaporin TIP3-2             58.2    1e-07   
ref|XP_011046111.1|  PREDICTED: probable aquaporin TIP3-2             58.2    1e-07   
gb|KEH44484.1|  tonoplast intrinsic protein                           57.8    1e-07   
ref|XP_009419322.1|  PREDICTED: probable aquaporin TIP2-2             57.8    1e-07   
ref|XP_004299427.1|  PREDICTED: aquaporin TIP2-3-like                 57.8    1e-07   
ref|XP_006478158.1|  PREDICTED: probable aquaporin TIP3-2-like        57.8    2e-07   
ref|NP_001042500.1|  Os01g0232000                                     57.8    2e-07   
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...  57.8    2e-07   
ref|XP_007039804.1|  Tonoplast intrinsic protein 2,3                  57.8    2e-07   
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C   57.8    2e-07   
ref|XP_007135655.1|  hypothetical protein PHAVU_010G147100g           57.8    2e-07   
ref|XP_010733986.1|  PREDICTED: aquaporin-4-like                      58.2    2e-07   
emb|CDP00041.1|  unnamed protein product                              57.8    2e-07   
ref|XP_001760745.1|  predicted protein                                57.8    2e-07   
ref|NP_001237401.1|  uncharacterized protein LOC100306092             57.8    2e-07   
gb|AES58629.2|  tonoplast intrinsic protein                           57.4    2e-07   
ref|XP_009612974.1|  PREDICTED: aquaporin TIP4-1                      57.4    2e-07   
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C   57.8    2e-07   
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...  57.4    2e-07   
ref|XP_003555811.1|  PREDICTED: aquaporin TIP1-3-like isoform X1      57.8    2e-07   
ref|XP_010042457.1|  PREDICTED: probable aquaporin TIP3-2             57.8    2e-07   
ref|XP_009804441.1|  PREDICTED: aquaporin TIP4-1                      57.4    2e-07   
ref|XP_006605823.1|  PREDICTED: aquaporin TIP1-3-like isoform X2      57.4    2e-07   
ref|XP_009416494.1|  PREDICTED: probable aquaporin TIP4-3             57.8    2e-07   
gb|ADW66144.1|  tonoplast intrinsic protein 2-2                       55.1    2e-07   
ref|XP_003588378.1|  Tonoplast intrinsic protein                      57.4    2e-07   
gb|AEV54104.1|  putative tonoplast intrinsic protein 1.6              57.0    2e-07   
ref|XP_004967395.1|  PREDICTED: aquaporin TIP4-4-like                 57.4    2e-07   
emb|CDY20190.1|  BnaA01g28120D                                        57.4    2e-07   
emb|CDY63821.1|  BnaC01g44580D                                        57.4    2e-07   
dbj|BAA19129.1|  unnamed protein product                              57.4    2e-07   
gb|KCW77800.1|  hypothetical protein EUGRSUZ_D02090                   57.4    2e-07   
ref|NP_001289647.1|  probable aquaporin TIP-type                      57.4    2e-07   
ref|XP_002262978.1|  PREDICTED: probable aquaporin TIP3-2             57.4    2e-07   
ref|XP_009767160.1|  PREDICTED: probable aquaporin TIP3-2             57.4    2e-07   



>ref|XP_011077300.1| PREDICTED: aquaporin TIP1-1 [Sesamum indicum]
Length=252

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*TA  267
            AV+FGPAVVSWSWD HW+YW GPLVGGG+AGLVY+L FI Q HE LP T+
Sbjct  201  AVSFGPAVVSWSWDNHWVYWAGPLVGGGLAGLVYELFFINQTHEQLPTTS  250



>gb|AAX14478.1| putative tonoplast intrinsic protein [Gossypium hirsutum]
Length=137

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+WD HWIYWVGPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  87   AVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEFIFISNTHEQLPTT  135



>dbj|BAL41683.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            A+AFGPA+VSWSW +HW+YWVGPL+GGGIAG+VYDL FI   HE LP T
Sbjct  200  AIAFGPALVSWSWTSHWVYWVGPLIGGGIAGIVYDLFFINSTHEQLPST  248



>ref|XP_004168293.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1-like [Cucumis 
sativus]
Length=250

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGP+VVSWSW++HWIYW GPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  200  AVAFGPSVVSWSWESHWIYWAGPLIGGGLAGLIYEFIFISNSHEQLPTT  248



>ref|XP_004143284.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN48203.1| hypothetical protein Csa_6G448110 [Cucumis sativus]
Length=250

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGP+VVSWSW++HWIYW GPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  200  AVAFGPSVVSWSWESHWIYWAGPLIGGGLAGLIYEFIFISNSHEQLPTT  248



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSWD HW+YWVGPL+GGG+AG+VY+  FI Q HE LP T
Sbjct  201  AVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTT  249



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+WD HWIYWVGPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  201  AVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEFIFISNTHEQLPTT  249



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+WD HWIYWVGPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  201  AVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEFIFISNTHEQLPTT  249



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSWD+HW+YW GPL+GGG+AGL+Y+ +FI   HE LP T
Sbjct  200  AVSFGPAVVSWSWDSHWVYWAGPLIGGGLAGLIYETVFISHTHEQLPTT  248



>ref|XP_008801219.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSWSWDAHW+YW GPL+GGG+AGLVY+L FI   HE LP
Sbjct  200  AVSFGPALVSWSWDAHWVYWAGPLIGGGLAGLVYELFFISHTHEQLP  246



>ref|NP_001284655.1| aquaporin TIP1-1 [Cucumis melo]
 gb|AGW99230.1| aquaporin TIP1-1 [Cucumis melo]
Length=250

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGP+VVSWSW++HW+YW GPL+GGG+AGL+Y+ IFI   HE LP T
Sbjct  200  AVAFGPSVVSWSWESHWVYWAGPLIGGGLAGLIYEFIFISNSHEQLPTT  248



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSWD HWIYW+GPL+GGG+AGL+Y+  FI Q HE LP T
Sbjct  201  AVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEFAFINQSHEQLPPT  249



>gb|ABQ85918.1| tonoplast intrinsic protein [Arachis diogoi]
Length=177

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYWVGPL+GGGIAG++Y+++FI   HE LP T
Sbjct  127  AVSFGPAVVSWSWSNHWIYWVGPLIGGGIAGVIYEVVFISHTHEQLPTT  175



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSWD HWIYW+GPL+GGG+AGL+Y+  FI Q HE LP T
Sbjct  201  AVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEFPFINQSHEQLPPT  249



>dbj|BAD90702.1| tonoplast intrinsic protein 1;1 [Mimosa pudica]
Length=251

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YWVGPL+GGG+AG++Y++IFI   HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWVGPLIGGGLAGVIYEVIFISHTHEQLPTT  249



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSWSW+ HW+YW GPL+GGG+AGLVY+ IFI Q HE LP
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLIGGGLAGLVYEFIFINQTHEQLP  247



>emb|CAA65188.1| aquaporin [Helianthus annuus]
Length=62

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*TA  267
            AV+FGPA+VSW+W  HWIYWVGPLVGGG+AGL+Y+L+FI Q H+ LP +A
Sbjct  13   AVSFGPALVSWTWANHWIYWVGPLVGGGLAGLIYELLFINQTHDHLPTSA  62



>gb|AAF82790.1|AF275315_1 water-selective transport intrinsic membrane protein 1 [Lotus 
japonicus]
Length=251

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYWVGPLVGGGIAGL+Y+++FI  Q HE LP T
Sbjct  200  AVSFGPAVVSWSWSNHWIYWVGPLVGGGIAGLIYEVVFIGSQTHEQLPTT  249



>emb|CAD33928.1| tonoplast intrinsic protein [Cicer arietinum]
Length=142

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYW GPL+GGG+AGL+Y+++FI   HE LP T
Sbjct  92   AVSFGPAVVSWSWSNHWIYWAGPLIGGGLAGLIYEVVFISHTHEQLPTT  140



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*TA  267
            AVAFGPAVVSWSW  HWIYW GPLVGGGIAG+VY+  FI   HE LP +A
Sbjct  201  AVAFGPAVVSWSWAGHWIYWAGPLVGGGIAGIVYEFFFISNTHEQLPSSA  250



>ref|XP_010527951.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=243

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AVAFGPAVVSWSW  HWIYW GPLVGGG+AGLVY+  FI   HE LP
Sbjct  193  AVAFGPAVVSWSWQGHWIYWAGPLVGGGLAGLVYEFFFISNTHEQLP  239



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWSWSNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>dbj|BAL41684.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            A+AFGPA+VSWSW +HW+YWVGPL+GGGIA +VYDL FI   HE LP T
Sbjct  200  AIAFGPALVSWSWASHWVYWVGPLIGGGIAAIVYDLFFISGTHEQLPTT  248



