BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13685_g1_i1 len=2478 path=[1:0-2477]

Length=2478
                                                                      Score     E

ref|XP_009591814.1|  PREDICTED: transketolase, chloroplastic-like      1196   0.0     
ref|XP_009786436.1|  PREDICTED: transketolase, chloroplastic-like      1191   0.0     
ref|XP_004228780.1|  PREDICTED: transketolase, chloroplastic-like      1181   0.0     
emb|CDO99755.1|  unnamed protein product                               1149   0.0     
ref|XP_011077266.1|  PREDICTED: transketolase, chloroplastic-like      1123   0.0     
ref|XP_011041028.1|  PREDICTED: transketolase, chloroplastic-like      1079   0.0     
gb|EYU39617.1|  hypothetical protein MIMGU_mgv1a001870mg               1079   0.0     
ref|XP_010032172.1|  PREDICTED: transketolase, chloroplastic-like      1073   0.0     
ref|XP_002531681.1|  transketolase, putative                           1062   0.0     Ricinus communis
gb|KCW51576.1|  hypothetical protein EUGRSUZ_J01078                    1062   0.0     
ref|XP_008806920.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...   1053   0.0     
ref|XP_010918808.1|  PREDICTED: transketolase, chloroplastic-like      1053   0.0     
ref|XP_006485646.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...   1039   0.0     
ref|XP_002315311.1|  hypothetical protein POPTR_0010s23150g            1036   0.0     Populus trichocarpa [western balsam poplar]
emb|CBI31439.3|  unnamed protein product                                910   0.0     
ref|XP_001776961.1|  predicted protein                                  907   0.0     
ref|XP_002986263.1|  hypothetical protein SELMODRAFT_234975             897   0.0     
ref|XP_002985082.1|  hypothetical protein SELMODRAFT_268939             895   0.0     
ref|XP_006436449.1|  hypothetical protein CICLE_v10033603mg             894   0.0     
ref|XP_006827464.1|  hypothetical protein AMTR_s00009p00124530          816   0.0     
gb|ACN39962.1|  unknown                                                 761   0.0     Picea sitchensis
ref|NP_001052335.1|  Os04g0266900                                       758   0.0     Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87979.1|  predicted protein                                      756   0.0     
ref|NP_001056711.1|  Os06g0133800                                       755   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAH66254.1|  OSIGBa0139I12.3                                        756   0.0     Oryza sativa [red rice]
ref|XP_006652140.1|  PREDICTED: transketolase, chloroplastic-like       755   0.0     
dbj|BAJ91301.1|  predicted protein                                      754   0.0     
gb|AAO33154.1|  putative transketolase                                  755   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EAY93323.1|  hypothetical protein OsI_15126                          754   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008813030.1|  PREDICTED: transketolase, chloroplastic            754   0.0     
ref|XP_004970575.1|  PREDICTED: transketolase, chloroplastic-like       750   0.0     
gb|EYU31980.1|  hypothetical protein MIMGU_mgv1a001876mg                751   0.0     
ref|XP_004248560.1|  PREDICTED: transketolase, chloroplastic            751   0.0     
dbj|BAJ93658.1|  predicted protein                                      748   0.0     
ref|XP_006656605.1|  PREDICTED: transketolase, chloroplastic-like       747   0.0     
ref|XP_006844816.1|  hypothetical protein AMTR_s00058p00047610          748   0.0     
ref|XP_003557240.1|  PREDICTED: transketolase, chloroplastic            749   0.0     
gb|KDO85798.1|  hypothetical protein CISIN_1g004509mg                   748   0.0     
ref|XP_002446209.1|  hypothetical protein SORBIDRAFT_06g004280          747   0.0     Sorghum bicolor [broomcorn]
ref|XP_008669591.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...    746   0.0     
ref|XP_006445277.1|  hypothetical protein CICLE_v10018991mg             747   0.0     
ref|NP_001275202.1|  transketolase, chloroplastic                       746   0.0     
ref|XP_004964445.1|  PREDICTED: transketolase, chloroplastic-like       747   0.0     
ref|XP_008803984.1|  PREDICTED: transketolase, chloroplastic-like       746   0.0     
ref|XP_010469147.1|  PREDICTED: transketolase-1, chloroplastic-li...    746   0.0     
gb|ABK95795.1|  unknown                                                 746   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009781082.1|  PREDICTED: transketolase, chloroplastic            745   0.0     
ref|XP_010671991.1|  PREDICTED: transketolase, chloroplastic            744   0.0     
gb|KFK35277.1|  hypothetical protein AALP_AA5G264000                    744   0.0     
ref|XP_011034130.1|  PREDICTED: transketolase, chloroplastic            744   0.0     
ref|XP_010264166.1|  PREDICTED: transketolase, chloroplastic            744   0.0     
ref|XP_009418330.1|  PREDICTED: transketolase, chloroplastic-like       744   0.0     
ref|XP_002301278.1|  transketolase family protein                       744   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009411523.1|  PREDICTED: transketolase, chloroplastic-like       744   0.0     
ref|XP_009596626.1|  PREDICTED: transketolase, chloroplastic            744   0.0     
ref|XP_002876580.1|  hypothetical protein ARALYDRAFT_486548             743   0.0     
ref|XP_004497357.1|  PREDICTED: transketolase, chloroplastic-like       743   0.0     
gb|ABK92500.1|  unknown                                                 743   0.0     Populus trichocarpa [western balsam poplar]
ref|WP_015144512.1|  transketolase                                      739   0.0     
ref|XP_011017481.1|  PREDICTED: transketolase, chloroplastic            743   0.0     
ref|XP_003592793.1|  Transketolase                                      742   0.0     
ref|XP_008344551.1|  PREDICTED: transketolase, chloroplastic            739   0.0     
gb|AAO29950.1|  Unknown protein                                         741   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354845.1|  PREDICTED: transketolase, chloroplastic            742   0.0     
ref|NP_567103.1|  transketolase                                         741   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153461.1|  hypothetical protein PHAVU_003G037400g             741   0.0     
ref|XP_002872970.1|  chloroplast transketolase                          740   0.0     
ref|XP_003521870.1|  PREDICTED: transketolase, chloroplastic            739   0.0     
emb|CDX71785.1|  BnaC08g30890D                                          739   0.0     
ref|XP_008438176.1|  PREDICTED: transketolase, chloroplastic            739   0.0     
ref|XP_004306931.1|  PREDICTED: transketolase, chloroplastic-like       739   0.0     
emb|CDY41143.1|  BnaA09g38720D                                          739   0.0     
ref|XP_006290638.1|  hypothetical protein CARUB_v10016731mg             739   0.0     
ref|XP_003581128.1|  PREDICTED: transketolase, chloroplastic-like       738   0.0     
gb|ACF60500.1|  plastid transketolase                                   738   0.0     Nicotiana tabacum [American tobacco]
gb|AAM62766.1|  transketolase-like protein                              738   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941046.1|  PREDICTED: transketolase, chloroplastic            738   0.0     
ref|XP_010413521.1|  PREDICTED: transketolase-1, chloroplastic          738   0.0     
ref|XP_009780210.1|  PREDICTED: transketolase, chloroplastic            738   0.0     
ref|XP_004506536.1|  PREDICTED: transketolase, chloroplastic-like       738   0.0     
ref|NP_001190145.1|  transketolase                                      738   0.0     
ref|XP_007142668.1|  hypothetical protein PHAVU_007G006600g             738   0.0     
ref|XP_006827830.1|  hypothetical protein AMTR_s00009p00268850          738   0.0     
gb|KDP28769.1|  hypothetical protein JCGZ_14540                         738   0.0     
ref|XP_010692960.1|  PREDICTED: transketolase, chloroplastic-like       737   0.0     
ref|XP_010098926.1|  Transketolase                                      738   0.0     
ref|XP_009116754.1|  PREDICTED: transketolase-1, chloroplastic-like     737   0.0     
ref|XP_010419543.1|  PREDICTED: transketolase, chloroplastic-like       737   0.0     
ref|XP_003605140.1|  Transketolase                                      737   0.0     
ref|XP_008460106.1|  PREDICTED: transketolase, chloroplastic            737   0.0     
sp|Q7SIC9.1|TKTC_MAIZE  RecName: Full=Transketolase, chloroplasti...    734   0.0     Zea mays [maize]
ref|XP_009391858.1|  PREDICTED: transketolase, chloroplastic            738   0.0     
ref|XP_010426578.1|  PREDICTED: transketolase, chloroplastic-like       737   0.0     
ref|XP_003556551.1|  PREDICTED: transketolase, chloroplastic            736   0.0     
emb|CDO97702.1|  unnamed protein product                                736   0.0     
ref|XP_004160671.1|  PREDICTED: transketolase, chloroplastic-like       736   0.0     
dbj|BAD67886.1|  putative transketolase 1                               732   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934663.1|  PREDICTED: transketolase, chloroplastic-like       736   0.0     
ref|XP_004964449.1|  PREDICTED: transketolase, chloroplastic-like...    738   0.0     
ref|XP_004145002.1|  PREDICTED: transketolase, chloroplastic-like       736   0.0     
ref|XP_010544646.1|  PREDICTED: transketolase-1, chloroplastic is...    736   0.0     
ref|XP_007052090.1|  Transketolase                                      736   0.0     
emb|CDX89074.1|  BnaA04g01120D                                          735   0.0     
ref|XP_010541872.1|  PREDICTED: transketolase, chloroplastic-like       736   0.0     
ref|XP_009138817.1|  PREDICTED: transketolase-1, chloroplastic          735   0.0     
ref|NP_001267600.1|  transketolase                                      735   0.0     
ref|XP_010456321.1|  PREDICTED: transketolase, chloroplastic-like       734   0.0     
gb|AGH33875.1|  transketolase                                           734   0.0     
gb|KHN37298.1|  Transketolase, chloroplastic                            734   0.0     
ref|XP_010524370.1|  PREDICTED: transketolase-1, chloroplastic-like     734   0.0     
gb|EAY99538.1|  hypothetical protein OsI_21507                          729   0.0     Oryza sativa Indica Group [Indian rice]
emb|CAB82679.1|  transketolase-like protein                             734   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CAA75777.1|  transketolase 1                                        734   0.0     Capsicum annuum
emb|CDY48374.1|  BnaC04g22010D                                          733   0.0     
ref|XP_002511690.1|  transketolase, putative                            734   0.0     Ricinus communis
gb|KFK30590.1|  hypothetical protein AALP_AA6G001400                    732   0.0     
ref|XP_003536788.1|  PREDICTED: transketolase, chloroplastic-like       733   0.0     
ref|XP_011090550.1|  PREDICTED: transketolase, chloroplastic            733   0.0     
ref|XP_007220240.1|  hypothetical protein PRUPE_ppa001865mg             733   0.0     
ref|XP_010513752.1|  PREDICTED: transketolase-1, chloroplastic-like     734   0.0     
gb|AAN65341.1|  thioredoxin/transketolase fusion protein                734   0.0     Zea mays [maize]
ref|XP_010053906.1|  PREDICTED: transketolase, chloroplastic            732   0.0     
dbj|BAJ33959.1|  unnamed protein product                                731   0.0     
ref|WP_015173010.1|  transketolase                                      728   0.0     
ref|XP_010506468.1|  PREDICTED: transketolase-2, chloroplastic          730   0.0     
ref|XP_006345515.1|  PREDICTED: transketolase, chloroplastic-like       730   0.0     
ref|XP_006293747.1|  hypothetical protein CARUB_v10022709mg             729   0.0     
ref|NP_566041.2|  transketolase                                         729   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EMT02862.1|  Transketolase, chloroplastic                            725   0.0     
ref|XP_010276861.1|  PREDICTED: transketolase, chloroplastic            729   0.0     
tpg|DAA38385.1|  TPA: hypothetical protein ZEAMMB73_245271              725   0.0     
ref|XP_004240048.1|  PREDICTED: transketolase, chloroplastic-like       729   0.0     
ref|WP_022607863.1|  transketolase                                      726   0.0     
ref|XP_010053907.1|  PREDICTED: transketolase, chloroplastic-like       728   0.0     
ref|XP_008232640.1|  PREDICTED: transketolase, chloroplastic            728   0.0     
gb|EMS63024.1|  Transketolase, chloroplastic                            723   0.0     
ref|XP_011093362.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...    727   0.0     
gb|KHG02686.1|  Transketolase, chloroplastic                            725   0.0     
ref|XP_001764998.1|  predicted protein                                  721   0.0     
ref|WP_011243295.1|  transketolase                                      723   0.0     
gb|KHG17602.1|  Transketolase, chloroplastic                            725   0.0     
gb|KHG01555.1|  Transketolase, chloroplastic                            725   0.0     
gb|KHG30158.1|  Transketolase, chloroplastic                            728   0.0     
sp|Q42675.1|TKTA_CRAPL  RecName: Full=Transketolase 10; Short=TK        721   0.0     Craterostigma plantagineum
ref|XP_002266494.2|  PREDICTED: transketolase, chloroplastic            723   0.0     Vitis vinifera
gb|KFK37327.1|  hypothetical protein AALP_AA4G242300                    723   0.0     
ref|WP_026788829.1|  MULTISPECIES: transketolase                        719   0.0     
ref|XP_002439367.1|  hypothetical protein SORBIDRAFT_09g005230          718   0.0     Sorghum bicolor [broomcorn]
ref|XP_002437762.1|  hypothetical protein SORBIDRAFT_10g002220          717   0.0     Sorghum bicolor [broomcorn]
ref|XP_002280760.1|  PREDICTED: transketolase, chloroplastic            721   0.0     Vitis vinifera
ref|XP_001769997.1|  predicted protein                                  720   0.0     
emb|CDY68196.1|  BnaAnng26460D                                          721   0.0     
sp|O20250.1|TKTC_SPIOL  RecName: Full=Transketolase, chloroplasti...    720   0.0     Spinacia oleracea
emb|CDX74726.1|  BnaA05g04720D                                          720   0.0     
ref|XP_001769987.1|  predicted protein                                  718   0.0     
gb|KHN35634.1|  Transketolase, chloroplastic                            715   0.0     
emb|CAN72939.1|  hypothetical protein VITISV_026323                     719   0.0     Vitis vinifera
gb|KEI66557.1|  Tkt                                                     715   0.0     
ref|XP_004964450.1|  PREDICTED: transketolase, chloroplastic-like...    719   0.0     
ref|WP_015125605.1|  transketolase                                      715   0.0     
ref|XP_002991248.1|  hypothetical protein SELMODRAFT_161534             714   0.0     
ref|XP_002953691.1|  hypothetical protein VOLCADRAFT_75893              716   0.0     
ref|XP_004964448.1|  PREDICTED: transketolase, chloroplastic-like...    720   0.0     
ref|XP_008658482.1|  PREDICTED: hypothetical protein isoform X1         713   0.0     
ref|WP_004268410.1|  transketolase                                      714   0.0     
ref|XP_009143123.1|  PREDICTED: transketolase-2, chloroplastic          716   0.0     
ref|XP_002991185.1|  hypothetical protein SELMODRAFT_161485             712   0.0     
gb|KDO85800.1|  hypothetical protein CISIN_1g004509mg                   715   0.0     
ref|WP_023071196.1|  transketolase                                      712   0.0     
ref|WP_017292875.1|  transketolase                                      712   0.0     
ref|WP_012629867.1|  transketolase                                      711   0.0     
gb|ACF88120.1|  unknown                                                 710   0.0     Zea mays [maize]
ref|WP_016868432.1|  transketolase                                      711   0.0     
ref|WP_002798627.1|  transketolase                                      711   0.0     
ref|WP_006619819.1|  transketolase                                      711   0.0     
ref|WP_015187816.1|  transketolase                                      711   0.0     
ref|WP_039725552.1|  transketolase                                      711   0.0     
ref|WP_017656050.1|  transketolase                                      710   0.0     
ref|WP_017286695.1|  transketolase                                      710   0.0     
ref|WP_015192175.1|  transketolase                                      710   0.0     
ref|WP_015229323.1|  transketolase                                      710   0.0     
ref|WP_024968611.1|  transketolase                                      710   0.0     
ref|WP_015202769.1|  transketolase                                      709   0.0     
ref|WP_026794557.1|  MULTISPECIES: transketolase                        709   0.0     
ref|WP_008057402.1|  transketolase                                      709   0.0     
ref|WP_017316342.1|  transketolase                                      709   0.0     
ref|WP_006621372.1|  transketolase                                      707   0.0     
ref|WP_006670091.1|  transketolase                                      707   0.0     
ref|WP_015221841.1|  transketolase                                      706   0.0     
ref|WP_026797090.1|  transketolase                                      706   0.0     
ref|WP_006515947.1|  transketolase                                      705   0.0     
ref|WP_037216432.1|  transketolase                                      705   0.0     
ref|WP_008232250.1|  Transketolase                                      705   0.0     
ref|WP_006454760.1|  transketolase                                      704   0.0     
ref|WP_009456507.1|  MULTISPECIES: transketolase                        704   0.0     
sp|Q42677.1|TKT7_CRAPL  RecName: Full=Transketolase 7; Short=TK         704   0.0     Craterostigma plantagineum
ref|WP_008314541.1|  transketolase                                      704   0.0     
gb|AAL09768.1|  At2g45290/F4L23.20                                      702   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|WP_019494448.1|  transketolase                                      704   0.0     
ref|WP_026721508.1|  transketolase                                      703   0.0     
gb|KHG02687.1|  Transketolase, chloroplastic                            702   0.0     
ref|WP_017662794.1|  transketolase                                      703   0.0     
ref|WP_012165705.1|  transketolase                                      703   0.0     
ref|WP_015153806.1|  transketolase                                      702   0.0     
ref|WP_010477310.1|  transketolase                                      701   0.0     
ref|WP_015180446.1|  transketolase                                      701   0.0     
ref|WP_015119641.1|  transketolase                                      701   0.0     
ref|WP_017311149.1|  transketolase                                      701   0.0     
dbj|BAP17071.1|  transketolase                                          700   0.0     
ref|WP_015956023.1|  transketolase                                      699   0.0     
ref|WP_006278283.1|  transketolase                                      699   0.0     
dbj|BAB62078.1|  transketolase                                          697   0.0     Persicaria tinctoria
gb|KDO85801.1|  hypothetical protein CISIN_1g004509mg                   701   0.0     
ref|WP_026734655.1|  transketolase                                      699   0.0     
ref|WP_039754505.1|  transketolase                                      699   0.0     
ref|WP_006528204.1|  transketolase                                      699   0.0     
ref|WP_010997495.1|  transketolase                                      698   0.0     
ref|WP_015141161.1|  transketolase                                      698   0.0     
ref|WP_035992986.1|  transketolase                                      697   0.0     
ref|WP_016863351.1|  transketolase                                      697   0.0     
ref|WP_009556088.1|  transketolase                                      697   0.0     
ref|WP_012264879.1|  transketolase                                      697   0.0     
ref|WP_009341460.1|  transketolase                                      698   0.0     
ref|WP_017719390.1|  transketolase                                      697   0.0     
ref|WP_013321191.1|  transketolase                                      697   0.0     
ref|WP_015149789.1|  transketolase                                      697   0.0     
ref|WP_009631538.1|  transketolase                                      697   0.0     
ref|XP_001701881.1|  transketolase                                      698   0.0     Chlamydomonas reinhardtii
dbj|GAL95388.1|  transketolase                                          696   0.0     
ref|WP_002784465.1|  Transketolase (TK)                                 696   0.0     
ref|WP_038091381.1|  transketolase                                      695   0.0     
ref|WP_015162462.1|  transketolase                                      695   0.0     
ref|WP_002748986.1|  transketolase                                      694   0.0     
ref|WP_007100994.1|  transketolase                                      694   0.0     
ref|WP_002768496.1|  transketolase                                      694   0.0     
ref|WP_039715842.1|  transketolase                                      694   0.0     
ref|WP_015224632.1|  transketolase                                      695   0.0     
ref|WP_002754495.1|  transketolase                                      694   0.0     
ref|WP_002775984.1|  transketolase                                      694   0.0     
ref|WP_015200504.1|  transketolase                                      694   0.0     
ref|WP_029635364.1|  transketolase [                                    694   0.0     
ref|WP_015113532.1|  transketolase                                      693   0.0     
ref|WP_008203199.1|  transketolase                                      693   0.0     
ref|WP_004159434.1|  transketolase                                      693   0.0     
ref|WP_002789441.1|  transketolase                                      693   0.0     
ref|WP_035156135.1|  transketolase                                      693   0.0     
ref|WP_023067697.1|  transketolase                                      692   0.0     
ref|WP_004162374.1|  transketolase                                      692   0.0     
ref|WP_009543323.1|  MULTISPECIES: transketolase                        692   0.0     
ref|WP_017739732.1|  transketolase                                      691   0.0     
ref|WP_002736729.1|  transketolase                                      691   0.0     
ref|WP_006632132.1|  transketolase                                      691   0.0     
ref|WP_016515556.1|  Transketolase                                      691   0.0     
ref|WP_015207308.1|  transketolase                                      691   0.0     
ref|WP_008184696.1|  transketolase                                      691   0.0     
ref|WP_007357567.1|  MULTISPECIES: transketolase                        691   0.0     
ref|WP_012410878.1|  transketolase                                      690   0.0     
ref|WP_017712725.1|  transketolase                                      689   0.0     
ref|WP_011320352.1|  transketolase                                      689   0.0     
ref|WP_009786437.1|  transketolase                                      689   0.0     
ref|WP_015179617.1|  transketolase                                      689   0.0     
ref|WP_011610305.1|  transketolase                                      688   0.0     
ref|WP_036005453.1|  transketolase                                      688   0.0     
emb|CAB58135.1|  putative transketolase precursor                       692   0.0     Cyanophora paradoxa
ref|XP_006397707.1|  hypothetical protein EUTSA_v10001334mg             689   0.0     
ref|WP_015218126.1|  transketolase                                      687   0.0     
ref|WP_007309476.1|  transketolase                                      687   0.0     
ref|WP_021836964.1|  Transketolase                                      686   0.0     
ref|WP_008277342.1|  transketolase                                      686   0.0     
ref|WP_015216155.1|  transketolase                                      686   0.0     
ref|WP_036485616.1|  transketolase                                      685   0.0     
ref|WP_015167957.1|  transketolase                                      684   0.0     
ref|WP_017305799.1|  transketolase                                      684   0.0     
ref|WP_015136254.1|  transketolase                                      684   0.0     
ref|WP_017297466.1|  transketolase                                      683   0.0     
ref|WP_015131246.1|  transketolase                                      682   0.0     
ref|WP_016952911.1|  transketolase                                      682   0.0     
ref|WP_011934548.1|  transketolase                                      682   0.0     
ref|WP_017319977.1|  transketolase                                      682   0.0     
gb|KFM23641.1|  Transketolase, chloroplastic                            684   0.0     
ref|YP_002049114.1|  transketolase                                      682   0.0     
ref|WP_013190823.1|  transketolase                                      681   0.0     
ref|WP_024124906.1|  transketolase Tkt                                  681   0.0     
ref|WP_025953847.1|  transketolase                                      680   0.0     
ref|WP_025952975.1|  transketolase                                      680   0.0     
ref|WP_025928934.1|  transketolase                                      680   0.0     
ref|WP_016878951.1|  transketolase                                      680   0.0     
ref|WP_036904458.1|  transketolase                                      679   0.0     
ref|WP_025961568.1|  transketolase                                      679   0.0     
ref|WP_027844043.1|  transketolase                                      679   0.0     
ref|XP_005643257.1|  transketolase 7                                    682   0.0     
ref|WP_011295531.1|  transketolase                                      679   0.0     
ref|WP_038654517.1|  transketolase                                      679   0.0     
ref|WP_009628433.1|  transketolase                                      679   0.0     
ref|WP_025969982.1|  transketolase                                      679   0.0     
ref|WP_006510883.1|  transketolase                                      679   0.0     
ref|WP_025947035.1|  transketolase                                      678   0.0     
ref|WP_025938757.1|  transketolase                                      678   0.0     
ref|WP_015081590.1|  transketolase                                      678   0.0     
ref|WP_025913911.1|  MULTISPECIES: transketolase                        678   0.0     
ref|WP_011824565.1|  transketolase                                      678   0.0     
ref|WP_006101618.1|  transketolase                                      678   0.0     
ref|WP_019504849.1|  transketolase                                      678   0.0     
ref|WP_025892028.1|  MULTISPECIES: transketolase                        677   0.0     
ref|WP_025882451.1|  MULTISPECIES: transketolase                        677   0.0     
ref|WP_025962675.1|  transketolase                                      677   0.0     
ref|WP_025941016.1|  transketolase                                      677   0.0     
ref|WP_012196286.1|  transketolase                                      677   0.0     
ref|WP_025927108.1|  transketolase                                      677   0.0     
ref|WP_025944921.1|  transketolase                                      677   0.0     
ref|WP_025952137.1|  transketolase                                      677   0.0     
ref|WP_011819222.1|  transketolase                                      677   0.0     
ref|WP_011863711.1|  transketolase                                      677   0.0     
ref|WP_036913798.1|  MULTISPECIES: transketolase                        676   0.0     
ref|WP_028083887.1|  transketolase                                      676   0.0     
ref|WP_006198159.1|  transketolase                                      676   0.0     
ref|WP_025970959.1|  transketolase                                      676   0.0     
ref|WP_032525121.1|  transketolase                                      676   0.0     
ref|WP_025954932.1|  transketolase                                      676   0.0     
ref|WP_015163532.1|  transketolase                                      676   0.0     
ref|WP_011057707.1|  transketolase                                      675   0.0     
ref|WP_019501710.1|  transketolase                                      675   0.0     
ref|WP_025915207.1|  transketolase                                      675   0.0     
ref|WP_028090445.1|  transketolase                                      675   0.0     
ref|WP_011377245.1|  transketolase                                      675   0.0     
ref|WP_002807303.1|  transketolase                                      675   0.0     
ref|WP_025956253.1|  transketolase                                      674   0.0     
ref|WP_032519998.1|  transketolase                                      674   0.0     
ref|WP_025923655.1|  transketolase                                      674   0.0     
ref|WP_032516119.1|  transketolase                                      674   0.0     
ref|WP_011431146.1|  transketolase                                      674   0.0     
ref|WP_030007223.1|  transketolase                                      674   0.0     
ref|WP_012306649.1|  transketolase                                      673   0.0     
ref|WP_025976026.1|  transketolase                                      673   0.0     
ref|WP_011363159.1|  transketolase                                      673   0.0     
ref|WP_006853861.1|  transketolase                                      673   0.0     
ref|WP_010871940.1|  transketolase                                      673   0.0     
ref|WP_006042518.1|  transketolase                                      672   0.0     
ref|WP_025931000.1|  transketolase                                      672   0.0     
ref|WP_032526338.1|  transketolase                                      672   0.0     
ref|WP_032521929.1|  transketolase                                      672   0.0     
ref|WP_009788397.1|  transketolase                                      671   0.0     
ref|WP_025934093.1|  transketolase                                      671   0.0     
ref|WP_032513587.1|  transketolase                                      671   0.0     
ref|WP_025937698.1|  transketolase                                      671   0.0     
ref|WP_025895094.1|  transketolase                                      671   0.0     
ref|WP_018396797.1|  transketolase                                      671   0.0     
ref|WP_012008493.1|  transketolase                                      670   0.0     
ref|WP_025972630.1|  transketolase                                      670   0.0     
ref|WP_035833478.1|  transketolase                                      670   0.0     
ref|WP_025936106.1|  transketolase                                      669   0.0     
ref|WP_025922679.1|  MULTISPECIES: transketolase                        669   0.0     
ref|WP_027402748.1|  transketolase                                      669   0.0     
ref|WP_015109740.1|  transketolase                                      669   0.0     
ref|WP_032517943.1|  transketolase                                      669   0.0     
ref|WP_036900784.1|  transketolase                                      669   0.0     
ref|WP_039199555.1|  transketolase                                      669   0.0     
ref|WP_011821090.1|  transketolase                                      668   0.0     
ref|WP_012954084.1|  transketolase                                      668   0.0     
ref|WP_024546054.1|  transketolase                                      668   0.0     
ref|WP_025923926.1|  transketolase                                      668   0.0     
ref|WP_011125919.1|  MULTISPECIES: transketolase                        667   0.0     
ref|WP_038542699.1|  transketolase                                      667   0.0     
ref|WP_011432749.1|  transketolase                                      667   0.0     
ref|WP_036899774.1|  transketolase                                      667   0.0     
gb|KGF85673.1|  Transketolase                                           666   0.0     
ref|WP_011131322.1|  transketolase                                      667   0.0     
gb|KFF41040.1|  transketolase                                           667   0.0     
ref|WP_011359007.1|  transketolase                                      666   0.0     
ref|WP_007099570.1|  transketolase                                      665   0.0     
gb|KGG02249.1|  Transketolase                                           665   0.0     
ref|WP_036922520.1|  transketolase                                      665   0.0     
ref|WP_006172467.1|  transketolase                                      665   0.0     
ref|WP_019479812.1|  transketolase                                      665   0.0     
ref|WP_011618116.1|  transketolase                                      665   0.0     
ref|WP_019477705.1|  transketolase                                      664   0.0     
ref|WP_011133237.1|  transketolase                                      664   0.0     
ref|WP_012594198.1|  MULTISPECIES: transketolase                        664   0.0     
ref|WP_038551702.1|  transketolase                                      663   0.0     
ref|WP_036919474.1|  MULTISPECIES: transketolase                        663   0.0     
ref|WP_029553180.1|  transketolase                                      663   0.0     
gb|AIE75019.1|  Transketolase                                           663   0.0     
gb|AIQ95975.1|  Transketolase                                           662   0.0     
gb|AHF62567.1|  transketolase                                           662   0.0     
ref|WP_019474366.1|  transketolase                                      662   0.0     
ref|WP_011127018.1|  transketolase                                      662   0.0     
gb|KGF92099.1|  Transketolase                                           661   0.0     
ref|WP_011827182.1|  transketolase                                      662   0.0     
ref|WP_011932127.1|  transketolase                                      661   0.0     
ref|WP_010314092.1|  transketolase                                      661   0.0     
gb|EAZ35729.1|  hypothetical protein OsJ_20020                          657   0.0     
ref|XP_001418785.1|  predicted protein                                  660   0.0     
gb|KGG13639.1|  Transketolase                                           659   0.0     
gb|KGG10691.1|  Transketolase                                           657   0.0     
ref|WP_006909034.1|  transketolase                                      657   0.0     
gb|KGF86858.1|  Transketolase                                           653   0.0     
gb|KGG14616.1|  Transketolase                                           654   0.0     
emb|CEF98870.1|  Transketolase-like, C-terminal                         655   0.0     
gb|AII46702.1|  transketolase                                           654   0.0     
ref|WP_028953384.1|  transketolase                                      653   0.0     
ref|WP_017325228.1|  transketolase                                      640   0.0     
ref|XP_002503179.1|  transketolase chloroplast precursor                641   0.0     
ref|XP_003605141.1|  Transketolase                                      635   0.0     
dbj|BAH19845.1|  AT3G60750                                              634   0.0     
ref|NP_001145984.1|  hypothetical protein                               635   0.0     
ref|XP_005847082.1|  hypothetical protein CHLNCDRAFT_48880              632   0.0     
emb|CDM65715.1|  transketolase                                          630   0.0     
ref|XP_004996939.1|  transketolase                                      628   0.0     
ref|XP_003061196.1|  predicted protein                                  629   0.0     
ref|XP_007508375.1|  transketolase                                      629   0.0     
ref|WP_023171246.1|  transketolase                                      620   0.0     
ref|XP_002437765.1|  hypothetical protein SORBIDRAFT_10g002250          617   0.0     
ref|WP_029521790.1|  transketolase                                      619   0.0     
ref|WP_011142294.1|  transketolase                                      618   0.0     
ref|WP_017872438.1|  hypothetical protein                               618   0.0     
dbj|GAK61248.1|  transketolase, TK                                      617   0.0     
ref|WP_025962042.1|  transketolase                                      614   0.0     
ref|WP_027080069.1|  transketolase                                      617   0.0     
ref|WP_020722258.1|  hypothetical protein                               617   0.0     
ref|WP_018132041.1|  hypothetical protein                               614   0.0     
ref|WP_025748481.1|  transketolase                                      613   0.0     
dbj|BAG09543.1|  transketolase                                          615   0.0     
ref|WP_029519922.1|  transketolase                                      612   0.0     
ref|XP_001744412.1|  hypothetical protein                               613   0.0     
dbj|GAK53954.1|  transketolase                                          612   0.0     
ref|WP_022823303.1|  transketolase                                      612   0.0     
ref|WP_026140606.1|  transketolase                                      612   0.0     
gb|KDO46241.1|  hypothetical protein CISIN_1g0068162mg                  600   0.0     
ref|WP_034773001.1|  transketolase                                      611   0.0     
gb|AHJ98269.1|  transketolase                                           612   0.0     
ref|WP_026907544.1|  transketolase                                      608   0.0     
ref|WP_019121209.1|  hypothetical protein                               608   0.0     
ref|WP_025322690.1|  transketolase                                      607   0.0     
ref|WP_027358694.1|  transketolase                                      606   0.0     
ref|WP_008214373.1|  transketolase                                      606   0.0     
ref|WP_028320191.1|  transketolase                                      604   0.0     
gb|AIZ65344.1|  transketolase                                           603   0.0     
ref|XP_005707295.1|  transketolase                                      607   0.0     
ref|WP_027408806.1|  transketolase                                      602   0.0     
ref|XP_005710126.1|  transketolase                                      602   0.0     
ref|WP_027109166.1|  transketolase                                      600   0.0     
ref|WP_018623214.1|  transketolase                                      601   0.0     
gb|AAW65685.1|  transketolase                                           606   0.0     
gb|ABQ23342.1|  plastid transketolase                                   606   0.0     
ref|WP_009709714.1|  transketolase                                      601   0.0     
ref|WP_027725414.1|  transketolase                                      600   0.0     
ref|WP_015863566.1|  transketolase                                      599   0.0     
ref|WP_004096381.1|  transketolase                                      599   0.0     
ref|WP_035445661.1|  transketolase                                      598   0.0     
ref|WP_031460942.1|  transketolase                                      598   0.0     
ref|WP_031428181.1|  transketolase                                      597   0.0     
ref|WP_010093267.1|  transketolase                                      597   0.0     
ref|WP_026578821.1|  transketolase                                      597   0.0     
ref|WP_015745186.1|  transketolase                                      596   0.0     
ref|XP_005537534.1|  transketolase                                      599   0.0     
ref|WP_006561605.1|  transketolase                                      596   0.0     
ref|WP_020601538.1|  transketolase                                      597   0.0     
ref|WP_034767737.1|  transketolase                                      596   0.0     
ref|WP_006838244.1|  transketolase                                      595   0.0     
ref|WP_019152673.1|  transketolase                                      595   0.0     
ref|WP_011024690.1|  transketolase                                      595   0.0     
ref|WP_015719570.1|  transketolase                                      596   0.0     
emb|CDH54115.1|  transketolase                                          595   0.0     
ref|WP_028315296.1|  transketolase                                      595   0.0     
ref|WP_022072405.1|  transketolase                                      594   0.0     
ref|WP_013179027.1|  transketolase                                      594   0.0     
ref|WP_008297074.1|  Transketolase                                      594   0.0     
ref|WP_034759907.1|  transketolase                                      594   0.0     
ref|WP_028458018.1|  transketolase                                      594   0.0     
ref|WP_024038165.1|  hypothetical protein                               593   0.0     
ref|WP_015947514.1|  transketolase                                      594   0.0     
ref|WP_015838157.1|  transketolase                                      595   0.0     
ref|WP_036193706.1|  transketolase                                      593   0.0     
ref|WP_013401191.1|  transketolase                                      593   0.0     
ref|WP_023614720.1|  transketolase                                      593   0.0     
ref|WP_007287170.1|  transketolase                                      593   0.0     
dbj|GAF63521.1|  transketolase                                          593   0.0     
ref|WP_039742034.1|  transketolase                                      593   0.0     
ref|WP_031313990.1|  transketolase                                      592   0.0     
ref|WP_039343626.1|  transketolase                                      592   0.0     
ref|WP_026574991.1|  transketolase                                      592   0.0     
ref|WP_035050589.1|  transketolase                                      591   0.0     
ref|WP_005035206.1|  transketolase                                      591   0.0     
ref|WP_032099541.1|  transketolase                                      591   0.0     
ref|WP_003349240.1|  transketolase                                      591   0.0     
gb|ERM92672.1|  transketolase                                           592   0.0     
ref|WP_028394449.1|  transketolase                                      591   0.0     
gb|ESA00983.1|  hypothetical protein GLOINDRAFT_338208                  591   0.0     
ref|WP_036833343.1|  transketolase                                      590   0.0     
ref|WP_003251508.1|  transketolase                                      591   0.0     
ref|WP_029524219.1|  transketolase                                      591   0.0     
ref|WP_003352955.1|  transketolase                                      590   0.0     
ref|WP_035050719.1|  transketolase                                      590   0.0     
ref|WP_022543748.1|  transketolase                                      590   0.0     
emb|CDS13223.1|  hypothetical protein LRAMOSA05401                      590   0.0     
ref|WP_032088696.1|  transketolase                                      590   0.0     
ref|WP_007721081.1|  transketolase                                      590   0.0     
ref|WP_007081456.1|  transketolase                                      590   0.0     
emb|CEI82598.1|  Transketolase                                          589   0.0     
ref|WP_026559104.1|  transketolase                                      589   0.0     