>sp|Q9FY14.1|TIP1_MEDTR RecName: Full=Probable aquaporin TIP-type; AltName: Full=MtAQP1 
[Medicago truncatula]
 emb|CAC01618.1| aquaporin [Medicago truncatula]
 gb|KEH24058.1| tonoplast intrinsic protein [Medicago truncatula]
Length=250

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HW+YW GPL+GGGIAGLVY+++FI   HE LP T
Sbjct  200  AVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTT  248



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSW+W+ HW+YWVGPL+GGG+AGL+Y+  FI Q HE LP
Sbjct  201  AVSFGPAVVSWTWNNHWVYWVGPLIGGGLAGLIYEFFFINQTHEPLP  247



>emb|CDY67380.1| BnaAnng24130D [Brassica napus]
 emb|CDY66645.1| BnaAnng22640D [Brassica napus]
Length=221

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW+ HW+YW GPLVGGG+AGL+Y++ FI   HE LP T
Sbjct  171  AVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYEVFFINTTHEQLPTT  219



>sp|P42067.2|TIP1_MEDSA RecName: Full=Probable aquaporin TIP-type; AltName: Full=Membrane 
channel protein 1; AltName: Full=MsMCP1 [Medicago sativa]
 gb|AAC04846.1| tonoplast intrinsic protein homolog MSMCP1 [Medicago sativa]
Length=249

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HW+YW GPL+GGGIAGLVY+++FI   HE LP T
Sbjct  199  AVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTT  247



>ref|XP_004494087.1| PREDICTED: probable aquaporin TIP-type-like [Cicer arietinum]
Length=250

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYW GPL+GGG+AGL+Y+++FI   HE LP T
Sbjct  200  AVSFGPAVVSWSWSNHWIYWAGPLIGGGLAGLIYEVVFISHTHEQLPTT  248



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW+ HW+YW GPL+GGG+AGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYEVFFINTTHEQLPTT  249



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW+ HW+YW GPLVGGG+AGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYEVFFINTTHEQLPTT  249



>gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea]
Length=252

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*TA  267
            AV+FGPAVVSW+WD+HW+YW+GP VG GIA LVY+++FI Q H+ LP +A
Sbjct  201  AVSFGPAVVSWTWDSHWVYWLGPFVGAGIAALVYEILFINQSHQQLPTSA  250



>gb|AAB51394.2| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=175

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW+ HW+YW GPL+GGG+AGL+Y++ FI   HE LP T
Sbjct  125  AVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYEVFFINTTHEQLPTT  173



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW  HW+YW GPLVGGG+AGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEIFFINTTHEQLPTT  249



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSWSW+ HW+YW GPL+GGG+AGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYEVFFINTTHEQLPTT  249



>gb|ACI95284.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A+AFGPA+VSWSW +HW+YWVGPL+GGGIA +VYDL FI   HE LP
Sbjct  200  AIAFGPALVSWSWASHWVYWVGPLIGGGIAAIVYDLFFISSTHEQLP  246



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW  HW+YWVGPL+GGG+AGL+Y+ +FI   HE LP T
Sbjct  201  AVSFGPALVSWSWSNHWVYWVGPLIGGGLAGLIYEFVFISHSHEQLPTT  249



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AVAFGPAVVSWSW+ HW+YW GPLVGGG+AGL+Y++ FI   HE LP
Sbjct  201  AVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYEVFFINTTHEQLP  247



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW  HW+YWVGPL+GGG+AG+VY+L FI   HE LP T
Sbjct  201  AVSFGPALVSWSWKNHWVYWVGPLIGGGLAGIVYELFFINHSHEQLPAT  249



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEIFFINTTHEQLPTT  249



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSWSW+ HW+YW GPL+GGG+AGL+Y+  FI Q HE LP
Sbjct  201  AVSFGPAVVSWSWNNHWVYWAGPLIGGGLAGLIYEFFFINQTHEPLP  247



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW  HW+YW GPL+GGGIAGLVY+  FI + HE LP T
Sbjct  201  AVSFGPALVSWSWANHWVYWAGPLIGGGIAGLVYEFFFISRSHEQLPTT  249



>emb|CDQ12457.1| tonoplast intrinsic protein 1;1, partial [Vicia faba var. minor]
Length=169

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYW GPL+GGGIAGLVY+++FI   HE LP T
Sbjct  119  AVSFGPAVVSWSWANHWIYWAGPLIGGGIAGLVYEVLFINGTHEQLPTT  167



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW GPL+GGG+AGLVY+L F+   H+ LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWAGPLIGGGLAGLVYELCFMTHGHQQLPAT  249



>ref|XP_010933183.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSWD HW+YW GPL+GGG+AGLVY+  FI   HE LP T
Sbjct  200  AVSFGPALVSWSWDDHWVYWGGPLIGGGLAGLVYEFFFISHTHEQLPTT  248



>emb|CAB45653.1| putative tonoplast intrinsic protein [Pisum sativum]
Length=250

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW  HWIYW GPL+GGG+AGL+Y+++FI   HE LP T
Sbjct  200  AVSFGPAVVSWSWANHWIYWAGPLIGGGLAGLIYEVLFINSTHEQLPTT  248



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW W  HW+YW GPLVGGG+AGL+Y+L FI   HE LP T
Sbjct  201  AVAFGPAVVSWDWTNHWVYWAGPLVGGGLAGLIYELFFINTTHEQLPTT  249



>ref|XP_010911210.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSWSW  HW+YWVGPL+GGG+AGLVY+  FI   HE LP
Sbjct  200  AVSFGPALVSWSWSDHWVYWVGPLIGGGLAGLVYEFFFISNTHEQLP  246



>ref|XP_008788358.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=414

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPL+GGG+AGLVY+  FI   HE LP T
Sbjct  364  AVSFGPALVSWSWNNHWVYWAGPLIGGGLAGLVYEFFFISSTHEQLPST  412



>gb|AAD39372.1|AF118381_1 tonoplast intrinsic protein [Brassica napus]
Length=253

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HWIYW GPLVGGG+AGL+Y+ +FI Q+ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEFVFINQNGHEQLPTT  251



>ref|XP_009152050.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
Length=253

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HWIYW GPLVGGG+AGL+Y+ +FI Q+ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEFVFINQNGHEQLPTT  251



>ref|XP_009129499.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
 emb|CDY48983.1| BnaA02g28130D [Brassica napus]
 emb|CDY28539.1| BnaC02g36210D [Brassica napus]
Length=253

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSWSW  HWIYWVGPLVGGG+AG++YD ++I ++ HE LP T
Sbjct  202  AVAFGPAVVSWSWSNHWIYWVGPLVGGGLAGIIYDFVYIIENGHEQLPTT  251



>dbj|BAA12711.1| VM23 [Raphanus sativus]
 emb|CDY13639.1| BnaA06g32840D [Brassica napus]
Length=253

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HWIYW GPLVGGG+AGL+Y+ +FI Q+ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEFVFINQNGHEQLPTT  251



>emb|CDX83623.1| BnaC07g23630D [Brassica napus]
Length=253

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HWIYW GPLVGGG+AGL+Y+ +FI Q+ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEFVFINQNGHEQLPTT  251



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPLVGGG+AGLVY+  FI   HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFIHSTHEQLPTT  249



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPLVGGG+AGLVY+  FI   HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFIHSTHEQLPTT  249



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSWSW  HW+YW GPL+GGG+AGLVY+  FI Q HE LP
Sbjct  201  AVSFGPAVVSWSWANHWVYWAGPLIGGGLAGLVYEFFFINQTHEPLP  247



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W  HW+YWVGPL+GGG+AGL+Y+  FI Q HE LP
Sbjct  201  AVSFGPALVSWAWSNHWVYWVGPLIGGGLAGLIYEFFFINQTHEPLP  247



>ref|XP_007162793.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
 gb|AFW90515.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54305.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54392.1| nodulin-26 [Phaseolus vulgaris]
 gb|AGV54457.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|AHA84233.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|ESW34787.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
Length=250

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV FGPAVVSW+W  +WIYWVGPL+GGG+AGL+Y+++FI   HE LP T
Sbjct  200  AVTFGPAVVSWTWTNNWIYWVGPLIGGGLAGLIYEVVFISHTHEQLPTT  248



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+W  HW+YW GPL+GGG+AGLVY+++FI   HE LP T
Sbjct  201  AVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVVFISHTHEQLPST  249



>ref|XP_006649396.1| PREDICTED: probable aquaporin TIP1-1-like [Oryza brachyantha]
Length=250

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW++ W+YWVGPL+GGG+AG++Y+++FI   HE LP T
Sbjct  200  AVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTT  248