>ref|XP_009591814.1| PREDICTED: transketolase, chloroplastic-like [Nicotiana tomentosiformis]
Length=763

 Score =  1196 bits (3095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/756 (78%), Positives = 664/756 (88%), Gaps = 12/756 (2%)
 Frame = -3

Query  2401  LLLRPNPPLLEAKPLFPQN------NKRLIALRLVQCRSNPK---SKSPVLKNTVVSKDE  2249
             LL +  PPL E K     N      + +L      QC++  K   S +P  K   + KD+
Sbjct  6     LLFKSFPPLHEPKLTIQTNRSYDYHSNKLSLWCNFQCKNRLKTDNSTTPRSKQPSLFKDQ  65

Query  2248  DYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGG  2069
             DY++SW EELKRAYP +  S H+  ED++  QE+V++RCV+NVRMLIVD VQHAKAGHGG
Sbjct  66    DYKVSWQEELKRAYPFEISSTHK-REDEEYLQELVEKRCVENVRMLIVDSVQHAKAGHGG  124

Query  2068  MALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDL  1889
             MALG+AEV YFLY + MR+N + PKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQI+DL
Sbjct  125   MALGMAEVAYFLYGNAMRYNSRNPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIEDL  184

Query  1888  KRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDH  1709
             KRLCKLGSRTPGHPEN +TEGIEVTTGPLGQGVANAVGLALAE HLA+RFNKPD+ IVDH
Sbjct  185   KRLCKLGSRTPGHPENGVTEGIEVTTGPLGQGVANAVGLALAEAHLAARFNKPDVAIVDH  244

Query  1708  RTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEA  1529
             RTYCIMGDGCSMEG++NEAASLAAHWKL+KLTL+YDDNHNTIDG+TDLT+SEDISARFEA
Sbjct  245   RTYCIMGDGCSMEGISNEAASLAAHWKLHKLTLIYDDNHNTIDGSTDLTLSEDISARFEA  304

Query  1528  LGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEE  1349
             LGWNTITVDNTQG+++A KNAL SA++ET+KPTFIRVKT IGKLSKKEGTSKAHHGTF+E
Sbjct  305   LGWNTITVDNTQGNIQAFKNALISAYSETKKPTFIRVKTRIGKLSKKEGTSKAHHGTFDE  364

Query  1348  DDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQ  1169
             DDVKQMKQK++WD+ R PF+VIPM+YREM+ Q + G  LE+EWHSKL+ YQ+KYP+EA +
Sbjct  365   DDVKQMKQKVKWDD-REPFYVIPMVYREMQAQTDLGGRLEEEWHSKLHYYQSKYPEEAAE  423

Query  1168  FIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQA  989
             F  LL  G++PGWE+SLP+W MSDPV+ TRGYSGKCLN LAKV+PGLIGGSADL SSNQA
Sbjct  424   FKLLLADGLLPGWESSLPKWSMSDPVDVTRGYSGKCLNALAKVLPGLIGGSADLASSNQA  483

Query  988   YLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSI  809
             YLH  GDF+QPDSP GRNIRYGVREHAMAGISNG+ALHGGGLIPFAATFLVFSDYMKNSI
Sbjct  484   YLHNLGDFKQPDSPWGRNIRYGVREHAMAGISNGLALHGGGLIPFAATFLVFSDYMKNSI  543

Query  808   RLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKV  629
             RLSALS AGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRA+P LL+FRP+DGNETAGAYKV
Sbjct  544   RLSALSRAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAVPHLLLFRPADGNETAGAYKV  603

Query  628   AIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLC  449
             A+ANRD PSL+ALSRQKVAA+++GTSAD V KGGYI+SDNS  ELPEIILIGTG ELCLC
Sbjct  604   AVANRDVPSLIALSRQKVAAHVEGTSADAVEKGGYIVSDNS-VELPEIILIGTGSELCLC  662

Query  448   EESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVG  269
             E SA VLR EGRRVRVVSLVCWRLF+RQPR+YKE+VLPS V KRVSVEAGSPLGW+EYVG
Sbjct  663   EASANVLRKEGRRVRVVSLVCWRLFDRQPRDYKELVLPSNVSKRVSVEAGSPLGWKEYVG  722

Query  268   DEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             DEG VIG+D+FGASGP + VFKKYGFTEENV+KTA+
Sbjct  723   DEGFVIGVDDFGASGPYSEVFKKYGFTEENVTKTAK  758



>ref|XP_009786436.1| PREDICTED: transketolase, chloroplastic-like [Nicotiana sylvestris]
Length=757

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/761 (77%), Positives = 658/761 (86%), Gaps = 28/761 (4%)
 Frame = -3

Query  2401  LLLRPNPPLLEAKPLFPQN------NKRLIALRLVQCR--------SNPKSKSPVLKNTV  2264
             LL +P P L E K     N      + +L      +C+        + P+SK P L    
Sbjct  6     LLFKPFPTLNEPKLTIQTNRSYSYHSNKLALWCNFRCKNSIRTDNNTTPRSKQPSL----  61

Query  2263  VSKDEDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAK  2084
               KD+DY++SW EELKRAYP +         D++  QE+VD+RCV+NVRMLIVD VQHAK
Sbjct  62    -FKDQDYKVSWQEELKRAYPFEI-------SDEEYLQELVDKRCVENVRMLIVDSVQHAK  113

Query  2083  AGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSV  1904
             AGHGGMALG+AE+ YFLYRH MR+N + PKWFNRDRFVLSAGHGSLL YVCLHLAGFQSV
Sbjct  114   AGHGGMALGMAEIAYFLYRHAMRYNSRNPKWFNRDRFVLSAGHGSLLHYVCLHLAGFQSV  173

Query  1903  QIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDI  1724
             QI+DLKRLCKLGSRTPGHPEN +TEGIEVTTGPLGQGVANAVGLALAE HLA+RFNKPDI
Sbjct  174   QIEDLKRLCKLGSRTPGHPENGVTEGIEVTTGPLGQGVANAVGLALAEAHLAARFNKPDI  233

Query  1723  PIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDIS  1544
              IVDHRTYCIMGDGCSMEG++NEAASLAAHWKL+KLTL+YD NHNTIDG+TDL VSEDIS
Sbjct  234   AIVDHRTYCIMGDGCSMEGISNEAASLAAHWKLHKLTLIYDFNHNTIDGSTDLAVSEDIS  293

Query  1543  ARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHH  1364
             ARFEALGWNTI VDNTQG+++A K+AL SAH+ET+KPTFIRVKT IGKLSKKEGTSKAHH
Sbjct  294   ARFEALGWNTIIVDNTQGNIQAFKSALISAHSETEKPTFIRVKTRIGKLSKKEGTSKAHH  353

Query  1363  GTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYP  1184
             GTF+EDDVKQMKQK++WD+ R PFHVIPM+YREM+ Q + G  LEQEW+SKLY YQ+KYP
Sbjct  354   GTFDEDDVKQMKQKVKWDD-REPFHVIPMVYREMQAQTDLGGRLEQEWNSKLYYYQSKYP  412

Query  1183  QEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLV  1004
             +EA +F  LL  G++PGWE+SLP+W MSDPV+ATRGYSGKCLN LAKV+PGLIGGSADL 
Sbjct  413   EEAAEFELLLADGMLPGWESSLPKWSMSDPVDATRGYSGKCLNVLAKVLPGLIGGSADLA  472

Query  1003  SSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDY  824
             SSNQAYLH  GDF+QPDSP GRNIRYGVREHAMAGISNG+ALHGGGLIPFAATFLVFSDY
Sbjct  473   SSNQAYLHNLGDFKQPDSPWGRNIRYGVREHAMAGISNGLALHGGGLIPFAATFLVFSDY  532

Query  823   MKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETA  644
             MKNSIRLSALS AGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRA+P LL+FRP+DGNETA
Sbjct  533   MKNSIRLSALSRAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAVPHLLLFRPADGNETA  592

Query  643   GAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGW  464
             GAYKVA+ NRD PSL+ALSRQKVA N++GTS D V KGGYIISDNS EELPEIILIGTG 
Sbjct  593   GAYKVAVENRDVPSLIALSRQKVATNVEGTSTDAVEKGGYIISDNS-EELPEIILIGTGS  651

Query  463   ELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGW  284
             ELCLCE SA VLRNEGRRVRVVSLVCWRLF+RQPR+YKE+VLPS V KRVSVEAGSPLGW
Sbjct  652   ELCLCEASANVLRNEGRRVRVVSLVCWRLFDRQPRDYKELVLPSNVSKRVSVEAGSPLGW  711

Query  283   REYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +EYVGDEGVVIG+D+FGASGP + VFKKYGFTEENV++TA+
Sbjct  712   KEYVGDEGVVIGIDDFGASGPYSEVFKKYGFTEENVTQTAK  752



>ref|XP_004228780.1| PREDICTED: transketolase, chloroplastic-like [Solanum lycopersicum]
Length=787

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/754 (74%), Positives = 652/754 (86%), Gaps = 10/754 (1%)
 Frame = -3

Query  2401  LLLRPNPPLLEAKP---LFPQNNKRLIALRLVQC--RSNPKSKSPVLKNTVVS--KDEDY  2243
              +++P PPL   +     +  + K+L     + C   +N  + SP+   +  S  KD+DY
Sbjct  6     FIVKPFPPLFHIQTNNYRYDYHTKKLALKSNIVCLKTNNISTTSPLFDQSRPSLFKDKDY  65

Query  2242  RLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMA  2063
             +LSW EE+KRAYP +   +++   DD+K QE+VD+RC+DN RMLIVD VQHAKAGH GMA
Sbjct  66    KLSWQEEVKRAYPLEI--SNQNLNDDEKLQELVDKRCIDNFRMLIVDSVQHAKAGHAGMA  123

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             LG+AEV YFLYRH MR++  +PKWFNRDRFVLSAGHG LLQYVCLHLA F+SVQI+DLK 
Sbjct  124   LGMAEVAYFLYRHAMRYSLTSPKWFNRDRFVLSAGHGCLLQYVCLHLASFRSVQIEDLKC  183

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
             LCKLGSRTPGHPENV+ +GIEVTTGPLGQGVANAVGLALAE +L +R+NKPD+ +VDHRT
Sbjct  184   LCKLGSRTPGHPENVVAQGIEVTTGPLGQGVANAVGLALAEANLNARYNKPDVAVVDHRT  243

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             YCIMGDGCSMEG++NEAASLAAHWKL+KLTL+YDDNHNTIDG+TDL +SED SARFEALG
Sbjct  244   YCIMGDGCSMEGISNEAASLAAHWKLHKLTLIYDDNHNTIDGSTDLALSEDTSARFEALG  303

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEEDD  1343
             WNTIT+DN+QG+++A KNAL SAH ET+KPTFIRVKT IGKLSKKEGTSKAHHGTF++DD
Sbjct  304   WNTITIDNSQGNLDAFKNALISAHCETRKPTFIRVKTIIGKLSKKEGTSKAHHGTFDDDD  363

Query  1342  VKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFI  1163
             VKQMKQK++W++ R PFHVIPM+YREM+ Q   G  LEQEWHSKL  YQNKYP+EA +F 
Sbjct  364   VKQMKQKVKWED-REPFHVIPMVYREMQAQTNLGGRLEQEWHSKLNYYQNKYPEEAAEFK  422

Query  1162  ALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYL  983
              LL  G++PGWE+SLP+  MSDPV++TRGYSGKCLN LAKV+PGLIGGSADL SSNQAYL
Sbjct  423   LLLPDGMIPGWESSLPKCSMSDPVDSTRGYSGKCLNALAKVLPGLIGGSADLASSNQAYL  482

Query  982   HGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRL  803
             H  GDF+QPDSP G+NIRYGVREHAM GISNG+ALHGGGLIPFAATFLVFSDYMKNS+RL
Sbjct  483   HNLGDFKQPDSPWGQNIRYGVREHAMGGISNGLALHGGGLIPFAATFLVFSDYMKNSVRL  542

Query  802   SALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAI  623
             SALSHAGVIYI+THDS+G+GEDGPTHQP+EHLAGLRAIP LL+FRP+DG ETAGAYKVAI
Sbjct  543   SALSHAGVIYILTHDSVGIGEDGPTHQPIEHLAGLRAIPHLLLFRPADGKETAGAYKVAI  602

Query  622   ANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEE  443
              NR  PSL+ALSRQKVAAN++GT AD VGKGGYI+SDNS +ELPEIILIGTG ELCLCE 
Sbjct  603   ENRSVPSLVALSRQKVAANVEGTLADAVGKGGYIVSDNSEKELPEIILIGTGSELCLCEA  662

Query  442   SAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDE  263
             SA VLR EG RVRVVSLVCWRLF+RQPR+YKE VLPS+V KRVSVEAGSPLGW+EYVGDE
Sbjct  663   SANVLRKEGTRVRVVSLVCWRLFDRQPRDYKECVLPSSVSKRVSVEAGSPLGWKEYVGDE  722

Query  262   GVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             G+V+G+D+FG+SGP + VF KYGFTEENV+KTA+
Sbjct  723   GIVMGIDDFGSSGPYSEVFNKYGFTEENVTKTAK  756



>emb|CDO99755.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/762 (74%), Positives = 657/762 (86%), Gaps = 15/762 (2%)
 Frame = -3

Query  2419  MAVYTVLLLRPNPPLLEAKPLFPQNNKRL-----IALRLVQCRSNPKSK----SPVLKNT  2267
             MA+ + LLLRP PP+L  KP   +N+ R      + LR + C+++ + +    SP +  T
Sbjct  1     MAI-SSLLLRPCPPILPTKPT-AENSHRCYTSNRLGLRCLTCKNSLRKETAETSPPIGAT  58

Query  2266  VVSKDEDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHA  2087
             + S D +Y+ SWLEELKRA P +  S+ +WE DD+KF+E+VD+R VDNVRMLI+D V HA
Sbjct  59    LFS-DSEYKHSWLEELKRACPPE-ISSQQWENDDEKFRELVDKRGVDNVRMLILDSVNHA  116

Query  2086  KAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQS  1907
             KAGH GMALG+AEVGYFLYRH MR+NP+ PKWFNRDRFVLSAGHG LLQYVCLHLAGFQS
Sbjct  117   KAGHPGMALGMAEVGYFLYRHAMRYNPRNPKWFNRDRFVLSAGHGCLLQYVCLHLAGFQS  176

Query  1906  VQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPD  1727
             VQI+DLKRL KLGSRTPGHPEN IT+GIEVTTGPLGQGV NAVGLALAE HLA+RFNKPD
Sbjct  177   VQIEDLKRLTKLGSRTPGHPENTITDGIEVTTGPLGQGVPNAVGLALAEAHLAARFNKPD  236

Query  1726  IPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDI  1547
             + IVDHRTYCIMGDGC+MEG+++EAASLAAHWKLNKLTL+YDDNHNTIDG+TDL  SED 
Sbjct  237   VAIVDHRTYCIMGDGCAMEGISHEAASLAAHWKLNKLTLIYDDNHNTIDGSTDLAFSEDT  296

Query  1546  SARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAH  1367
             SARF+ALGW TITVD   G+++  +NAL SA+ ET+KPTFIRVKT IGKLSKKEGTSK H
Sbjct  297   SARFQALGWKTITVDLRNGELKLFENALLSAYGETEKPTFIRVKTTIGKLSKKEGTSKTH  356

Query  1366  HGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKY  1187
             HGTF+EDDVKQMKQK++W+N + PFHVIPM+YREM++QA+QGE LE  W SKL+ YQ  Y
Sbjct  357   HGTFDEDDVKQMKQKVKWENHQ-PFHVIPMIYREMQIQADQGEKLEAMWTSKLHYYQTAY  415

Query  1186  PQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADL  1007
             P+EA +F ALL+GG+VPGWE+SLP+W ++DPV+ATRGYS KCLN LAKV+PGLIGGSADL
Sbjct  416   PEEAAEFNALLHGGLVPGWESSLPQWSITDPVDATRGYSEKCLNQLAKVLPGLIGGSADL  475

Query  1006  VSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSD  827
              SSN+AYLH  GDF++ +  +GRNIRYGVREHAM GISNGIALHGGGLIPFAATFL+FSD
Sbjct  476   ASSNKAYLHDCGDFQRQNY-KGRNIRYGVREHAMGGISNGIALHGGGLIPFAATFLIFSD  534

Query  826   YMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNET  647
             YMKNSIRLSALSHA V YIMTHDSIGLGEDGPTHQPVE LAGLRAIPRLLVFRP+DGNET
Sbjct  535   YMKNSIRLSALSHAAVTYIMTHDSIGLGEDGPTHQPVEQLAGLRAIPRLLVFRPADGNET  594

Query  646   AGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTG  467
             AGAYKVA+ANRD PS++ALSRQK+AAN++GTS+D V +GGYI+SDN GEELPEIILI TG
Sbjct  595   AGAYKVAVANRDVPSVIALSRQKLAANVEGTSSDAVERGGYIVSDNCGEELPEIILISTG  654

Query  466   WELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLG  287
              ELCLCE SA +LR EGRRVRVVSLVCWRLF+RQP+EYKE VLPS V KR+SVEAGSPLG
Sbjct  655   SELCLCEASANLLRKEGRRVRVVSLVCWRLFDRQPQEYKEDVLPSGVSKRLSVEAGSPLG  714

Query  286   WREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             WREYVG++G V+G++EFGASG     FKKYGFTEENV++ A+
Sbjct  715   WREYVGEKGSVLGVEEFGASGAYLDAFKKYGFTEENVTRIAK  756



>ref|XP_011077266.1| PREDICTED: transketolase, chloroplastic-like [Sesamum indicum]
Length=749

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/720 (75%), Positives = 633/720 (88%), Gaps = 11/720 (2%)
 Frame = -3

Query  2311  CRSN-PKSKS--PVLKNTVVSKDEDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVD  2141
             CR++ PK+ +  P+LK      D +++LSW +EL+ AYP+++ SA E++  D+KFQE+VD
Sbjct  33    CRNSLPKTTTTNPLLK------DPNHKLSWKDELQNAYPNES-SALEFDVSDEKFQELVD  85

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
             RRC DN+RMLI+D VQ AKAGH GMALG+AE+G FLYRHV+++NP+ P+WFNRDRFVLSA
Sbjct  86    RRCADNLRMLILDSVQKAKAGHPGMALGMAEIGVFLYRHVLKYNPRNPRWFNRDRFVLSA  145

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG LLQYVCLHLAGFQSVQI+DLKRLCKLGSRTPGHPEN +T+GIEVTTGPLGQGVANA
Sbjct  146   GHGCLLQYVCLHLAGFQSVQIEDLKRLCKLGSRTPGHPENTVTDGIEVTTGPLGQGVANA  205

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD+ +VDHRTYCIMGDGC+MEG+++EAASLAAHWKLNKLTL+YD
Sbjct  206   VGLALAEAHLAARFNKPDVSVVDHRTYCIMGDGCAMEGISHEAASLAAHWKLNKLTLIYD  265

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DN NTIDG+TDL  +EDIS +F+ALGWNTITVD+   +M + K+A+ +A+ ET++PTFIR
Sbjct  266   DNRNTIDGSTDLAFTEDISLQFKALGWNTITVDDNHSNMRSFKSAVLAAYRETERPTFIR  325

Query  1420  VKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
             VKT IGKLSKKEGTSKAHHG F+EDD KQMKQK++WDN R PF+VIPM+YREM++QA+ G
Sbjct  326   VKTRIGKLSKKEGTSKAHHGIFDEDDEKQMKQKVKWDN-REPFYVIPMVYREMQVQADHG  384

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
             E LE++W SKLY YQ+KYPQEA +F +LL  G++PGWE SLP W  SDP++ATRGYS KC
Sbjct  385   EELERDWCSKLYYYQSKYPQEAVEFKSLLYNGMLPGWENSLPTWSTSDPLDATRGYSEKC  444

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGLIGGSADL SSN+ YLH YGDF+QP SP GRNIRYGVREHAMAGISNGIA
Sbjct  445   LNQLAKVLPGLIGGSADLASSNKVYLHDYGDFQQPASPGGRNIRYGVREHAMAGISNGIA  504

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHL G
Sbjct  505   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLVG  564

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
             LRAIPRLL+FRP+DGNET+G YKVA+ANR  PS++ALSRQKV A+++GTSAD V +GGYI
Sbjct  565   LRAIPRLLLFRPADGNETSGVYKVAVANRTVPSVIALSRQKVLAHVEGTSADAVARGGYI  624

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNSG  LPEIILIGTG ELCLCE SA VLR EGRRVRVVSLVCWRLF++QP EYKE V
Sbjct  625   VSDNSGPNLPEIILIGTGSELCLCEGSASVLRKEGRRVRVVSLVCWRLFDQQPAEYKEEV  684

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V +RVSVEAGSP+GWREYVG EGVV+G++EFGASG     FKKYGFTEENV++ A+
Sbjct  685   LPPGVPRRVSVEAGSPIGWREYVGPEGVVLGVEEFGASGAHLDTFKKYGFTEENVTRVAK  744



>ref|XP_011041028.1| PREDICTED: transketolase, chloroplastic-like [Populus euphratica]
Length=764

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/759 (69%), Positives = 623/759 (82%), Gaps = 18/759 (2%)
 Frame = -3

Query  2401  LLLRPNPPLLEAKPLFPQNNKRLIALRLVQCRSNPKSKSPVLKNTVVSKDEDYRLSWLEE  2222
             LL +P   LL +KP     N ++       C S    +S V K   +SK   ++LSW +E
Sbjct  6     LLSKPFISLLSSKPSPDNKNNKISPTSFTLCSSLKTKQSRVTKPATLSKT--HKLSWQQE  63

Query  2221  LKRAYPSQACSAHEWEEDD------------DKFQEMVDRRCVDNVRMLIVDCVQHAKAG  2078
             LK+A+  Q   +   + ++            + FQ++VD+RCVDNV+MLIVD VQ+A+AG
Sbjct  64    LKQAF--QQPKSQNLQTNNDSIDCNIDDIDDESFQKLVDKRCVDNVKMLIVDAVQNAQAG  121

Query  2077  HGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQI  1898
             H GMALG+A+ GY+LYRHVMR+NP+ P+WFNRDRFVLSAGHG LLQYVCLHLAGF+SVQ+
Sbjct  122   HPGMALGMADTGYYLYRHVMRYNPRDPQWFNRDRFVLSAGHGCLLQYVCLHLAGFESVQL  181

Query  1897  DDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPI  1718
             +DL RLCKLGSRTPGHPEN +T+GIEVTTGPLGQGVANAVGLALAE HLA+RFNKPD  I
Sbjct  182   EDLTRLCKLGSRTPGHPENTVTDGIEVTTGPLGQGVANAVGLALAEAHLAARFNKPDCDI  241

Query  1717  VDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISAR  1538
             VDHRTYCIMGDGC+MEG+T+EAASLAAHWKL+KLT++YDDNHNTIDG   L  SEDISAR
Sbjct  242   VDHRTYCIMGDGCAMEGITHEAASLAAHWKLHKLTMIYDDNHNTIDGPISLAFSEDISAR  301

Query  1537  FEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT  1358
             F+ALGWN ITVD+T  DM++  +AL SA  +T+KPTFIRVKT IG+LS+KEGTSKAHHG 
Sbjct  302   FKALGWNAITVDDTHDDMDSFNDALLSAFGDTEKPTFIRVKTLIGRLSRKEGTSKAHHGN  361

Query  1357  FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQE  1178
             FEEDDVKQM+QK++WD+ R PFHVIPM+YREM++Q + GE LE+EW SK   ++  YP+E
Sbjct  362   FEEDDVKQMRQKVKWDS-REPFHVIPMVYREMQIQTDHGEKLEKEWFSKFDYFKTNYPEE  420

Query  1177  AKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSS  998
             A +F  LL+GG+ P WE+ LP W ++DPV+ATRGYS KCLN L KV+PGLIGGSADL SS
Sbjct  421   AAEFEVLLSGGLPPNWESCLPEWSVTDPVDATRGYSEKCLNQLVKVLPGLIGGSADLASS  480

Query  997   NQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMK  818
             N+ YL G  DF Q  S  GRNIRYGVREHAMAGISNGIALH  GLIPFAATFL+FSDYMK
Sbjct  481   NKVYLQGSQDF-QHSSFYGRNIRYGVREHAMAGISNGIALHKSGLIPFAATFLIFSDYMK  539

Query  817   NSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGA  638
             NSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP+E LAGLRA+PRLLVFRP+DGNETAGA
Sbjct  540   NSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPIEQLAGLRAVPRLLVFRPADGNETAGA  599

Query  637   YKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWEL  458
             Y+ AI NRD PS++ALSRQKVAAN++GTSA+ V KGGYI+SDNSG+ LP+IILI TG EL
Sbjct  600   YREAITNRDAPSVIALSRQKVAANLEGTSANEVEKGGYILSDNSGKSLPDIILISTGSEL  659