>sp|P50156.1|TIP11_ORYSJ RecName: Full=Probable aquaporin TIP1-1; AltName: Full=Tonoplast 
intrinsic protein 1-1; Short=OsTIP1;1; AltName: Full=rTIP1 
[Oryza sativa Japonica Group]
 gb|AAK98737.1|AC090485_16 Tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAA05017.1| gamma-Tip [Oryza sativa]
 gb|ABF93961.1| aquaporin TIP-type, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY88537.1| hypothetical protein OsI_10010 [Oryza sativa Indica Group]
 gb|EAZ25574.1| hypothetical protein OsJ_09399 [Oryza sativa Japonica Group]
 gb|ABP48112.1| water channel protein [Oryza sativa Japonica Group]
 dbj|BAG96434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW++ W+YWVGPL+GGG+AG++Y+++FI   HE LP T
Sbjct  200  AVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTT  248



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+W  HW+YW GPL+GGGIAGLVY+  FI   HE LP T
Sbjct  201  AVSFGPALVSWTWKNHWVYWAGPLIGGGIAGLVYEFFFISHTHEQLPAT  249



>gb|AFU51578.1| aquaporin [Gladiolus hybrid cultivar]
Length=259

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW  HW+YW GPL+GGG+AG++Y+L FI   HE LP T
Sbjct  209  AVSFGPALVSWSWSNHWVYWAGPLIGGGLAGIIYELFFISHTHEQLPTT  257



>ref|XP_002465859.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
 gb|EER92857.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
Length=250

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI Q HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISQTHEQLPTT  248



>emb|CBI30163.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+W  HW+YW GPL+GGG+AGLVY++ FI   HE LP T
Sbjct  163  AVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVFFISHTHEQLPST  211



>ref|NP_001236728.1| nodulin-26 [Glycine max]
 gb|AAA02946.1| nodulin-26 [Glycine max]
Length=249

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV FGPAVVSW+W  HWIYW GPL+GGGIAGL+Y+++FI   HE  P T
Sbjct  199  AVTFGPAVVSWTWTNHWIYWAGPLIGGGIAGLIYEVVFISHTHEQRPST  247



>gb|AHW81522.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-c]
 gb|AHW81534.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-n]
Length=494

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   HE LP T
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTT  249



>gb|KFK33580.1| hypothetical protein AALP_AA5G032300 [Arabis alpina]
Length=253

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AGL+YD +FI ++ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYDFVFIIENGHEQLPTT  251



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW+W  HW+YW GPL+GGG+AGLVY++ FI   HE LP T
Sbjct  201  AVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVFFISHTHEQLPST  249



>ref|XP_010033163.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW52713.1| hypothetical protein EUGRSUZ_J02074 [Eucalyptus grandis]
Length=251

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPAVVSWSW +HW+YW+GP +G GIA ++Y+L FI Q HE LP T
Sbjct  201  AVSFGPAVVSWSWSSHWVYWLGPFLGAGIAAVIYELFFINQTHEQLPTT  249



>gb|AGD98709.1| aquaporin protein 6 [Camellia sinensis]
Length=252

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD+HW+YW+GP +G  IA LVY+LIFI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDSHWVYWLGPFIGSAIAALVYELIFISPSTHEQLPTT  250



>gb|AAC62397.1| gamma tonoplast intrinsic protein 2 [Arabidopsis thaliana]
Length=253

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPL+GGG+AG++YD +FI ++ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTT  251



>ref|XP_002876978.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53237.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPA+VSW+W  HW+YW GPLVGGG+AG++YD +FI ++ HE LP T
Sbjct  202  AVAFGPAIVSWTWTNHWVYWAGPLVGGGLAGIIYDFVFIDENAHEQLPTT  251



>ref|NP_189283.1| aquaporin TIP1-2 [Arabidopsis thaliana]
 sp|Q41963.2|TIP12_ARATH RecName: Full=Aquaporin TIP1-2; AltName: Full=Gamma-tonoplast 
intrinsic protein 2; Short=Gamma-TIP2; AltName: Full=Salt stress-induced 
tonoplast intrinsic protein; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=AtTIP1;2; Contains: RecName: 
Full=Aquaporin TIP1-2, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16271.1|AF428341_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 gb|AAL31945.1|AF419613_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAB01832.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
 gb|AAL84998.1| AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAH30470.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77174.1| aquaporin TIP1-2 [Arabidopsis thaliana]
Length=253

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPL+GGG+AG++YD +FI ++ HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTT  251



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W+ HW+YW GPL+GGG+AGLVY+  FI   HE LP
Sbjct  201  AVSFGPALVSWTWENHWVYWAGPLIGGGLAGLVYEFFFINHSHEQLP  247



>gb|AAB62692.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
Length=273

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPL+GGG+AG++YD +FI ++ HE LP T
Sbjct  222  AVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTT  271



>gb|AHA84270.1| nodulin-26 [Phaseolus vulgaris]
Length=250

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV FGPAVVSW+W  +WIYWVGP +GGG+AGL+Y+++FI   HE LP T
Sbjct  200  AVTFGPAVVSWTWTNNWIYWVGPFIGGGLAGLIYEVVFISHTHEQLPTT  248



>gb|AFS50011.1| hypothetical protein [Dendrobium catenatum]
Length=250

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSW W  HW+YW GPL+GGG+AG+VY+L FI + HE LP
Sbjct  200  AVSFGPAVVSWEWKHHWVYWAGPLIGGGLAGIVYELFFINRSHEQLP  246



>gb|ACX37451.1| tonoplast intrinsic protein [Hevea brasiliensis]
Length=252

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSWD HW+YW GPL+GGG+AG+VY+L+FI  + HE LP T
Sbjct  201  AVSFGPALVSWSWDNHWVYWAGPLIGGGLAGVVYELLFIGHNTHEQLPST  250



>ref|XP_006291577.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
 gb|EOA24475.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
Length=298

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AG++YD +FI ++ HE LP T
Sbjct  247  AVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGIIYDFVFINENEHEQLPTT  296



>ref|XP_007205767.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
 gb|EMJ06966.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
Length=252

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP +G  IA LVYDLI+I P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAALVYDLIYITPDTHEQLPTT  250



>ref|XP_008222876.1| PREDICTED: probable aquaporin TIP1-2 [Prunus mume]
Length=252

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP +G  IA LVYDLI+I P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAALVYDLIYITPDTHEQLPTT  250



>emb|CAA56553.1| gamma-TIP-like protein [Hordeum vulgare subsp. vulgare]
 dbj|BAI66434.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90879.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI + HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTT  248



>gb|ACV52008.1| tonoplast aquaporin 1;1 [Daucus carota]
Length=251

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*TAV  264
            AV+FGPA+VSW W  HW+YW GPLVGGG+AG++Y+LIFI   HE LP T +
Sbjct  200  AVSFGPALVSWDWTNHWVYWAGPLVGGGLAGIIYELIFIGGSHEPLPTTGL  250



>gb|AJA04408.1| tonoplast intrinsic protein [Chorispora bungeana]
Length=252

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AG++Y++ FI   HE LP T
Sbjct  202  AVAFGPAVVSWTWSNHWVYWAGPLVGGGLAGVIYEVAFINGSHEQLPTT  250



>gb|AAD10494.1| gamma-type tonoplast intrinsic protein [Triticum aestivum]
Length=250

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI + HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTT  248



>gb|ACJ53709.1| tonoplast intrinsic protein 1-2 [Lolium perenne]
Length=249

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG+VY+L+FI + HE LP T
Sbjct  199  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVVYELLFINRSHEQLPTT  247



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AV+FGPA+VSWSWD HW+YW GPL+GGG+AGLVY+  FI   HE L
Sbjct  200  AVSFGPALVSWSWDDHWVYWAGPLIGGGLAGLVYEFFFISHTHEQL  245



>ref|XP_006395549.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
 gb|ESQ32835.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
Length=253

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AVAFGPAVVSWSW  HW+YW GPLVGGG+AGL+Y+ +FI    HE LP T
Sbjct  202  AVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEFVFIGGNDHEQLPTT  251



>gb|AFQ98316.1| MIP6 [Eutrema halophilum]
Length=253

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AVAFGPAVVSWSW  HW+YW GPLVGGG+AGL+Y+ +FI  + HE LP T
Sbjct  202  AVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEFVFIGGNAHEQLPTT  251



>ref|XP_004137844.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 ref|XP_004161262.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN59003.1| Tonoplast intrinsic protein [Cucumis sativus]
Length=253

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AVAFGPAV+SWSW  HWIYW GPL+GGG+AG+VY+L FI   HE LP
Sbjct  203  AVAFGPAVISWSWANHWIYWAGPLIGGGLAGIVYELFFIGFTHEPLP  249



>ref|XP_011089824.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=252

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP VG GIA LVY+++FI Q  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGAGIAALVYEILFINQSGHEQLPVT  250



>gb|AHA50083.1| tonoplast intrinsic protein [Eleutherococcus senticosus]
Length=251