Query  457   CLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWRE  278
             CLCEESA +LR EGR+VRVVSLVCW+LF RQP+EYKE VLPS+V KR+SVEAGS +GW E
Sbjct  660   CLCEESAKILRKEGRKVRVVSLVCWQLFNRQPKEYKEHVLPSSVSKRISVEAGSSMGWSE  719

Query  277   YVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             YVG EG+V+G++EFGASG     FKK+GFTEENV++ A+
Sbjct  720   YVGREGIVMGVEEFGASGAYLDTFKKFGFTEENVTRVAK  758



>gb|EYU39617.1| hypothetical protein MIMGU_mgv1a001870mg [Erythranthe guttata]
Length=747

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/748 (73%), Positives = 624/748 (83%), Gaps = 15/748 (2%)
 Frame = -3

Query  2401  LLLRPNPPLLEAKPLFPQNNKRLIALRLVQCRSNPKSKSPVLKNTVVSKDEDYRLSWLEE  2222
             LLL PN      +P++     +L + +   C+S+       L N    +D++Y+LSW+ E
Sbjct  9     LLLHPNSGH-HKRPIYKIT--KLPSRKPFSCKSS-------LLNPTKIQDQNYKLSWINE  58

Query  2221  LKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVG  2042
             ++ AYPS A      E  D++FQE+VDRRCVDNVRMLIVD VQ AKAGH GMALG+A+V 
Sbjct  59    IQEAYPSAAAGG---EYSDEEFQELVDRRCVDNVRMLIVDSVQRAKAGHPGMALGMADVA  115

Query  2041  YFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSR  1862
             YFLYRHV R NP  P WFNRDRFVLSAGHG LLQYVCLHLAGF SV+I+DL+RLC+LGSR
Sbjct  116   YFLYRHVFRHNPMNPTWFNRDRFVLSAGHGCLLQYVCLHLAGFHSVKIEDLQRLCQLGSR  175

Query  1861  TPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDG  1682
             TPGHPEN +T GIEVTTGPLGQGVANAVG ALAE HLA+RFNKPD+ IVDHRTYCIMGDG
Sbjct  176   TPGHPENTVTAGIEVTTGPLGQGVANAVGFALAEAHLAARFNKPDVAIVDHRTYCIMGDG  235

Query  1681  CSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVD  1502
             C+MEG++NEAASLAAHWKLNKLTL+YDDN NTIDG TDL  +ED++ RF+ALGWNTITVD
Sbjct  236   CAMEGISNEAASLAAHWKLNKLTLIYDDNKNTIDGPTDLAFTEDVTLRFKALGWNTITVD  295

Query  1501  NTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQK  1322
              T  +M + KNAL  A  ETQ+PT IRVKTCIGKLSKKEGTSKAHHG F+E+D KQMK+K
Sbjct  296   ATHSNMSSFKNALLDAFNETQRPTLIRVKTCIGKLSKKEGTSKAHHGIFDEEDEKQMKEK  355

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             ++W   R PF+VIPML+REM++QA +GE LE+EWHSKL  YQ+KYPQEA +F  LL GG+
Sbjct  356   VKWGT-RQPFYVIPMLHREMQVQAGRGEELEKEWHSKLNYYQSKYPQEAAEFKCLLYGGM  414

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
             +PGWE SLP+W  SD V+ATRGYS KCLN+LAKV+PGLIGGSADL SSN+ +LH Y DF+
Sbjct  415   IPGWENSLPKWSTSDAVDATRGYSEKCLNNLAKVLPGLIGGSADLASSNKVHLHDYQDFQ  474

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
              P SP GRNIRYGVREHAMAGISNGIALHGGGLIPFAATFL FSDYMKNSIRLSALSHAG
Sbjct  475   NPVSPWGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLTFSDYMKNSIRLSALSHAG  534

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VIYIMTHDSIGLGEDGPTHQPVEHL GLRAIPRLLVFRP+DGNETAGAY+VA+ANR  PS
Sbjct  535   VIYIMTHDSIGLGEDGPTHQPVEHLVGLRAIPRLLVFRPADGNETAGAYRVAVANRGAPS  594

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNS-GEELPEIILIGTGWELCLCEESAGVLR  425
             ++ALSRQKVAAN++GTSADGV +GGYI+SDNS  + LPEIILIGTG ELCLCE SA VLR
Sbjct  595   VVALSRQKVAANLEGTSADGVERGGYIVSDNSLDDHLPEIILIGTGSELCLCEGSARVLR  654

Query  424   NEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGM  245
              EGRRVRVVSLVCWRLF+RQ  EYKE VLP  V +RVSVEA S +GWREYVG EGVV+G+
Sbjct  655   REGRRVRVVSLVCWRLFDRQGVEYKERVLPPGVTRRVSVEARSTIGWREYVGPEGVVVGV  714

Query  244   DEFGASGPDTHVFKKYGFTEENVSKTAR  161
             DEFGASG     FKK+GFTEENV++ A+
Sbjct  715   DEFGASGAYLDTFKKFGFTEENVTRIAK  742



>ref|XP_010032172.1| PREDICTED: transketolase, chloroplastic-like [Eucalyptus grandis]
Length=750

 Score =  1073 bits (2774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/738 (73%), Positives = 620/738 (84%), Gaps = 10/738 (1%)
 Frame = -3

Query  2362  PLFPQNNKRLIALRLVQCRS-NPKSKSPVLKNTVVSKDEDYRLSWLEELKRAYPSQACSA  2186
             P F    +  ++ + + C S   +   P  + + +S+D+  +LSW EELK+AY  +  + 
Sbjct  12    PSFCSYRRSKLSAKSIACSSLKTQDCKPAAQRSSLSRDD--KLSWKEELKKAYQREIPNL  69

Query  2185  HEWEE----DDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVM  2018
             + W++    +D+ FQ +VD+RCVDNVRMLIVD VQ+AKAGH GMALG+A V + LYRHVM
Sbjct  70    N-WDKLEELEDESFQNLVDKRCVDNVRMLIVDSVQNAKAGHPGMALGMAGVLFLLYRHVM  128

Query  2017  RFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENV  1838
             ++NP+ PKWFNRDRFVLSAGHG LLQYVCLHLAGF+SVQI+DLKRLC+LGSRTPGHPENV
Sbjct  129   KYNPKNPKWFNRDRFVLSAGHGCLLQYVCLHLAGFESVQIEDLKRLCQLGSRTPGHPENV  188

Query  1837  ITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTN  1658
             +T GIEVTTGPLGQGVANAVGLALAE HLA+RFNK D  IVDHRTYCIMGDGC+MEG+ +
Sbjct  189   VTSGIEVTTGPLGQGVANAVGLALAEAHLAARFNKADAVIVDHRTYCIMGDGCAMEGIAH  248

Query  1657  EAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEA  1478
             EAASLAAHWKLNKLTL+YDDNHNTIDG T L  SEDISARF+ALGW+TI+VD+   DM  
Sbjct  249   EAASLAAHWKLNKLTLIYDDNHNTIDGPTTLAFSEDISARFKALGWHTISVDDIDADMRT  308

Query  1477  LKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRG  1298
             LK+AL SA +ET+KPTFIRVKT IGKLS KEGTSKAHHGTF EDDV  M+QK++W + R 
Sbjct  309   LKDALFSAFSETEKPTFIRVKTLIGKLSGKEGTSKAHHGTFSEDDVNNMRQKVKWTD-RE  367

Query  1297  PFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSL  1118
             PFHVIP++YREM+ QA+ GE LE+EWH+ LYSYQ KYPQEA +F  LL+GG++PGWE SL
Sbjct  368   PFHVIPIVYREMQKQADIGERLEKEWHTNLYSYQIKYPQEAIEFQILLSGGLLPGWENSL  427

Query  1117  PRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGR  938
             PRW  SDPV+ATRG+S KCLN LAKV+PGLIGGSADL +SN+AYLH Y DF  P SP G 
Sbjct  428   PRWSQSDPVDATRGHSEKCLNQLAKVLPGLIGGSADLATSNKAYLHNYDDF-LPSSPWGC  486

Query  937   NIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHD  758
             NIRYGVREHAM GISNGIALHG GLIPFAATFL+FSDYMKN+IRL+ALSHAGVIYIMTHD
Sbjct  487   NIRYGVREHAMGGISNGIALHGSGLIPFAATFLIFSDYMKNTIRLAALSHAGVIYIMTHD  546

Query  757   SIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQK  578
             SIGLGEDGPTHQPVE LAGLRAIP LLVFRP+DGNETAGAYK+A+ANR  PSL+ALSRQK
Sbjct  547   SIGLGEDGPTHQPVEQLAGLRAIPHLLVFRPADGNETAGAYKIAVANRAAPSLIALSRQK  606

Query  577   VAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVV  398
             VA+N+ GTS D V +GGY ISDNSGE++PEIILIGTG ELCLCE SA  LR  GRRVRVV
Sbjct  607   VASNLTGTSMDAVKQGGYTISDNSGEQMPEIILIGTGSELCLCEGSARRLREAGRRVRVV  666

Query  397   SLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPD  218
             SLVCWRLF+ QPREYKE VLPS V KRVSVEAGSP+GWREYVG EGVV+G+DEFGASG  
Sbjct  667   SLVCWRLFDGQPREYKERVLPSNVVKRVSVEAGSPVGWREYVGREGVVVGVDEFGASGHY  726

Query  217   THVFKKYGFTEENVSKTA  164
                F KYGFTEEN+++ A
Sbjct  727   LDTFNKYGFTEENITRIA  744



>ref|XP_002531681.1| transketolase, putative [Ricinus communis]
 gb|EEF30700.1| transketolase, putative [Ricinus communis]
Length=789

 Score =  1062 bits (2747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/795 (68%), Positives = 629/795 (79%), Gaps = 36/795 (5%)
 Frame = -3

Query  2476  VLSPPKAGS----PKVKIRAENNMAVYTVLLLRPNPPL--LEAKPLFPQNNKRLIALRLV  2315
             +L+PP  G     P+  +    ++   + LL +P+ PL     KP     N         
Sbjct  3     LLAPPYHGRSQSPPRATLSISFSIMAISSLLFKPHVPLKFSSTKPSLNIKN---------  53

Query  2314  QCRSNPKSKSPVLKNTV------VSKDEDYRLSWLEELKRAYPSQACSAHEWEEDD----  2165
                + P S S  L N++      ++K + ++LSW +ELK A+     + +  + ++    
Sbjct  54    ---NTPSSSSLTLYNSLTPDRFHIAKSKTHKLSWQKELKHAFQEPLNNQNLIKTNNNDID  110

Query  2164  -------DKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNP  2006
                    + FQ++VDRRCVDNVRMLIVD VQ AKAGH GMALG+AEVGY+LYRHVM++NP
Sbjct  111   FIDDYDDESFQKLVDRRCVDNVRMLIVDAVQTAKAGHPGMALGMAEVGYYLYRHVMKYNP  170

Query  2005  QTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEG  1826
               P WFNRDRFVLSAGHG LLQYVCLHLAGF+SVQ++DLK LCKLGSRTPGHPEN +T+G
Sbjct  171   FNPTWFNRDRFVLSAGHGCLLQYVCLHLAGFESVQLEDLKCLCKLGSRTPGHPENTVTDG  230

Query  1825  IEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAAS  1646
             IEV TGPLGQGVANAVGLALAE HLA+RFNKPD  IVDHRTYCIMGDGC+MEG+ +EAAS
Sbjct  231   IEVPTGPLGQGVANAVGLALAEAHLAARFNKPDCVIVDHRTYCIMGDGCAMEGIAHEAAS  290

Query  1645  LAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNA  1466
             LAAHWKL+KLTL+YDDN NTIDG T L  SEDISARF ALGW+TITVDN   DM++ KNA
Sbjct  291   LAAHWKLHKLTLIYDDNQNTIDGPTSLAFSEDISARFSALGWDTITVDNIHEDMDSFKNA  350

Query  1465  LNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHV  1286
             L SA  ET KPTFIRVKT IG+LSKKEGTSKAHHGTF+EDD K+MKQK++W+N + PFHV
Sbjct  351   LLSAVNETNKPTFIRVKTLIGRLSKKEGTSKAHHGTFDEDDTKEMKQKVKWNN-QDPFHV  409

Query  1285  IPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWL  1106
             IPM+Y EM+ Q    E LE EW S +  Y++KYPQEA +F  LL+GG+   WE+ LP+W 
Sbjct  410   IPMVYSEMQTQTCHSEKLEMEWLSNIRYYKSKYPQEAAEFEVLLHGGLPSKWESCLPKWS  469

Query  1105  MSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRY  926
             +SDPV+ATRGYS KCLN LAKVVPGLIGGSADL SSN+ YLH Y DF  P S  GRNIRY
Sbjct  470   VSDPVDATRGYSEKCLNRLAKVVPGLIGGSADLASSNKVYLHDYQDFAPPHSAWGRNIRY  529

Query  925   GVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGL  746
             G+REHAMAGISNGIALHG GLIPFAATFL+FSDYMKNSIRLS L HAGVIYIMTHDSIGL
Sbjct  530   GIREHAMAGISNGIALHGSGLIPFAATFLIFSDYMKNSIRLSGLGHAGVIYIMTHDSIGL  589

Query  745   GEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAAN  566
             GEDGPTHQPVE LAGLRA+P LLVFRP DGNETAGAYKVAIANRD PS++ALSRQKVAAN
Sbjct  590   GEDGPTHQPVEQLAGLRAVPGLLVFRPGDGNETAGAYKVAIANRDVPSVIALSRQKVAAN  649

Query  565   MDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVC  386
             ++GTS + V +GGYIISDNSG+ LP+IIL+GTG ELCLCE SA +LRNEGR+VRVVSLVC
Sbjct  650   LEGTSTNEVERGGYIISDNSGKSLPDIILMGTGSELCLCEGSAKILRNEGRKVRVVSLVC  709

Query  385   WRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVF  206
             WRLF++QP EYKE VLPS+V KRVSVEAGSPLGWREYVG  GVVIG++EFGASG     F
Sbjct  710   WRLFDKQPPEYKEHVLPSSVTKRVSVEAGSPLGWREYVGGVGVVIGVEEFGASGAYLDTF  769

Query  205   KKYGFTEENVSKTAR  161
             KK+GFTEENV+K A+
Sbjct  770   KKFGFTEENVTKVAK  784



>gb|KCW51576.1| hypothetical protein EUGRSUZ_J01078 [Eucalyptus grandis]
Length=746

 Score =  1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/738 (72%), Positives = 617/738 (84%), Gaps = 14/738 (2%)
 Frame = -3

Query  2362  PLFPQNNKRLIALRLVQCRS-NPKSKSPVLKNTVVSKDEDYRLSWLEELKRAYPSQACSA  2186
             P F    +  ++ + + C S   +   P  + + +S+D+  +LSW EELK+AY  +  + 
Sbjct  12    PSFCSYRRSKLSAKSIACSSLKTQDCKPAAQRSSLSRDD--KLSWKEELKKAYQREIPNL  69

Query  2185  HEWEE----DDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVM  2018
             + W++    +D+ FQ +VD+RCVDNVRMLIVD VQ+AKAGH GMALG+A V + LYRHVM
Sbjct  70    N-WDKLEELEDESFQNLVDKRCVDNVRMLIVDSVQNAKAGHPGMALGMAGVLFLLYRHVM  128

Query  2017  RFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENV  1838
             ++NP+ PKWFNRDRFVLSAGHG LLQYVCLHLAGF+SVQI+DLKRLC+LGSRTPGHPENV
Sbjct  129   KYNPKNPKWFNRDRFVLSAGHGCLLQYVCLHLAGFESVQIEDLKRLCQLGSRTPGHPENV  188

Query  1837  ITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTN  1658
             +T GIEVTTGPLGQGVANAVGLALAE HLA+RFNK D  IVDHRTYCIMGDGC+MEG+ +
Sbjct  189   VTSGIEVTTGPLGQGVANAVGLALAEAHLAARFNKADAVIVDHRTYCIMGDGCAMEGIAH  248

Query  1657  EAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEA  1478
             EAASLAAHWKLNKLTL+YDDNHNTIDG T L  SEDISARF+ALGW+TI+VD+   DM  
Sbjct  249   EAASLAAHWKLNKLTLIYDDNHNTIDGPTTLAFSEDISARFKALGWHTISVDDIDADMRT  308

Query  1477  LKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRG  1298
             LK+AL SA +ET+KPTFIRV+    KLS KEGTSKAHHGTF EDDV  M+QK++W + R 
Sbjct  309   LKDALFSAFSETEKPTFIRVR----KLSGKEGTSKAHHGTFSEDDVNNMRQKVKWTD-RE  363

Query  1297  PFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSL  1118
             PFHVIP++YREM+ QA+ GE LE+EWH+ LYSYQ KYPQEA +F  LL+GG++PGWE SL
Sbjct  364   PFHVIPIVYREMQKQADIGERLEKEWHTNLYSYQIKYPQEAIEFQILLSGGLLPGWENSL  423

Query  1117  PRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGR  938
             PRW  SDPV+ATRG+S KCLN LAKV+PGLIGGSADL +SN+AYLH Y DF  P SP G 
Sbjct  424   PRWSQSDPVDATRGHSEKCLNQLAKVLPGLIGGSADLATSNKAYLHNYDDF-LPSSPWGC  482

Query  937   NIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHD  758
             NIRYGVREHAM GISNGIALHG GLIPFAATFL+FSDYMKN+IRL+ALSHAGVIYIMTHD
Sbjct  483   NIRYGVREHAMGGISNGIALHGSGLIPFAATFLIFSDYMKNTIRLAALSHAGVIYIMTHD  542

Query  757   SIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQK  578
             SIGLGEDGPTHQPVE LAGLRAIP LLVFRP+DGNETAGAYK+A+ANR  PSL+ALSRQK
Sbjct  543   SIGLGEDGPTHQPVEQLAGLRAIPHLLVFRPADGNETAGAYKIAVANRAAPSLIALSRQK  602

Query  577   VAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVV  398
             VA+N+ GTS D V +GGY ISDNSGE++PEIILIGTG ELCLCE SA  LR  GRRVRVV
Sbjct  603   VASNLTGTSMDAVKQGGYTISDNSGEQMPEIILIGTGSELCLCEGSARRLREAGRRVRVV  662

Query  397   SLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPD  218
             SLVCWRLF+ QPREYKE VLPS V KRVSVEAGSP+GWREYVG EGVV+G+DEFGASG  
Sbjct  663   SLVCWRLFDGQPREYKERVLPSNVVKRVSVEAGSPVGWREYVGREGVVVGVDEFGASGHY  722

Query  217   THVFKKYGFTEENVSKTA  164
                F KYGFTEEN+++ A
Sbjct  723   LDTFNKYGFTEENITRIA  740



>ref|XP_008806920.1| PREDICTED: LOW QUALITY PROTEIN: transketolase, chloroplastic-like 
[Phoenix dactylifera]
Length=739

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/697 (75%), Positives = 596/697 (86%), Gaps = 5/697 (1%)
 Frame = -3

Query  2248  DYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGG  2069
             DYRLSW  EL+R   S      E  ED+D FQ  +DRR VDNVRMLIVD VQHAKAGH G
Sbjct  42    DYRLSWQNELER---SNGPLPREKLEDEDFFQTAIDRRAVDNVRMLIVDAVQHAKAGHPG  98

Query  2068  MALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDL  1889
             M LG+AEVGY LYRHVMR+NP+ PKWFNRDRFVLSAGHG L QYVCLHLAGF SVQ++DL
Sbjct  99    MPLGMAEVGYLLYRHVMRYNPKNPKWFNRDRFVLSAGHGCLHQYVCLHLAGFDSVQLEDL  158

Query  1888  KRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDH  1709
             K+LCKLGSRTPGHPEN +T G+EVTTGPLGQGVANAVGLALAE HLA+RFNKP+  +VDH
Sbjct  159   KQLCKLGSRTPGHPENTLTAGVEVTTGPLGQGVANAVGLALAEAHLAARFNKPNAILVDH  218

Query  1708  RTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEA  1529
             RTYCIMGDGC+MEG++NEAASLAAHWKLNKLTL+YDDNHNTIDG T +  SE+ISARFEA
Sbjct  219   RTYCIMGDGCAMEGISNEAASLAAHWKLNKLTLIYDDNHNTIDGDTXICFSENISARFEA  278

Query  1528  LGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEE  1349
             LGWNTITV++   DM +L+ A+ SAH ET++PTFI+VKT IG+LS KEGT KAHHGTFEE
Sbjct  279   LGWNTITVEDIYEDMGSLRKAIRSAHNETRRPTFIKVKTLIGRLSVKEGTYKAHHGTFEE  338

Query  1348  DDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQ  1169
             DDVKQM+ K++W++ R PFHVIPM+YREM+ QAE G  LE++W S L  YQ  YPQEA++
Sbjct  339   DDVKQMRGKVKWED-REPFHVIPMVYREMQRQAEYGANLEKKWKSALIHYQAMYPQEAEE  397

Query  1168  FIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQA  989
             F  LL+GG+ PGWE SLP W  SDPV+ATRGYS KCLN LA+ +PGLIGGSADL SSN+ 
Sbjct  398   FKILLHGGLPPGWEESLPNWSTSDPVDATRGYSEKCLNELAEALPGLIGGSADLASSNKV  457

Query  988   YLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSI  809
             YL GY DF+ P +P+GRNIRYGVREHAMAGISNGIALHG GLIPFAATFL FSDYMKNS+
Sbjct  458   YLKGYADFQLPGTPQGRNIRYGVREHAMAGISNGIALHGSGLIPFAATFLTFSDYMKNSM  517

Query  808   RLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKV  629
             RLSALSHAGV+Y++THDSIGLGEDGPTHQPVE LAGLRAIPRLLVFRP+DGNETAGAYKV
Sbjct  518   RLSALSHAGVVYVLTHDSIGLGEDGPTHQPVEQLAGLRAIPRLLVFRPADGNETAGAYKV  577

Query  628   AIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSG-EELPEIILIGTGWELCL  452
             AI+NRD PS++ALSRQKVAAN++GTS  GV KGGY+ISDNSG   LPEIILIGTG ELCL
Sbjct  578   AISNRDAPSVVALSRQKVAANLEGTSISGVEKGGYVISDNSGINGLPEIILIGTGSELCL  637

Query  451   CEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYV  272
             CE SA  LR EGRRVRVVSLVCWRLF+ QPREY+E+VLP  V KRVSVEAGSP+GWREYV
Sbjct  638   CEGSAETLRREGRRVRVVSLVCWRLFDGQPREYRELVLPPKVSKRVSVEAGSPIGWREYV  697

Query  271   GDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             G+ GV+ G+ +FGASG     F+K+GFTEENV++ AR
Sbjct  698   GESGVIHGVRDFGASGAGLDTFRKFGFTEENVTRIAR  734



>ref|XP_010918808.1| PREDICTED: transketolase, chloroplastic-like [Elaeis guineensis]
Length=738

 Score =  1053 bits (2723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/756 (72%), Positives = 620/756 (82%), Gaps = 26/756 (3%)
 Frame = -3

Query  2419  MAVYTVLLLRPNPPLLEAKPLFPQNNKRLIA---LRLVQCRSNPKSKSPVLKNTVVSKDE  2249
             MA+++ LL +P  P L  KP    N KRL      R  + R +P +              
Sbjct  1     MALFS-LLFQPPQPFLPYKP----NTKRLSTKPPTRRTRARFHPSN--------------  41

Query  2248  DYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGG  2069
             DYRLSW  ELKR          E  ED+D FQ  +DRR VDNVRMLIVD VQHAKAGH G
Sbjct  42    DYRLSWQNELKRL---DGPPPKEKLEDEDFFQAAIDRRAVDNVRMLIVDAVQHAKAGHPG  98

Query  2068  MALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDL  1889
             MALG+AEVGY +YRHVMR+NP+  +WFNRDRFVLSAGHG LLQYVCLHLAGF+SVQ++DL
Sbjct  99    MALGMAEVGYLIYRHVMRYNPKNSRWFNRDRFVLSAGHGCLLQYVCLHLAGFESVQLEDL  158

Query  1888  KRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDH  1709
             K+LCKLGSRTPGHPEN++T G+EVTTGPLGQGVANAVGLALAE HLA+RFNKPD  +VDH
Sbjct  159   KQLCKLGSRTPGHPENILTAGVEVTTGPLGQGVANAVGLALAEAHLAARFNKPDAILVDH  218

Query  1708  RTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEA  1529
             RTYCIMGDGC+MEG++NEAASLAAHWKLNKLTL+YDDNHNTIDG T +  SE++SARFEA
Sbjct  219   RTYCIMGDGCAMEGISNEAASLAAHWKLNKLTLIYDDNHNTIDGDTKICFSENVSARFEA  278

Query  1528  LGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEE  1349
             LGWNTITV+N  GDM +   A+ SAH ET++PTFI+VKT IG+LS KEGT KAHHGTFEE
Sbjct  279   LGWNTITVENIHGDMGSFIEAIRSAHNETRRPTFIKVKTLIGRLSGKEGTYKAHHGTFEE  338

Query  1348  DDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQ  1169
             +DVK+M+ K++W+N R PFHVIPM+YREM+ QAE GE LE++W S L  YQ  YPQEA++
Sbjct  339   NDVKRMRGKVKWEN-REPFHVIPMVYREMQKQAEYGENLEKKWKSDLRHYQAMYPQEAEE  397

Query  1168  FIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQA  989
             F  LL+GG+ PG+E SLP W  SDPV+ATRGYS KCLN LAK +PGLIGGSADL SSN+ 
Sbjct  398   FSILLHGGLPPGFEESLPNWSTSDPVDATRGYSEKCLNELAKALPGLIGGSADLASSNKV  457

Query  988   YLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSI  809
             YL GY DF+ P++P+GRNIRYGVREHAMAGISNGIALHG GLIPFAATFL FSDYMKNS+
Sbjct  458   YLKGYDDFQLPEAPQGRNIRYGVREHAMAGISNGIALHGSGLIPFAATFLTFSDYMKNSM  517

Query  808   RLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKV  629
             RLSALSHAGV+YI+THDSIGLGEDGPTHQPVE LAGLRAIPRLLVFRP+DGNETAGAYKV
Sbjct  518   RLSALSHAGVLYILTHDSIGLGEDGPTHQPVEQLAGLRAIPRLLVFRPADGNETAGAYKV  577

Query  628   AIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLC  449
             AI+NRD PS++ALSRQKVAAN++GTS  GV KGGYIISDNS   LPEIILIGTG ELCLC
Sbjct  578   AISNRDAPSVIALSRQKVAANLEGTSISGVEKGGYIISDNSSNGLPEIILIGTGSELCLC  637

Query  448   EESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVG  269
             E SA  LR EGRRVRVVSLVCWRLF+ Q REY+E VLP TV KRVSVEAGSP+GWREYVG
Sbjct  638   EGSAETLRREGRRVRVVSLVCWRLFDGQTREYREFVLPPTVSKRVSVEAGSPIGWREYVG  697

Query  268   DEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             D GVV G+ +FGASG     FKK+GFTEENV++ AR
Sbjct  698   DGGVVHGVRDFGASGAYLDTFKKFGFTEENVTRIAR  733



>ref|XP_006485646.1| PREDICTED: LOW QUALITY PROTEIN: transketolase-1, chloroplastic-like 
[Citrus sinensis]
Length=746

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/758 (69%), Positives = 622/758 (82%), Gaps = 29/758 (4%)
 Frame = -3

Query  2404  VLLLRPNPPLLEAKPLFPQNNKRLIALRLVQCRSNPKSKSPVLK--------NTVVSKDE  2249
             + LL   P  +  K +F  NNK       +  +++  S +P+LK        N  ++   
Sbjct  3     ISLLLTKPSSIPTKQIF-SNNK-------LYHKNDTVSVNPILKPCSSLRTDNNNITISN  54

Query  2248  DYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGG  2069
             +++LSW ++L++A+  Q    +++  +D+ FQE+VD+RCVDN+RMLIVD VQ+AKAGH G
Sbjct  55    NHKLSWQKKLEQAFKDQLSDHYDYA-NDNSFQELVDKRCVDNIRMLIVDAVQNAKAGHPG  113

Query  2068  MALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDL  1889
             MALG+AEVGY LYRH M++N + PKWFNRDRFVLSAGHG LLQYVCLHLAGFQSVQ++DL
Sbjct  114   MALGMAEVGYVLYRHAMKYNSRNPKWFNRDRFVLSAGHGCLLQYVCLHLAGFQSVQLEDL  173

Query  1888  KRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDH  1709
             KRLCK+GSRTP HPEN +TEGIEVTTGPLGQGVANAVGLALAE HLA+RFNKPD  IVD+
Sbjct  174   KRLCKMGSRTPSHPENAMTEGIEVTTGPLGQGVANAVGLALAEAHLAARFNKPDAVIVDY  233

Query  1708  RTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEA  1529
             RTYCIMGDGC+MEG+++EAASLAAHWKLNKLTL+YDDNHNTIDG T L +SEDISARF++
Sbjct  234   RTYCIMGDGCAMEGISHEAASLAAHWKLNKLTLIYDDNHNTIDGPTSLVLSEDISARFKS  293

Query  1528  LGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEE  1349
             LGWNTITV+N   ++ + K AL +A  ET+KPTFIRVKT +GKLS KEGTSKAHHG F+E
Sbjct  294   LGWNTITVENIHDNLSSFKEALMAAANETKKPTFIRVKTLVGKLSAKEGTSKAHHGAFDE  353

Query  1348  DDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQ  1169
             ++VK+M++K+ W + R  FHVIPM+YREM++Q + GE LE+EW+SK+Y+Y+++YPQE  +
Sbjct  354   NEVKKMREKVNWVD-RDQFHVIPMVYREMQIQTDHGERLEKEWYSKVYNYRSEYPQEGAE  412

Query  1168  FIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQA  989
                LLNGG++PGWE +LP+W  SDP++ATRGYS KCLN LAKV+PGLIGGSADL SSN+A
Sbjct  413   LDLLLNGGLLPGWENALPKWSTSDPLDATRGYSEKCLNQLAKVLPGLIGGSADLASSNKA  472

Query  988   YLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSI  809
             YL GY DF QPDSP GRNIRYGVREHAMAGISNGIALHGGGLIPFAATFL+FSDYMKNSI
Sbjct  473   YLLGYHDFSQPDSPWGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLIFSDYMKNSI  532

Query  808   RLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKV  629
             RLSALSHAGVIYI+THDSIGLGEDGPTHQPVE LAGLRA+PRLLVFRP DGNETAG+Y V
Sbjct  533   RLSALSHAGVIYILTHDSIGLGEDGPTHQPVEQLAGLRAVPRLLVFRPPDGNETAGSYSV  592

Query  628   AIANRDKPSLMALSRQKVAANMDGTSADGV--GKGGYIISDNSGEELPEIILIGTGWELC  455
             AIANRD PS++ALSRQK+AAN +GTSAD V  G+GG I+SDNS E  PEIILIGTG EL 
Sbjct  593   AIANRDVPSVIALSRQKIAANFEGTSADEVERGRGGCIVSDNSSENKPEIILIGTGTELS  652