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW W  HW+YW GPLVGGG+AG+VY LIFI   HE LP
Sbjct  201  AVSFGPALVSWDWTNHWVYWAGPLVGGGLAGVVYQLIFISHTHEPLP  247



>dbj|BAP33938.1| aquaporin [Triticum aestivum]
Length=250

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI + HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFIXRTHEQLPTT  248



>emb|CDO19477.1| tonoplast intrinsec protein, partial [Olea europaea]
 emb|CDO19478.1| tonoplast intrinsec protein, partial [Olea europaea]
Length=116

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            AV+FGPAVVSW+WD+HW+YW+GP VG GIA LVY+++FI Q H+
Sbjct  73   AVSFGPAVVSWTWDSHWVYWLGPFVGAGIAALVYEILFINQSHQ  116



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPA+VSWSWD HW+YW GPLVGGG+AGLVY+  FI  + HE LP
Sbjct  201  AVSFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEFFFIGHNTHEQLP  248



>ref|XP_009411359.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW   WIYW+GPL+GGG+AG+VY+  FI   HE LP T
Sbjct  200  AVSFGPALVSWSWTHQWIYWLGPLIGGGLAGIVYEFFFISHSHEQLPTT  248



>emb|CAC85291.1| putative tonoplast intrinsic protein [Posidonia oceanica]
Length=250

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AVAFGPA+VSW+W  HWIYWVGPLVG  IAG+VY L+FI   HE LP T
Sbjct  200  AVAFGPALVSWNWVNHWIYWVGPLVGAAIAGIVYQLLFINHTHEQLPTT  248



>ref|XP_008442728.1| PREDICTED: aquaporin TIP1-1-like [Cucumis melo]
Length=253

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AVAFGPAV+SWSW  HWIYW GPL+GGG+AG+VY+L FI   HE LP
Sbjct  203  AVAFGPAVISWSWVNHWIYWAGPLIGGGLAGIVYELFFIGFTHEPLP  249



>ref|XP_010043596.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 ref|XP_010042712.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW85618.1| hypothetical protein EUGRSUZ_B02403 [Eucalyptus grandis]
Length=252

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSWSWD+HW+YW+GP VG GIA +VYD  FI Q  HE LP
Sbjct  201  AVSFGPAVVSWSWDSHWVYWLGPFVGAGIAAVVYDTFFINQSTHEQLP  248



>ref|XP_002299893.1| nodulin-26 family protein [Populus trichocarpa]
 gb|EEE84698.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD+HW+YW+GP VG  IA +VY++IFI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDSHWVYWLGPFVGSAIAAIVYEVIFINPSTHEQLPST  250



>ref|NP_001241727.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG25449.1| aquaporin TIP1.1 [Zea mays]
Length=250

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI   HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPST  248



>emb|CDO19482.1| tonoplast intrinsec protein, partial [Olea europaea]
Length=116

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            AV+FGPAVVSW+WD+HW+YW+GP VG GIA L+Y+++FI Q H+
Sbjct  73   AVSFGPAVVSWTWDSHWVYWLGPFVGAGIAALIYEILFINQSHQ  116



>ref|XP_010425366.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AGL+Y+ +FI    HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEFVFINGNDHEQLPTT  251



>ref|XP_009800738.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
 emb|CAA69353.1| aquaporin 1 [Nicotiana tabacum]
Length=251

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W   W+YW GPLVGGGIAG+VY+LIFI   HE LP
Sbjct  201  AVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELIFINHSHEPLP  247



>ref|XP_010502579.1| PREDICTED: aquaporin TIP1-2 [Camelina sativa]
Length=253

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AGL+Y+ +FI    HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEFVFINGNDHEQLPTT  251



>dbj|BAF95576.1| tonoplast intrinsic protein [Nicotiana tabacum]
Length=251

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W   W+YW GPLVGGGIAG+VY+LIFI   HE LP
Sbjct  201  AVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELIFINHSHEPLP  247



>ref|NP_001104896.1| aquaporin TIP1-1 [Zea mays]
 sp|O64964.1|TIP11_MAIZE RecName: Full=Aquaporin TIP1-1; AltName: Full=Tonoplast intrinsic 
protein 1-1; AltName: Full=ZmTIP1-1; AltName: Full=ZmTIP1;1; 
Short=ZmTIP1 [Zea mays]
 gb|AAC09245.1| tonoplast intrinsic protein [Zea mays]
 gb|AAO86709.1| tonoplast water channel [Zea mays]
 gb|ACF85770.1| unknown [Zea mays]
 gb|ACF85962.1| unknown [Zea mays]
 gb|ACG23904.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG24935.1| aquaporin TIP1.1 [Zea mays]
 gb|ACN31200.1| unknown [Zea mays]
 gb|ACN33327.1| unknown [Zea mays]
Length=250

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI   HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPST  248



>ref|XP_010514297.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AVAFGPAVVSW+W  HW+YW GPLVGGG+AGL+Y+ +FI    HE LP T
Sbjct  202  AVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEFVFINGNDHEQLPTT  251



>ref|XP_004985722.1| PREDICTED: aquaporin TIP1-1-like [Setaria italica]
Length=249

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSWSW   W+YWVGPL+GGG+AG++Y+++FI   HE LP T
Sbjct  199  AVSFGPALVSWSWGYQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTT  247



>ref|XP_009613493.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W   W+YW GPLVGGGIAG+VY+LIFI   HE LP
Sbjct  201  AVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELIFINHSHEPLP  247



>ref|XP_002523724.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF38664.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW W  HW+YW GPL+GGG+AG+VYDL FI   HE +P
Sbjct  202  AVSFGPALVSWDWTNHWVYWAGPLIGGGLAGIVYDLFFITYSHEPVP  248



>ref|XP_004294610.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSWSW++HW+YW+GP +G GIA L+YD IFI P  HE LP T
Sbjct  202  AVSFGPAVVSWSWESHWVYWLGPFLGAGIAALIYDWIFIGPATHEPLPTT  251



>ref|XP_009404620.1| PREDICTED: aquaporin TIP1-1-like [Musa acuminata subsp. malaccensis]
Length=252

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AV+FGPAVVSW+WD HW+YWVGPL+GGGIA LVYD +FI    HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWVGPLLGGGIAALVYDGVFIGFGTHEQLPTT  250



>ref|XP_008366336.1| PREDICTED: probable aquaporin TIP1-2 [Malus domestica]
Length=252

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY+LIFI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAVVYELIFIAPDTHEQLPTT  250



>ref|XP_009338345.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY+LIFI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAVVYELIFIAPDTHEQLPTT  250



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AV+FGPA+VSWSWD HW+YW GPL+GGG+AGL+Y++ FI    HE LP T
Sbjct  201  AVSFGPALVSWSWDNHWVYWAGPLIGGGLAGLIYEVFFIGHSSHEPLPTT  250



>gb|AAG44946.1|AF290619_1 putative gamma TIP [Nicotiana glauca]
Length=251

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W   W+YW GPLVGGGIAG+VY+L+FI   HE LP
Sbjct  201  AVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELVFINHSHEPLP  247



>gb|ACN30999.1| unknown [Zea mays]
Length=200

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+L+FI   HE LP T
Sbjct  150  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPST  198



>emb|CDO19476.1| tonoplast intrinsic protein, partial [Olea europaea]
 emb|CDO19479.1| tonoplast intrinsec protein, partial [Olea europaea]
Length=115

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHH  288
            AV+FGPAVVSW+WD+HW+YW+GP VG GIA LVY+++FI Q H
Sbjct  73   AVSFGPAVVSWTWDSHWVYWLGPFVGAGIAALVYEILFINQSH  115



>gb|EYU18933.1| hypothetical protein MIMGU_mgv1a012390mg [Erythranthe guttata]
Length=252

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+W +HW+YWVGP VG GIA L+Y+++FI Q  HE LP T
Sbjct  201  AVSFGPAVVSWTWASHWVYWVGPFVGAGIAALIYEILFINQTGHEQLPTT  250



>gb|ABB29477.1| tonoplast intrinsic protein [Panax ginseng]
Length=250

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW W  HW+YW GP+VGGG+A +VY+LIFI   HE LP
Sbjct  200  AVSFGPALVSWDWTNHWVYWAGPIVGGGVAAVVYELIFISSSHEPLP  246



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV FGPA+VSWSWD HW+YW GPLVGGG+AGLVY+  FI  + HE LP
Sbjct  201  AVPFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEFFFIGHNTHEQLP  248



>emb|CDO19481.1| tonoplast intrinsec protein, partial [Olea europaea]
Length=115

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHH  288
            AV+FGPAVVSW+WD+HW+YW+GP VG GIA L+Y+++FI Q H
Sbjct  73   AVSFGPAVVSWTWDSHWVYWLGPFVGAGIAALIYEILFINQSH  115