Query  454   LCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREY  275
             LCE +A +LR EGRRVRVVSLVCW LF+RQP EYKE VLPS V K         +GWREY
Sbjct  653   LCEGTAKLLRQEGRRVRVVSLVCWWLFDRQPAEYKEKVLPSRVVK---------VGWREY  703

Query  274   VGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             VG EG VIG++EFGASG     FKKYGFT +NV+K AR
Sbjct  704   VGVEGKVIGVEEFGASGAYLDTFKKYGFTIDNVTKVAR  741



>ref|XP_002315311.1| hypothetical protein POPTR_0010s23150g [Populus trichocarpa]
 gb|EEF01482.1| hypothetical protein POPTR_0010s23150g [Populus trichocarpa]
Length=656

 Score =  1036 bits (2680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/652 (76%), Positives = 573/652 (88%), Gaps = 2/652 (0%)
 Frame = -3

Query  2116  MLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQY  1937
             ML+VD VQ A+AGH GMALG+A++GY+LYRHVMR+NP+ PKWFNRDRFVLSAGHG LLQY
Sbjct  1     MLVVDAVQSAQAGHPGMALGMADIGYYLYRHVMRYNPRDPKWFNRDRFVLSAGHGCLLQY  60

Query  1936  VCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEV  1757
             VCLHLAGF+SVQ++DLKRLCKLGSRTPGHPEN +T+GIEVTTGPLGQGVANAVGLALAE 
Sbjct  61    VCLHLAGFESVQLEDLKRLCKLGSRTPGHPENTVTDGIEVTTGPLGQGVANAVGLALAEA  120

Query  1756  HLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDG  1577
             HLA+RFNKPD  IVDHRTYCIMGDGC+MEG+T+EAASLAAHWKL+KLT++YDDNHNTIDG
Sbjct  121   HLAARFNKPDCDIVDHRTYCIMGDGCAMEGITHEAASLAAHWKLHKLTMIYDDNHNTIDG  180

Query  1576  TTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKL  1397
                L  SEDISARF+ALGWNTITVDNT  DM++  +AL SA  +T+KPTFIRVKT IG+L
Sbjct  181   PISLAFSEDISARFKALGWNTITVDNTHDDMDSFNDALLSAFGDTEKPTFIRVKTLIGRL  240

Query  1396  SKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWH  1217
             S+KEGTSKAHHGTFEEDDVKQM+QK++WD+ R PFHVIPM+YREM++Q + GE LE+EW 
Sbjct  241   SRKEGTSKAHHGTFEEDDVKQMRQKVKWDS-REPFHVIPMVYREMQVQTDHGEKLEKEWF  299

Query  1216  SKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVV  1037
             SK   ++  YP+EA +F  LL+GG+ P WE+ LP W ++DPV+ATRGYS KCLN L KV+
Sbjct  300   SKFDYFKTNYPEEAAEFEVLLSGGLPPNWESCLPEWSVTDPVDATRGYSEKCLNQLVKVL  359

Query  1036  PGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIP  857
             PGLIGGSADL SSN+ YL G  DF Q  S  GRNIRYGVREHAMAGISNGIALH  GLIP
Sbjct  360   PGLIGGSADLASSNKVYLQGSQDF-QHSSFYGRNIRYGVREHAMAGISNGIALHKSGLIP  418

Query  856   FAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLL  677
             FAATFL+FSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP+E LAGLRA+PRLL
Sbjct  419   FAATFLIFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPIEQLAGLRAVPRLL  478

Query  676   VFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEE  497
             VFRP+DGNETAGAY+ A+ NRD PS++ALSRQKVAAN++GTSA+ V KGGYIISDNSG+ 
Sbjct  479   VFRPADGNETAGAYREAMTNRDAPSVIALSRQKVAANLEGTSANEVEKGGYIISDNSGKS  538

Query  496   LPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKR  317
             LP+IILI TG ELCLCEESA +LR EGR+VRVVSLVCW+LF RQP+EYKE VLPS+V KR
Sbjct  539   LPDIILISTGSELCLCEESAKMLRKEGRKVRVVSLVCWQLFNRQPKEYKEHVLPSSVSKR  598

Query  316   VSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +SVEAGS +GW EYVG EG+V+G++EFGASG     FKK+GFTEENV++ A+
Sbjct  599   ISVEAGSSMGWSEYVGREGIVMGVEEFGASGAYLDTFKKFGFTEENVTRVAK  650



>emb|CBI31439.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/663 (70%), Positives = 544/663 (82%), Gaps = 29/663 (4%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             RCVDNVRMLIVD VQ AKAGH GM LG+A+VGY LYRHVMR+NP+ PKWFNRDRFVLSAG
Sbjct  2     RCVDNVRMLIVDAVQTAKAGHSGMPLGMAKVGYILYRHVMRYNPRNPKWFNRDRFVLSAG  61

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG LLQY+CLHLAGFQSVQ++DL+RLC             +  G +VT       +   +
Sbjct  62    HGCLLQYICLHLAGFQSVQLEDLQRLC-------------LVVGPQVT-------LRMWL  101

Query  1777  GLALAEVHLA-SRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
              +AL  +    +RFNKPD  IVDHRT+CIMGDGC MEG+++EAASLAAHWKLNKLTL+YD
Sbjct  102   PMALKSLQAPWARFNKPDAVIVDHRTFCIMGDGCVMEGISHEAASLAAHWKLNKLTLIYD  161

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DN NTIDG T L  SEDISARF+AL WNTITVD+T  DMEA+KNAL SA  ET+KPTFIR
Sbjct  162   DNLNTIDGATSLAFSEDISARFKALRWNTITVDDTHNDMEAIKNALLSAFRETEKPTFIR  221

Query  1420  VKTCIGKLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
             V  C  KLS+K+G SKAHHGTF+E DVK+M++K+ W + R PFHVIPM+YR +   A   
Sbjct  222   V--C--KLSEKKGISKAHHGTFDEKDVKKMRRKVSWSD-REPFHVIPMIYRLVFKSAAGK  276

Query  1240  ETLEQ--EWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSG  1067
                +Q  EWHS+L  YQ KYPQE  +F  LL+GG++PGWE+SLP++  SDPV+AT+GYS 
Sbjct  277   CRYKQSMEWHSRLCYYQTKYPQEFVEFKILLDGGLLPGWESSLPKFPTSDPVDATQGYSE  336

Query  1066  KCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNG  887
             KCL+ LAKV+PGLI GSADL +SN+AYLHG+ DF QP+SP G NIRYGVREHAMAGISNG
Sbjct  337   KCLSQLAKVLPGLIRGSADLATSNKAYLHGHEDFSQPNSPWGCNIRYGVREHAMAGISNG  396

Query  886   IALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP-VEH  710
             IALHG GLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP VE 
Sbjct  397   IALHGSGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPAVEQ  456

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             LAGLRA+P+LLVFRP+DGNETAGAYKVA+ANR+ PSL+ALSRQKVAAN++GTS   V +G
Sbjct  457   LAGLRAVPQLLVFRPADGNETAGAYKVAVANRNVPSLIALSRQKVAANLEGTSRASVERG  516

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYI+SDNS ++LP+IILIGTG ELCLC+E A +LR EGR VRVVSLVCWRLF+ QP++YK
Sbjct  517   GYIVSDNSEDKLPDIILIGTGSELCLCDEGAKMLRQEGRTVRVVSLVCWRLFDMQPQQYK  576

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E VLP +V KRVSVEA SP+GWREYVG+EGVV+G++EFGASG     FKK+GFTE N+++
Sbjct  577   EFVLPPSVSKRVSVEAASPIGWREYVGEEGVVVGVEEFGASGAYLDTFKKFGFTEGNITR  636

Query  169   TAR  161
              A+
Sbjct  637   IAK  639



>ref|XP_001776961.1| predicted protein [Physcomitrella patens]
 gb|EDQ58210.1| predicted protein [Physcomitrella patens]
Length=665

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/655 (66%), Positives = 531/655 (81%), Gaps = 3/655 (0%)
 Frame = -3

Query  2122  VRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLL  1943
             +RML VD V  AKAGH G+ LG+AEVGY L+R+VM+FNP+ P WFNRDRFVLSAGHG LL
Sbjct  1     MRMLTVDAVNTAKAGHPGLPLGMAEVGYVLWRYVMKFNPKNPNWFNRDRFVLSAGHGCLL  60

Query  1942  QYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALA  1763
             QY+ LHL+G+ SVQI+DLKRLC++GSRTPGHPENV T+GIEVTTGPLGQGVANAVGLALA
Sbjct  61    QYITLHLSGYDSVQIEDLKRLCQIGSRTPGHPENVTTDGIEVTTGPLGQGVANAVGLALA  120

Query  1762  EVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTI  1583
             E HLA+RFNK D  IVDHRT+CIMGDGC+MEG+TNEAASLAAHWKLNKLT++YDDNHNTI
Sbjct  121   EKHLAARFNKHDGKIVDHRTFCIMGDGCAMEGITNEAASLAAHWKLNKLTVIYDDNHNTI  180

Query  1582  DGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIG  1403
             DG T L  SED+ ARFEALGWN + +DN   D+++ K A+ +   ++ KPTFI+VK+ IG
Sbjct  181   DGDTSLAFSEDVGARFEALGWNRVVIDNIYHDIDSFKEAVLNFAGKSDKPTFIQVKSRIG  240

Query  1402  KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQE  1223
             + S KE T+KAHHGTF+EDDVK M + L+W+N R PF+VIP +Y E    A+ G + E+E
Sbjct  241   RESVKENTAKAHHGTFDEDDVKHMHKNLKWEN-REPFYVIPQVYEEFTDHAKHGISEEEE  299

Query  1222  WHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAK  1043
             W+  L  Y  KYP+EA+ F  L++G +   WE ++P +   + ++ATRGYS  CLN +AK
Sbjct  300   WNEALEDYSKKYPEEARNFKELISGELPKDWEKAIPHFPEDEKIDATRGYSETCLNAVAK  359

Query  1042  VVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGL  863
             V+PGLIGGSADL SSN+ Y+  + DF   ++P GRNIRYG+REHAMAGISNG+ALH  GL
Sbjct  360   VLPGLIGGSADLASSNKVYMKDFPDF-SAETPEGRNIRYGIREHAMAGISNGLALHNSGL  418

Query  862   IPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPR  683
             IP AATFL+FSDYMKNS+RLSALS AGVIYI+THDSIGLGEDGPTHQPVE LAGLRAIP 
Sbjct  419   IPIAATFLIFSDYMKNSMRLSALSEAGVIYILTHDSIGLGEDGPTHQPVEQLAGLRAIPG  478

Query  682   LLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSG  503
             + V RP+D  E AGAYKVAI+ R  P++++LSRQKVAAN+ GTSA+GV KGGY++SDN+ 
Sbjct  479   MYVLRPADAKEVAGAYKVAISRRHAPTVLSLSRQKVAANVGGTSAEGVLKGGYVVSDNTD  538

Query  502   E-ELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTV  326
             E  LPE+ILIGTG EL LCE+SA  LR EG++VRVVSLVCW+LF++QP EY+E +LPS +
Sbjct  539   ENSLPELILIGTGTELALCEKSAETLRQEGKKVRVVSLVCWQLFDQQPEEYREKILPSAM  598

Query  325   RKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              KR+SVEAGSP GWREYVG +G ++ +  FG SG  T VF+KYGFT EN++  A+
Sbjct  599   EKRISVEAGSPFGWREYVGSKGKILAVYTFGCSGAYTKVFEKYGFTAENITDVAQ  653



>ref|XP_002986263.1| hypothetical protein SELMODRAFT_234975 [Selaginella moellendorffii]
 gb|EFJ12794.1| hypothetical protein SELMODRAFT_234975 [Selaginella moellendorffii]
Length=661

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/656 (66%), Positives = 523/656 (80%), Gaps = 4/656 (1%)
 Frame = -3

Query  2122  VRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLL  1943
             +RML+VD V +AKAGH GM LG+AEVG+ LYR VM++NP  P WFNRDRFVLSAGHG LL
Sbjct  1     MRMLVVDAVNNAKAGHPGMPLGMAEVGFTLYRKVMKYNPGNPGWFNRDRFVLSAGHGCLL  60

Query  1942  QYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALA  1763
             QY+CLHLAGF+SVQ++DLKRLCK G+RTPGHPEN  T GIEVTTGPLGQGVANAVGLALA
Sbjct  61    QYICLHLAGFESVQMEDLKRLCKFGARTPGHPENSETAGIEVTTGPLGQGVANAVGLALA  120

Query  1762  EVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTI  1583
             E HLA+RFNKP   IV+HRT+CIMGDGC+MEG++NE+ASLA HWKL+KLT++YDDNHNTI
Sbjct  121   ERHLAARFNKPGHDIVNHRTFCIMGDGCAMEGISNESASLAGHWKLDKLTVIYDDNHNTI  180

Query  1582  DGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIG  1403
             DG T+L  SED++ R+ ALGW TI V++          AL+ A  ET+KPT I+VK+ IG
Sbjct  181   DGDTELAFSEDVAGRYRALGWQTILVEDIHEHPGKFVKALDEAFAETEKPTLIQVKSSIG  240

Query  1402  KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQE  1223
               SKK+GTSKAHHGTF+E+DV+ +K  L W+ GR PF+V+P +Y E K +A++ E +E+E
Sbjct  241   FPSKKQGTSKAHHGTFDEEDVEGIKAALSWE-GREPFYVVPTVYEEFKKKAKEAECIEEE  299

Query  1222  WHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAK  1043
             W+ +L  Y+ ++P EA +F  LL   I  GWE  LP W  SDPV+ATR YS KCLN L+ 
Sbjct  300   WNIELAKYEQEFPNEANEFKQLLGNIISEGWEKVLPTWSQSDPVDATRSYSEKCLNALST  359

Query  1042  VVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGL  863
             V+PGLIGGSADL SSN+AYL  Y DF Q  +P GRN+RYG+REHAMA ISNG++LH  GL
Sbjct  360   VIPGLIGGSADLASSNKAYLKDYDDF-QHKTPWGRNVRYGIREHAMAAISNGLSLHSSGL  418

Query  862   IPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPR  683
             IPFAATFL FSDYMK+++RLSALS AGVIYI THDSIGLGEDGPTHQPVE L GLRAIP 
Sbjct  419   IPFAATFLAFSDYMKHAMRLSALSRAGVIYICTHDSIGLGEDGPTHQPVEQLVGLRAIPN  478

Query  682   LLVFRPSDGNETAGAYKVAIANRDK-PSLMALSRQKVAANMDGTSADGVGKGGYIISDNS  506
             L+V RP+DGNET+GAYKVA+  RD  P+++ALSRQKV A++ GTSAD V KGGYI+SDNS
Sbjct  479   LVVLRPADGNETSGAYKVAVRRRDSGPTVIALSRQKVQAHVAGTSADKVEKGGYIVSDNS  538

Query  505   GE-ELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPST  329
                  PE+I+IGTG ELCLCE +A  LRN+G +VRVVSLV W LF+ QP EYK+ +LP +
Sbjct  539   SSGSDPELIIIGTGSELCLCEGAAEKLRNDGLKVRVVSLVSWELFDEQPLEYKDEILPRS  598

Query  328   VRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             V+KR+SVEAGSP+GWREYVG  G V+ ++ FG SG    VFKK+GFT +NV   AR
Sbjct  599   VKKRLSVEAGSPVGWREYVGFHGRVLAVNSFGKSGAYLDVFKKFGFTVDNVESEAR  654