>ref|XP_003558815.1| PREDICTED: aquaporin TIP1-1 [Brachypodium distachyon]
Length=250

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP*T  270
            AV+FGPA+VSW W   W+YWVGPL+GGG+AG++Y+++FI   HE LP T
Sbjct  200  AVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTT  248



>ref|XP_010031004.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW50265.1| hypothetical protein EUGRSUZ_J00051 [Eucalyptus grandis]
Length=252

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSWSWD HW+YW+GPL+G GIA +VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWSWDNHWVYWLGPLIGAGIAAIVYDNIFIGDNTHEPLP  248



>gb|AHJ09607.1| aquaporin protein 26 [Camellia sinensis]
Length=258

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSWSWD HWIYW GPL+G  +A ++Y+L F+   HE LP
Sbjct  208  AVSFGPAVVSWSWDNHWIYWAGPLIGSALAAIIYELFFMNHTHEQLP  254



>gb|ADU25490.1| tonoplastic intrinsic protein [Helianthemum almeriense]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSW+W+ HW+YW GPLVGGG+AGLVY+  FI    HE LP T
Sbjct  201  AVSFGPALVSWNWENHWVYWAGPLVGGGLAGLVYEFXFISNSGHEQLPST  250



>dbj|BAD90703.1| tonoplast intrinsic protein 1;2 [Mimosa pudica]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+W  HW+YW+GP VG GIA LVY+L+FI Q+ HE LP T
Sbjct  201  AVSFGPAVVSWTWANHWVYWLGPFVGAGIAALVYELLFINQNTHEPLPTT  250



>gb|KDP43963.1| hypothetical protein JCGZ_05430 [Jatropha curcas]
Length=254

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW W  HW+YW GPL+GGG+AGL+Y+ IFI + HE +P
Sbjct  204  AVSFGPALVSWDWTHHWVYWAGPLIGGGLAGLIYETIFISRTHEPVP  250



>gb|AHI54565.1| tonoplastic intrinsic protein [Camellia japonica]
Length=258

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSWSWD HWIYW GPL+G  +A ++Y+L F+   HE LP
Sbjct  208  AVSFGPAVVSWSWDDHWIYWAGPLIGSALAAIIYELFFMTHTHEQLP  254



>ref|XP_002274538.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
Length=251

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A++FGPA+VSW W  HW+YW GPL+GGGIAGLVY+ +FI   HE LP
Sbjct  201  AMSFGPALVSWDWTNHWVYWAGPLIGGGIAGLVYETVFIHHTHEPLP  247



>ref|XP_008357781.1| PREDICTED: aquaporin TIP1-3-like [Malus domestica]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY+LIFI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAVVYELIFIGPDTHEQLP  248



>ref|XP_009358317.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY+LIFI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAVVYELIFIGPDTHEQLP  248



>dbj|BAG15863.1| aquaporin [Bruguiera gymnorhiza]
Length=212

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*TA  267
            AV+FGPAVVSW+WD HW+YWVGP VG  IA +VY++ FI P  HE LP +A
Sbjct  160  AVSFGPAVVSWTWDNHWVYWVGPFVGAAIAAVVYEVFFINPSTHEQLPISA  210



>ref|XP_011010727.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
 ref|XP_011012605.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=255

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIFI   HE LP
Sbjct  205  AVPFGPALVSWNWYHHWVYWAGPLIGGGLAGVVYELIFISHTHEPLP  251



>ref|XP_009421351.1| PREDICTED: probable aquaporin TIP1-2 [Musa acuminata subsp. malaccensis]
Length=252

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSW+WD HW+YWVGPL+G  IA LVYD +FI Q  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWVGPLIGAAIAALVYDGVFIGQATHEQLP  248



>ref|XP_002322910.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93416.1| unknown [Populus trichocarpa]
 gb|ABK93851.1| unknown [Populus trichocarpa]
 gb|EEF04671.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AV+FGPA+VSWSW  HW+YW GPLVGGG+AGL+Y+L FI    HE LP T
Sbjct  201  AVSFGPALVSWSWTNHWVYWAGPLVGGGLAGLIYELFFIGFGTHEQLPTT  250



>emb|CAB61841.1| putative gamma tonoplast intrinsic protein (TIP) [Sporobolus 
stapfianus]
Length=250

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGP++VSWSW+ HW+YWVGP +G  +A L+YD++FI  H HE LP T
Sbjct  199  AVSFGPSLVSWSWNNHWVYWVGPFIGAALAALIYDMLFISSHTHEQLPTT  248



>ref|XP_004304478.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=253

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPA+VSWSW+ HW+YW GPLVGGG+AGLVY+  FI    HE LP
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFINNSGHEPLP  248



>emb|CDP08994.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPAVVSW+W  HW+YW+GP VG  IA +VY+L FI Q HE LP
Sbjct  201  AVSFGPAVVSWTWTGHWVYWLGPFVGAAIAAIVYELFFIHQTHEQLP  247



>gb|ABP35520.1| tonoplast intrinsic protein [Ipomoea batatas]
Length=251

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSWSW+ HW+YW+GP +G  IA LVY +IFI Q+ HE LP T
Sbjct  200  AVSFGPAVVSWSWECHWVYWLGPFLGAAIAALVYQVIFICQNTHEQLPTT  249



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEA  282
            AVAFGPAVVSW+W  HW+YW GPLVGGGIAGL+Y++ FI   H +
Sbjct  201  AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHTS  245



>dbj|BAM15884.1| putative tonoplast intrinsic protein 1, partial [Pyrus pyrifolia 
var. culta]
Length=166

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY+LIFI Q  H+ LP T
Sbjct  115  AVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAVVYELIFIAQDTHQQLPTT  164



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP*T  270
            AV+FGPA+VSWSW  HW+YW GPL+GGG+AGL+Y+L FI    HE LP T
Sbjct  201  AVSFGPALVSWSWTNHWVYWAGPLIGGGLAGLIYELFFIGFGTHEQLPTT  250



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP VG GIA +VY+  FI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGAGIAAIVYETFFISPSTHEQLP  248



>gb|KHG11211.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGAAIAAIVYEVFFIAPDTHEQLPTT  250



>dbj|BAB12722.1| gamma tonoplast intrinsic protein [Pyrus communis]
Length=252

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPL+G G+AGL+Y+ +FI    HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLIGAGLAGLIYEFVFIGNSGHEQLPST  250



>ref|XP_006833429.1| hypothetical protein AMTR_s00109p00145020 [Amborella trichopoda]
 gb|ERM98707.1| hypothetical protein AMTR_s00109p00145020 [Amborella trichopoda]
Length=250

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+ SW W  HWIYWVGPLVGG +AGLVY+ IFI + HE LP
Sbjct  198  ARSFGPALASWDWSNHWIYWVGPLVGGALAGLVYENIFIIRTHEPLP  244



>gb|AFQ23566.1| aquaporin TIP1 [Hedychium coronarium]
Length=249

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            A+AFGPA+VSWSW   WIYWVGPL+GGGIAG+VY++ FI   HE
Sbjct  200  AIAFGPALVSWSWTHQWIYWVGPLIGGGIAGVVYEIFFISHTHE  243



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+W  HW+YW+GP +GGGIA +VY+  FI P  HE LP
Sbjct  201  AVSFGPAVVSWTWSNHWVYWLGPFIGGGIAAVVYETFFISPNTHEQLP  248



>ref|XP_010112915.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXC35064.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YW+GP VG  IA LVY++IFI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWANHWVYWLGPFVGAAIAALVYEIIFIGPTTHEQLPTT  250



>gb|AEQ29861.1| aquaporin TIP1 [Malus prunifolia]
Length=252

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPL+G GIAG++Y+ +FI    HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIGNSGHEQLPST  250



>gb|AAB17284.1| tonoplast intrinsic protein [Mesembryanthemum crystallinum]
Length=253

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 2/44 (5%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            AV+FGPA+VSW+W+ HW+YWVGPL+GGG+AG++Y+ IFI  HHE
Sbjct  201  AVSFGPALVSWTWNNHWVYWVGPLIGGGLAGVIYETIFI--HHE  242



>ref|XP_002314305.2| nodulin-26 family protein [Populus trichocarpa]
 gb|EEE88260.2| nodulin-26 family protein [Populus trichocarpa]
Length=255

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIFI   HE L
Sbjct  205  AVPFGPALVSWNWHHHWVYWAGPLIGGGLAGVVYELIFISHTHEPL  250



>ref|XP_008350342.1| PREDICTED: aquaporin TIP1-1-like [Malus domestica]
Length=252

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPL+G GIAG++Y+ +FI    HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIGNSGHEQLPST  250



>ref|NP_001274695.1| aquaporin TIP1-3-like [Solanum lycopersicum]
 dbj|BAO18633.1| tonoplast intrinsic protein 1;2 [Solanum lycopersicum]
Length=253

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP  G  IA LVY++IFI Q+ HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFGGAAIAALVYEIIFIGQNTHEQLPTT  250



>ref|XP_009349744.1| PREDICTED: aquaporin TIP1-1-like [Pyrus x bretschneideri]
Length=252

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSW  HW+YW GPL+G G+AGL+Y+ +FI    HE LP T
Sbjct  201  AVSFGPALVSWSWQNHWVYWAGPLIGAGLAGLIYEFVFIGNSGHEQLPST  250



>ref|XP_009382161.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSWSW   W+YW+GPL+GG +AG+VY++ FI   HE LP
Sbjct  200  AVSFGPALVSWSWTHQWVYWLGPLIGGALAGIVYEIFFISHSHEQLP  246



>gb|AAL49753.1|AF452015_1 aquaporin-like protein [Petunia x hybrida]
Length=250

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGP++VSW+W   WIYW GP++GGG+AG+VY+L+FI   HE LP
Sbjct  200  AVSFGPSLVSWTWTHQWIYWAGPIIGGGLAGVVYELLFINHSHEPLP  246



>ref|XP_008795635.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AV+FGPA+VSWSW+  W+YW+GPL+GGG+AGLVY+  FIP   E L
Sbjct  200  AVSFGPALVSWSWNDQWVYWLGPLIGGGLAGLVYETFFIPPTPEQL  245



>ref|XP_007016527.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY34146.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAVVYEIFFIAPNTHEQLP  248



>ref|XP_010422715.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=252

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G GIA +VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAGIAAIVYDTIFISSNGHEPLP  248



>ref|XP_006286822.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
 gb|EOA19720.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
Length=252

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G GIA +VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAGIAAIVYDTIFISSNGHEPLP  248



>ref|XP_010920700.1| PREDICTED: probable aquaporin TIP1-2 [Elaeis guineensis]
Length=253

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI--PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GPL+G  +A +VYDL FI     HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPLIGAAVAAIVYDLFFIGHGTTHEQLPTT  251



>ref|XP_011000304.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDRHWVYWLGPFVGSAIAAIVYEVFFINPSTHEQLP  248



>gb|AFK34456.1| unknown [Lotus japonicus]
Length=252

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSW+W  HW+YW GPL+G  IA +VY+L FIPQ ++E LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWAGPLIGSAIAAVVYELFFIPQSNYEELP  248



>gb|KHG14163.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAIVYEVFFIAPDTHEQLP  248



>ref|XP_011089965.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=259

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VS++W  HW+YW GPL+GG +AG+VY++ FI   HEALP
Sbjct  209  AVSFGPALVSFTWTHHWVYWAGPLIGGALAGVVYEVFFISHSHEALP  255



>gb|AAD31847.1|AF133531_1 water channel protein MipI [Mesembryanthemum crystallinum]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*TA  267
            AV+FGPAVVSWSW+ HW+YW+GP  G GIA L+Y ++FI P ++E LP TA
Sbjct  201  AVSFGPAVVSWSWNNHWVYWLGPFAGAGIAALLYHIVFIQPDNYEELPSTA  251



>gb|EYU37031.1| hypothetical protein MIMGU_mgv1a016968mg [Erythranthe guttata]
Length=99

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AV+FGPA+VS+SW  HWIYW GPL+GGG+AG++Y++ FI   HE L
Sbjct  51   AVSFGPALVSFSWANHWIYWAGPLIGGGLAGVIYEIFFISHTHEPL  96



>ref|XP_010049101.1| PREDICTED: aquaporin TIP4-1 [Eucalyptus grandis]
 gb|KCW81557.1| hypothetical protein EUGRSUZ_C02914 [Eucalyptus grandis]
Length=243

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+ SW W  HW+YWVGPLVGGG+AGLVY+  FI + H+ LP
Sbjct  195  ARSFGPALASWDWTDHWVYWVGPLVGGGLAGLVYENFFICRSHDLLP  241



>ref|XP_006396348.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
 gb|ESQ37801.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA +VYD IFI  H HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYDTIFIDSHGHEPLP  248



>gb|AGG39699.1| aquaporin protein AQU21 [Camellia sinensis]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YW+GPL+G  IA LVYD IFI  + HEALP
Sbjct  201  AVSFGPAVVSWTWANHWVYWLGPLIGAAIAALVYDNIFIGDNAHEALP  248



>gb|AGD98711.1| aquaporin protein 8 [Camellia sinensis]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YW+GPL+G  IA LVYD IFI  + HEALP
Sbjct  201  AVSFGPAVVSWTWANHWVYWLGPLIGAAIAALVYDNIFIGDNAHEALP  248



>ref|XP_007202475.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
 gb|EMJ03674.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPA+VSW+W  HWIYW GPL+GGG+AGL+Y+ +FI    HE LP
Sbjct  201  AVSFGPALVSWNWHNHWIYWAGPLIGGGLAGLIYEFVFIGNSSHEPLP  248



>emb|CAA64952.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=259

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  404  GPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            G A+VSWSW +HW+YWVGPL+GGGIAG+VYDL FI   HE  P
Sbjct  205  GRALVSWSWTSHWVYWVGPLIGGGIAGIVYDLFFINSTHEPAP  247



>ref|XP_011089424.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=254

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 3/52 (6%)
 Frame = -3

Query  416  AVAFGPAVVSWSW--DAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+W  ++HW+YWVGP VG GIA LVY+++FI Q+ HE LP T
Sbjct  201  AVSFGPAVVSWTWTWNSHWVYWVGPFVGAGIAALVYEVLFINQNGHEQLPTT  252



>gb|ADW66151.1| tonoplast intrinsic protein 1-1 [Solanum nigrum]
Length=145

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGP+++SW+W   W+YW GPL+GGG+AG +Y+ IFI   HE +P
Sbjct  95   AVSFGPSLISWTWTHQWVYWAGPLIGGGLAGFIYEFIFISHTHEQIP  141



>ref|XP_009624595.1| PREDICTED: aquaporin TIP1-3 [Nicotiana tomentosiformis]
Length=252

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W++HW+YW+GP VG  IA LVY++IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWNSHWVYWLGPFVGAAIAALVYEIIFIGDNTHEQLP  248



>dbj|BAD04010.1| tonoplast intrinsic protein [Prunus persica]
Length=252

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPA+VSW+W  HWIYW GPL+GGG+AGL+Y+ +FI    HE LP
Sbjct  201  AVSFGPALVSWNWHNHWIYWAGPLIGGGLAGLIYEFVFIGNSSHEPLP  248



>ref|XP_006350747.1| PREDICTED: aquaporin TIP1-3-like [Solanum tuberosum]
Length=253

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP  G  IA L+Y++IFI Q+ HE LP T
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFGGAAIAALLYEIIFIGQNTHEQLPCT  250



>ref|XP_008788076.1| PREDICTED: aquaporin TIP1-3-like [Phoenix dactylifera]
Length=252

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP++G  +A +VYD+ FI +  HE LP T
Sbjct  201  AVSFGPAVVSWTWDHHWVYWLGPMIGAALAAIVYDMCFIGRGTHEQLPTT  250



>ref|XP_007150288.1| hypothetical protein PHAVU_005G141100g [Phaseolus vulgaris]
 gb|ESW22282.1| hypothetical protein PHAVU_005G141100g [Phaseolus vulgaris]
Length=238

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YWVGP  G  IA +VY+++FI P  HE LP T
Sbjct  187  AVSFGPAVVSWTWANHWVYWVGPFAGAAIAAVVYEILFINPNTHEQLPTT  236



>emb|CDO19480.1| tonoplast intrinsec protein, partial [Olea europaea]
Length=116

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  413  VAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            V+FGPAVV W+WD HW+YW+GP VG GIA LVY+++FI Q H+
Sbjct  74   VSFGPAVVIWTWDTHWVYWLGPFVGAGIAALVYEILFINQSHQ  116



>gb|AGK27806.1| AQP1, partial [Pteris vittata]
 gb|AGS18562.1| TIP-like aquaporin [Pteris vittata]
Length=260

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 6/56 (11%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ------HHEALP*TA  267
            A +FGPA+V+WSWD HWIYWVGP++GG +AG++Y+LI+I         HE LP +A
Sbjct  201  ARSFGPALVAWSWDNHWIYWVGPILGGALAGIIYELIYIETSEPTGGQHERLPSSA  256



>gb|ACY74345.1| aquaporin-like protein [Capsicum annuum]
Length=250

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGP++VSW+W   W+YW GPL+GGG+AG +Y+ +FI   HE +P
Sbjct  199  AVSFGPSLVSWTWTNQWVYWAGPLIGGGLAGFIYEFVFISHTHEQIP  245



>ref|NP_001234103.1| aquaporin-like [Solanum lycopersicum]
 dbj|BAD95790.1| similar to aquaporin [Solanum lycopersicum]
 dbj|BAO18632.1| tonoplast intrinsic protein 1;1 [Solanum lycopersicum]
Length=250

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGP++VSW+W   W+YW GPL+GGG+AG +Y+ IFI   HE +P
Sbjct  200  AVSFGPSLVSWTWTHQWVYWAGPLIGGGLAGFIYEFIFISHTHEQIP  246



>ref|XP_011018806.1| PREDICTED: aquaporin TIP1-1 [Populus euphratica]
Length=252

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP  276
            AV+FGPA+VSW+W  HW+YW GPL+GGG+AGL+Y+  FI   +HE LP
Sbjct  201  AVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLIYEFFFIGFGNHEQLP  248



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP  276
            AV+FGPA+VSW+W  HW+YW GPL+GGG+AGL+Y+  FI   +HE LP
Sbjct  201  AVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLIYEFFFIGFGNHEQLP  248



>ref|XP_010253312.1| PREDICTED: aquaporin TIP1-3-like [Nelumbo nucifera]
Length=251

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGPL+G  IA +VYD +FI ++ HE LP
Sbjct  201  AVSFGPAVVSWTWTHHWVYWVGPLIGAAIAAIVYDTLFIGENTHEQLP  248



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YWVGP  G  IA +VY++ FI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAIVYEIFFISPNTHEQLPVT  250



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIP-QHHEALP  276
            AV+FGPA+VSW+W  HW+YW GPLVGGG+AGL+Y+  FI    HE LP
Sbjct  201  AVSFGPALVSWTWTNHWVYWAGPLVGGGLAGLIYEFFFIGFGSHEQLP  248



>ref|XP_006347203.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=250

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGP+++SW+W   W+YW GPL+GGG+AG +Y+ IFI   HE +P
Sbjct  200  AVSFGPSLISWTWTHQWVYWAGPLIGGGLAGFIYEFIFISHTHEQIP  246



>ref|XP_004307108.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSWSW +HW+YW+GPL+G  IA ++YD I I P  HE LP T
Sbjct  202  AVSFGPAVVSWSWASHWVYWLGPLLGAAIAAIIYDWILIAPTTHEPLPTT  251



>ref|XP_003542571.1| PREDICTED: aquaporin TIP1-1-like [Glycine max]
Length=250

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHE  285
            A +FGPAVV WSW  HW+YWVGPLVGGG+AG +Y+LIF+    +
Sbjct  200  AASFGPAVVGWSWKNHWVYWVGPLVGGGLAGFMYELIFVSHSRQ  243



>ref|XP_008387528.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Malus domestica]
Length=252

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPA+VSWSW+ HW+YW GPL+G G AG++Y+ +FI    HE LP T
Sbjct  201  AVSFGPALVSWSWENHWVYWAGPLIGAGXAGVIYEFVFIGNSGHEQLPST  250



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YWVGP  G  IA +VY++ FI P  HE LP T
Sbjct  201  AVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAVVYEIFFISPNTHEQLPVT  250



>ref|XP_011019624.1| PREDICTED: aquaporin TIP4-1 [Populus euphratica]
Length=247

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFITRSHRPLP  241



>ref|XP_002309548.1| aquaporin TIP4.1 family protein [Populus trichocarpa]
 gb|EEE93071.1| aquaporin TIP4.1 family protein [Populus trichocarpa]
Length=247

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFITRSHRPLP  241



>ref|XP_011088796.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=255

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AVAFGPAVVS++W  HWIYW GPL+GGG+AG+VY+  FI   HE L
Sbjct  207  AVAFGPAVVSFTWTNHWIYWAGPLIGGGLAGVVYEGFFISHTHEPL  252



>ref|XP_010696310.1| PREDICTED: probable aquaporin TIP1-2 [Beta vulgaris subsp. vulgaris]
Length=254

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEA  282
            AV+FGPAV+SW+W  HWIYWVGPL+G GIAGL+Y+ IFI     A
Sbjct  201  AVSFGPAVMSWNWTNHWIYWVGPLIGAGIAGLIYEFIFIGHQEPA  245



>ref|XP_011041956.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE +P
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAIVYEVCFISPATHEQIP  248



>ref|XP_010456993.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=238

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA +VYD IFI  + HE LP
Sbjct  187  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYDTIFISSNGHEPLP  234



>ref|XP_010922400.1| PREDICTED: aquaporin TIP1-3-like [Elaeis guineensis]
Length=252

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP*T  270
            AV+FGPAVVSW+WD HW++W+GP++G  +A +VYD+ FI +  HE LP T
Sbjct  201  AVSFGPAVVSWTWDHHWVFWLGPMIGAALAAIVYDMCFICRGTHEQLPTT  250



>gb|KHG06645.1| putative aquaporin TIP1-2 [Gossypium arboreum]
Length=252

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD+HW+YW+GP +G  IA +VY++ FI P  +E LP
Sbjct  201  AVSFGPAVVSWTWDSHWVYWLGPFIGSAIAAIVYEVFFIAPSTYEELP  248



>ref|XP_010428353.1| PREDICTED: aquaporin TIP1-3 [Camelina sativa]
Length=252

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA +VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYDTIFISSNGHEPLP  248



>gb|ACF78734.1| unknown [Zea mays]
 gb|AFW83841.1| aquaporin TIP1-2 [Zea mays]
Length=254

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*TA  267
            AV+FGPAVV+  W+ HW+YWVGPL G  IA LVYD+IFI Q  H+ LP TA
Sbjct  201  AVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTTA  251



>ref|NP_001105029.1| aquaporin TIP1-2 [Zea mays]
 sp|Q9ATM0.1|TIP12_MAIZE RecName: Full=Aquaporin TIP1-2; AltName: Full=Tonoplast intrinsic 
protein 1-2; AltName: Full=ZmTIP1-2; AltName: Full=ZmTIP1;2 
[Zea mays]
 gb|AAK26767.1| tonoplast membrane integral protein ZmTIP1-2 [Zea mays]
 gb|ACG36209.1| aquaporin TIP1.2 [Zea mays]
Length=254

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*TA  267
            AV+FGPAVV+  W+ HW+YWVGPL G  IA LVYD+IFI Q  H+ LP TA
Sbjct  201  AVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTTA  251



>gb|AAB47180.1| root-specific protein homolog {clone CHEM 8} [Zea mays=maize, 
cv. INRA 258, mercuric chloride-treated, leaves, Peptide Partial, 
55 aa]
Length=55

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  407  FGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            FGPAVVSW W   W+YW GPL+GGG+A ++Y+L+FI   HE LP
Sbjct  1    FGPAVVSWEWGYQWVYWAGPLIGGGLAAVIYELLFINHTHEQLP  44



>ref|XP_006424746.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
 gb|ESR37986.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
Length=250

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+WD HW+YW+GP VG  IA + Y + FI P  HE LP T
Sbjct  199  AVSFGPAVVSWTWDNHWVYWLGPFVGAAIAAIAYTVAFICPNTHEQLPST  248



>ref|XP_008343557.1| PREDICTED: aquaporin TIP1-3 [Malus domestica]
Length=252

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSWSW  HW+YW GPL+G  IA LVYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWSWTHHWVYWAGPLIGAAIAALVYDNIFIGNRTHEPLP  248



>ref|XP_009780564.1| PREDICTED: aquaporin TIP1-3 [Nicotiana sylvestris]
Length=252

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W++HW+YW+GP VG   A LVY++IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWNSHWVYWLGPFVGAATAALVYEIIFIGDNTHEQLP  248



>ref|XP_010096653.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXB65321.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSW+W  HW+YW GP++G GIA +VYD IFI +  HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWAGPMIGAGIAAIVYDNIFIGEPTHEPLP  248



>ref|XP_002516539.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF45880.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=247

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFIIRSHRPLP  241



>ref|XP_009337569.1| PREDICTED: aquaporin TIP1-3 [Pyrus x bretschneideri]
Length=252

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSWSW  HW+YW GPL+G  IA LVYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWSWTHHWVYWAGPLIGAAIAALVYDNIFIGNRTHEPLP  248



>ref|XP_009772083.1| PREDICTED: aquaporin TIP1-1-like [Nicotiana sylvestris]
Length=125

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA+VSW+W   W+YW GP++G G+AG+VY+L FI   HE +P
Sbjct  75   AVSFGPALVSWTWTHQWVYWAGPIIGAGLAGVVYELFFINHSHEQVP  121



>ref|XP_009111380.1| PREDICTED: aquaporin TIP1-3 [Brassica rapa]
 emb|CDY69446.1| BnaA09g51590D [Brassica napus]
 emb|CDY07142.1| BnaCnng01570D [Brassica napus]
Length=252

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA +VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYDTIFIDSNGHEPLP  248



>dbj|BAM44345.1| vacuolar aluminum transporter [Hydrangea macrophylla]
Length=252

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YW+GP++G  IA L+YD IFI    HE LP T
Sbjct  201  AVSFGPAVVSWTWTHHWVYWLGPMIGAAIAALIYDNIFIGDSTHEQLPVT  250



>ref|XP_002314201.1| nodulin-26 family protein [Populus trichocarpa]
 gb|ABK92822.1| unknown [Populus trichocarpa]
 gb|EEE88156.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEAL  279
            AV+FGPAVVSW+WD HW+YW+GP VG  IA +VY++ FI P  HE L
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAIVYEVCFISPTTHEQL  247



>ref|XP_003606614.1| Aquaporin TIP1-1 [Medicago truncatula]
 gb|AES88811.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP*T  270
            AV+FGPAVVSW+W  HW+YWVGPL+G  IA +VY+  FI P  +E LP T
Sbjct  201  AVSFGPAVVSWTWANHWVYWVGPLIGSAIAAVVYETFFITPSSYEQLPVT  250



>gb|ADE34283.1| aquaporin TIP1;7 [Gossypium hirsutum]
Length=252

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+WD HW+YW+GP +G  IA +VY++ FI P  +E LP
Sbjct  201  AVSFGPAVVSWTWDNHWVYWLGPFIGSAIAAIVYEVFFIAPSTYEELP  248



>ref|XP_008241379.1| PREDICTED: aquaporin TIP1-1 [Prunus mume]
Length=252

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPA+VSWSW  HW+YW GPL+GGG+AGL+Y   FI    H+ALP
Sbjct  201  AVSFGPALVSWSWHNHWVYWAGPLIGGGVAGLIYAAAFIGNSGHDALP  248



>gb|ACB71282.1| tonoplast intrinsic protein [Tamarix hispida]
Length=252

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEA  282
            AV+FGPAVVSWSWD  W+YW+GP +G GIA L+Y+L FI Q ++A
Sbjct  201  AVSFGPAVVSWSWDDPWVYWLGPFLGAGIAALIYELFFIRQDNDA  245



>ref|XP_007012110.1| Tonoplast intrinsic protein 4,1 [Theobroma cacao]
 gb|EOY29729.1| Tonoplast intrinsic protein 4,1 [Theobroma cacao]
Length=247

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYEYFFIVRTHAPLP  241



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSW+W  HW+YW+GP +G GIA LVYD IFI    HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWLGPFIGAGIAALVYDNIFIGSGGHEPLP  248



>ref|XP_011022886.1| PREDICTED: aquaporin TIP1-3 [Populus euphratica]
Length=252

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSW+W  HW+YW+GP +G GIA LVYD IFI    HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWLGPFIGAGIAALVYDNIFIGSGGHEPLP  248



>ref|XP_006384960.1| nodulin-26 family protein [Populus trichocarpa]
 gb|ERP62757.1| nodulin-26 family protein [Populus trichocarpa]
Length=256

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIF+    HE LP
Sbjct  205  AVPFGPALVSWNWYHHWVYWAGPLIGGGLAGIVYELIFMSHSTHEPLP  252



>gb|ADF32096.1| aquaporin [Populus x canadensis]
Length=256

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIF+    HE LP
Sbjct  205  AVPFGPALVSWNWYHHWVYWAGPLIGGGLAGIVYELIFMSHSTHEPLP  252



>ref|XP_009401846.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=251

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEAL  279
            AV+FGPA+VSWSW   W+YW+GPL GG +AGLVY++ FI   HE L
Sbjct  201  AVSFGPALVSWSWTHQWVYWLGPLSGGALAGLVYEIFFICSTHEQL  246



>ref|XP_004505892.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFI-PQHHEALP  276
            AV+FGPAVVSW+W  HW+YWVGPL+G  +A +VY++ FI P  +E LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPLIGSAVAAVVYEIFFITPSSYEQLP  248



>ref|XP_011028266.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
 ref|XP_011016522.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=256

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIF+    HE LP
Sbjct  205  AVPFGPALVSWNWYHHWVYWAGPLIGGGLAGIVYELIFMSHGTHEPLP  252



>ref|XP_008801471.1| PREDICTED: probable aquaporin TIP4-3 [Phoenix dactylifera]
Length=249

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+ SW W  HWIYWVGPL+GG +AG +YD +FI + HE LP
Sbjct  198  ARSFGPALASWDWTDHWIYWVGPLIGGPLAGFIYDHLFIIRTHEPLP  244



>emb|CAN66944.1| hypothetical protein VITISV_020091 [Vitis vinifera]
 emb|CBI20864.3| unnamed protein product [Vitis vinifera]
 gb|AIK66519.1| putative aquaporin [Vitis vinifera]
Length=253

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW W  HW+YWVGPLVGG +AG VY+  FI + H  LP
Sbjct  197  ARSFGPALVSWDWTNHWVYWVGPLVGGAVAGFVYENFFINRPHLRLP  243



>ref|XP_002872891.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49150.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA  VYD IFI  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAATVYDTIFIGSNGHEPLP  248



>gb|KDP29873.1| hypothetical protein JCGZ_18448 [Jatropha curcas]
Length=252

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEAL  279
            AV+FGPAVVSW+W  HW+YWVGPL+G  IA LVYD IFI +  HE L
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPLIGAAIAALVYDNIFIGEGAHEPL  247



>ref|XP_009592994.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AV+FGPA VSW+W   W+YW GP++G G+AG+VY+L FI   HE +P
Sbjct  201  AVSFGPAFVSWTWTHQWVYWAGPIIGAGLAGVVYELFFINHSHEQVP  247



>gb|EPS60922.1| hypothetical protein M569_13880, partial [Genlisea aurea]
Length=247

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            AVAFGP+VVS  W  HWIYW+GPL+GG +AG+VY++ FI   HE LP
Sbjct  201  AVAFGPSVVSGVWTDHWIYWLGPLLGGAVAGVVYEVFFISHTHEPLP  247



>gb|KFK30698.1| hypothetical protein AALP_AA6G016000 [Arabis alpina]
Length=252

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP  276
            AV+FGPAVVSW+W  HW+YWVGP +G  IA +VYD IF+  + HE LP
Sbjct  201  AVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYDTIFLGSNGHEPLP  248



>gb|AEV54107.1| putative tonoplast intrinsic protein 1.7 [Populus deltoides x 
Populus x canadensis]
Length=236

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ  294
            AV FGPA+VSW+W  HW+YW GPL+GGG+AG+VY+LIFI  
Sbjct  196  AVPFGPALVSWNWHHHWVYWAGPLIGGGLAGVVYELIFISH  236



>ref|XP_006645407.1| PREDICTED: probable aquaporin TIP1-2-like [Oryza brachyantha]
Length=254

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH-HEALP*T  270
            AV+FGPAVV+  WD HW+YW+GP +G  IA LVYD+IFI Q  H+ LP T
Sbjct  203  AVSFGPAVVTGVWDNHWVYWLGPFIGAAIAALVYDIIFIGQRPHDQLPTT  252



>gb|KHG13169.1| Aquaporin TIP4-1 -like protein [Gossypium arboreum]
Length=246

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW+W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWNWTDHWVYWVGPLIGGGLAGYIYENFFIVRTHVLLP  241



>tpg|DAA33872.1| TPA_inf: aquaporin TIP4;1 [Gossypium hirsutum]
 tpg|DAA33873.1| TPA_inf: aquaporin TIP4;2 [Gossypium hirsutum]
Length=246

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQHHEALP  276
            A +FGPA+VSW+W  HW+YWVGPL+GGG+AG +Y+  FI + H  LP
Sbjct  195  ARSFGPALVSWNWTDHWVYWVGPLIGGGLAGYIYENFFIVRTHVLLP  241



>ref|XP_008233574.1| PREDICTED: aquaporin TIP1-3 [Prunus mume]
Length=252

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP  276
            AV+FGPAVVSWSW  HW+YW GPL+G  IA LVYD IFI    HE LP
Sbjct  201  AVSFGPAVVSWSWSHHWVYWAGPLIGAAIAALVYDNIFIGDGGHEPLP  248



>gb|ABK22410.1| unknown [Picea sitchensis]
Length=255

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQH--HEALP  276
            A AFGPA+VSW+W  HWI+WVGPL+GGG+AG ++++ FI     HE LP
Sbjct  203  ARAFGPALVSWTWKNHWIFWVGPLIGGGLAGAIFEVFFIEARPTHERLP  251



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  416  AVAFGPAVVSWSWDAHWIYWVGPLVGGGIAGLVYDLIFIPQ-HHEALP*T  270
            AV+FGPAVVSW+W  HW+YW+GP +G  IA LVYD IFI    HE LP T
Sbjct  201  AVSFGPAVVSWTWTNHWVYWLGPFIGAAIAALVYDNIFIGSGGHEPLPTT  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527874827830