>ref|XP_002985082.1| hypothetical protein SELMODRAFT_268939 [Selaginella moellendorffii]
 gb|EFJ13957.1| hypothetical protein SELMODRAFT_268939 [Selaginella moellendorffii]
Length=659

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/656 (66%), Positives = 523/656 (80%), Gaps = 4/656 (1%)
 Frame = -3

Query  2122  VRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLL  1943
             +RML+VD V +AKAGH GM LG+AEVG+ LYR VM++NP  P WFNRDRFVLSAGHG LL
Sbjct  1     MRMLVVDAVNNAKAGHPGMPLGMAEVGFTLYRKVMKYNPGNPGWFNRDRFVLSAGHGCLL  60

Query  1942  QYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALA  1763
             QY+CLHLAGF+SVQ++DLKRLCK G+RTPGHPEN  T GIEVTTGPLGQGVANAVGLALA
Sbjct  61    QYICLHLAGFESVQMEDLKRLCKFGARTPGHPENSETAGIEVTTGPLGQGVANAVGLALA  120

Query  1762  EVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTI  1583
             E HLA+RFNKP   IV+HRT+CIMGDGC+MEG++NE+ASLA HWKL+KLT++YDDNHNTI
Sbjct  121   ERHLAARFNKPGHDIVNHRTFCIMGDGCAMEGISNESASLAGHWKLDKLTVIYDDNHNTI  180

Query  1582  DGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIG  1403
             DG T+L  SED++ R+ ALGW TI V++          AL+ A  ET+KPT I+VK+ IG
Sbjct  181   DGDTELAFSEDVAGRYRALGWQTILVEDIHEHPGKFVKALDEAFAETEKPTLIQVKSSIG  240

Query  1402  KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQE  1223
               SKK+GTSKAHHGTF+E+DVK +K  L W+ GR PF+V+P +Y E K +A++ E +E+E
Sbjct  241   FPSKKQGTSKAHHGTFDEEDVKGIKAALSWE-GREPFYVVPTVYEEFKKKAKEAECIEEE  299

Query  1222  WHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAK  1043
             W+ +L  Y+ ++P EA +F  LL   I  GWE  LP W  SDPV+ATR YS KCLN L+ 
Sbjct  300   WNIELAKYEQEFPNEANEFKQLLGNIISEGWEKVLPTWSQSDPVDATRSYSEKCLNALST  359

Query  1042  VVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGL  863
             V+PGLIGGSADL SSN+AYL  Y DF Q  +P GRN+RYG+REHAMA ISNG++LH  GL
Sbjct  360   VIPGLIGGSADLASSNKAYLKDYDDF-QHKTPWGRNVRYGIREHAMAAISNGLSLHSSGL  418

Query  862   IPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPR  683
             IPFAATFL FSDYMK+++RLSALS AGVIYI THDSIGLGEDGPTHQPVE L GLRAIP 
Sbjct  419   IPFAATFLAFSDYMKHAMRLSALSRAGVIYICTHDSIGLGEDGPTHQPVEQLVGLRAIPN  478

Query  682   LLVFRPSDGNETAGAYKVAIANRDK-PSLMALSRQKVAANMDGTSADGVGKGGYIISDNS  506
             L+V RP+DGNET+GAY+VA+  RD  P+++ALSRQKV A++ GTSAD V KGGY++SDNS
Sbjct  479   LVVLRPADGNETSGAYQVAVRRRDSGPTVIALSRQKVQAHVAGTSADKVEKGGYVVSDNS  538

Query  505   GE-ELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPST  329
                  PE+I+IGTG ELCLCE +A  LR++G +VRVVSLV W LF+ QP EYK+ +LP +
Sbjct  539   SSGSDPELIIIGTGSELCLCEGAAEKLRSDGFKVRVVSLVSWELFDEQPVEYKDEILPRS  598

Query  328   VRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             V+KR+SVEAGSP+GWREYVG  G V+ ++ FG SG    VFKK+GFT +NV   AR
Sbjct  599   VKKRLSVEAGSPVGWREYVGFHGRVLAVNSFGKSGAYLDVFKKFGFTVDNVESEAR  654



>ref|XP_006436449.1| hypothetical protein CICLE_v10033603mg [Citrus clementina]
 gb|ESR49689.1| hypothetical protein CICLE_v10033603mg [Citrus clementina]
Length=768

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/756 (62%), Positives = 567/756 (75%), Gaps = 84/756 (11%)
 Frame = -3

Query  2404  VLLLRPNPPLLEAKPLFPQNNKRLIALRLVQCRSNPKSKSPVLK--------NTVVSKDE  2249
             + LL   P  +  K +F  NNK       +  +++  S +P+LK        N  ++   
Sbjct  3     ISLLLTKPSSIPTKQIF-SNNK-------LYHKNDTVSVNPILKPCSSLRTDNNNITISN  54

Query  2248  DYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGG  2069
             +++LSW ++L++A+  Q    +++  +D+ FQE+VD+RCVDN+RMLIVD VQ+AKAGH G
Sbjct  55    NHKLSWQKKLEQAFKDQLSDHYDYA-NDNSFQELVDKRCVDNIRMLIVDAVQNAKAGHPG  113

Query  2068  MALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDL  1889
             MALG+AEVG     H M++N + PKWFNRDRFVLSAGHG LLQYVCLHLAGFQSVQ++DL
Sbjct  114   MALGMAEVG-----HAMKYNSRNPKWFNRDRFVLSAGHGCLLQYVCLHLAGFQSVQLEDL  168

Query  1888  KRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDH  1709
             KRLCK+GSRTP HPEN +TEGIEVTTGPLGQGVANAVGLALAE HLA+RFNKPD  IVD+
Sbjct  169   KRLCKMGSRTPSHPENAMTEGIEVTTGPLGQGVANAVGLALAEAHLAARFNKPDAVIVDY  228

Query  1708  RTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEA  1529
             RTYCIMGDGC+MEG+++EAASLAAHWKLNKLTL+YDDNHNTIDG T L +SEDISARF++
Sbjct  229   RTYCIMGDGCAMEGISHEAASLAAHWKLNKLTLIYDDNHNTIDGPTSLVLSEDISARFKS  288

Query  1528  LGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGTFEE  1349
             LGWNTITV+N   ++ + K AL +A  ET+KPTFIRVKT +GKLS KEGTSKAHHG F+E
Sbjct  289   LGWNTITVENIHDNLSSFKEALMAAANETKKPTFIRVKTLVGKLSAKEGTSKAHHGAFDE  348

Query  1348  DDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQ  1169
             ++VK+M++K+ W + R  FHVIPM+YREM++Q + GE LE+EW+SK+Y+Y+++YPQE  +
Sbjct  349   NEVKKMREKVNWVD-RDQFHVIPMVYREMQIQTDHGERLEKEWYSKVYNYRSEYPQEGAE  407

Query  1168  FIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQA  989
                LLNGG++PGWE +LP+W  SDP++ATRGYS KCLN LAKV+PGLIGGSADL SSN+A
Sbjct  408   LDLLLNGGLLPGWENALPKWSTSDPLDATRGYSEKCLNQLAKVLPGLIGGSADLASSNKA  467

Query  988   YLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSI  809
             YL GY DF QPDSP GRNIRYGVREHAMAGISNGIALHGGGLIPFAATFL+FSDYMKNSI
Sbjct  468   YLLGYHDFSQPDSPWGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLIFSDYMKNSI  527

Query  808   RLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKV  629
             RLSALSHAGVIYI+THDSIGLGEDGPTHQPVE LAGLRA+PRLLVFRP DGNETAG+Y V
Sbjct  528   RLSALSHAGVIYILTHDSIGLGEDGPTHQPVEQLAGLRAVPRLLVFRPPDGNETAGSYSV  587

Query  628   AIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLC  449
             AIANRD PS++ALSRQK+AAN +GTSAD V +G    ++   + LP  + +  GW     
Sbjct  588   AIANRDVPSVIALSRQKIAANFEGTSADEVERGQRQPAEYKEKVLPSRV-VKVGW-----  641

Query  448   EESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVG  269
                                          REY                          VG
Sbjct  642   -----------------------------REY--------------------------VG  646

Query  268   DEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              EG VIG++EFGASG     FKKYGFT +NV+K AR
Sbjct  647   VEGKVIGVEEFGASGAYLDTFKKYGFTIDNVTKVAR  682



>ref|XP_006827464.1| hypothetical protein AMTR_s00009p00124530 [Amborella trichopoda]
 gb|ERM94880.1| hypothetical protein AMTR_s00009p00124530 [Amborella trichopoda]
Length=681

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/580 (69%), Positives = 472/580 (81%), Gaps = 1/580 (0%)
 Frame = -3

Query  1900  IDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIP  1721
             I+DLKRLCKLGSRTPGHPE  +T GIEVTTGPLGQGVANAVGLALAE HLA R+NKPD  
Sbjct  99    IEDLKRLCKLGSRTPGHPEKDVTAGIEVTTGPLGQGVANAVGLALAEAHLAGRYNKPDAI  158

Query  1720  IVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISA  1541
             IV+HRTYCIMGDGC+MEG++NEAASLA HWKLNKLTL+YDDNHNTIDG T L  SEDI  
Sbjct  159   IVNHRTYCIMGDGCAMEGISNEAASLAGHWKLNKLTLIYDDNHNTIDGDTSLAFSEDICG  218

Query  1540  RFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG  1361
             RF ALGWNTI VDN   D+ +    L SA  + +KPTF++ KT IG+LS KEGTSKAHHG
Sbjct  219   RFRALGWNTIEVDNIHEDLGSFSRTLLSASKQIEKPTFMKGKTLIGRLSGKEGTSKAHHG  278

Query  1360  TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQ  1181
              F +DDV +M++K+ W + R PFHVIPM+Y+EM+   E GE++E+EW++ L  Y++ YP 
Sbjct  279   IFSDDDVMKMREKVCWKD-RHPFHVIPMVYKEMQSHTEHGESMEREWNATLERYEHDYPM  337

Query  1180  EAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVS  1001
             EA +F  LL G + P WE+SLP+W  S+PV+ATRGYS KCLNHLAKV+PGLIGGSADL S
Sbjct  338   EAAEFKILLTGRLPPNWESSLPKWSESEPVDATRGYSEKCLNHLAKVIPGLIGGSADLAS  397

Query  1000  SNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYM  821
             SN+AYLHG+ DF+QP SP G NI YGVREHAMA ISNG+ALH  GLIPFAATFLVFSDYM
Sbjct  398   SNKAYLHGFDDFKQPASPWGHNICYGVREHAMAAISNGLALHQSGLIPFAATFLVFSDYM  457

Query  820   KNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAG  641
             K +IRLSALS A V+YI+THDSIGLGEDGPTHQPVEHLAGLRAIP+LLVFRP+D NET+G
Sbjct  458   KGAIRLSALSGAHVLYILTHDSIGLGEDGPTHQPVEHLAGLRAIPQLLVFRPADANETSG  517

Query  640   AYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWE  461
             AYK A+  +  P +++LSRQKV+AN+  +  + V KG YI+SDNS  ++PEIIL+GTG E
Sbjct  518   AYKAAMEYQTGPCVISLSRQKVSANLLWSCMEKVSKGWYIVSDNSAVDMPEIILVGTGPE  577

Query  460   LCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWR  281
             L LCEESA  LR EGRRVRVVSLVCWRLF  Q REY+E VLPS+VRKR+S EAGSPLGWR
Sbjct  578   LSLCEESAERLRKEGRRVRVVSLVCWRLFNEQLREYRESVLPSSVRKRMSGEAGSPLGWR  637

Query  280   EYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             EYVG EGVV G+  FGASG     F K+GFT + V++ AR
Sbjct  638   EYVGGEGVVHGVCGFGASGTYLDTFTKFGFTLDKVTRIAR  677



>gb|ACN39962.1| unknown [Picea sitchensis]
Length=751

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/660 (55%), Positives = 473/660 (72%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  92    KSINAIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  151

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  L+LAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  152   HGCMLQYALLYLAGYDSVKEEDLKGFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAV  211

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKPD  IVDH TYCI+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  212   GLALAEKHLAARYNKPDSTIVDHYTYCIVGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  271

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED++ RFE LGW+TI V N     + ++ A+  A +   +PT I+V
Sbjct  272   NHISIDGDTEIAFTEDVTTRFEGLGWHTIWVKNGNTGYDEIRAAIEEAKSVKDRPTLIKV  331

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W +   PFHV   +       A +G
Sbjct  332   TTTIGFGSPNKANSYSVHGSALGAKEVDATRQNLGWPH--PPFHVPEEVKSHWSRHAARG  389

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              + E EW SKL  ++ KYP+EA +F AL++G +  GW+ +LP +    P +ATR  S +C
Sbjct  390   ASFEAEWSSKLAEHEKKYPEEAAEFKALISGKLPEGWDKALPAYTTESPADATRILSQQC  449

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH+M  I NGIA
Sbjct  450   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPAERNVRFGVREHSMGAICNGIA  508

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              HG GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  509   HHGSGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  568

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  ++ G+S +GV KGGY 
Sbjct  569   FRAMPNVLMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PHLAGSSIEGVEKGGYT  627

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             IS N+    P++IL+GTG EL + E++A  LRNEG+ VRVVS VCW LFE Q  EYKE V
Sbjct  628   ISCNASNNKPDVILMGTGSELEIAEKAAVTLRNEGKAVRVVSFVCWELFEEQTPEYKESV  687

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVSVEAGS  GW  Y+G +G  +G+D FGAS P   ++K++G T ENV  TA+
Sbjct  688   LPAAVAARVSVEAGSTFGWERYLGSKGKAVGIDRFGASAPIGILYKEFGLTAENVVATAK  747



>ref|NP_001052335.1| Os04g0266900 [Oryza sativa Japonica Group]
 emb|CAD39964.2| OSJNBa0072D08.7 [Oryza sativa Japonica Group]
 dbj|BAF14249.1| Os04g0266900 [Oryza sativa Japonica Group]
 dbj|BAG91438.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60633.1| hypothetical protein OsJ_14067 [Oryza sativa Japonica Group]
Length=714

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/663 (55%), Positives = 472/663 (71%), Gaps = 5/663 (1%)
 Frame = -3

Query  2146  VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVL  1967
             V  + V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF+L
Sbjct  54    VVEQSVNTIRFLAVDSVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPKNPYWFDRDRFIL  113

Query  1966  SAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVA  1787
             SAGHG +LQY  LHLAG+ SV +DDLK   + GSRTPGHPEN  T G+EVTTGPLGQG A
Sbjct  114   SAGHGCMLQYALLHLAGYDSVTMDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQGFA  173

Query  1786  NAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLL  1607
             NAVGLALAE HLA+RFNKPD+ IVDH TY I+GDGC MEGV+NEA+SLA HW L KL   
Sbjct  174   NAVGLALAEKHLAARFNKPDLKIVDHHTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAF  233

Query  1606  YDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTF  1427
             YDDNH +IDG+T +  +ED  AR+EALGW+TI V N     + ++ A+  A     KPT 
Sbjct  234   YDDNHISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTL  293

Query  1426  IRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA  1250
             I+V T IG  S  +  + + HG+     +V+  K  L W +   PFHV   + R      
Sbjct  294   IKVTTTIGYGSPNKANTYSVHGSALGTKEVEATKNNLSWHH--EPFHVPDEVKRHWSHHI  351

Query  1249  EQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYS  1070
             ++G +LE EW+ K+  Y+ KY QEA +  ++++G +  GW+ SLP++   +P +ATR  S
Sbjct  352   DEGASLEAEWNKKIVEYEKKYRQEAAELKSIISGELPSGWDNSLPKYTPENPADATRNLS  411

Query  1069  GKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISN  890
              +CLN LAK +PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREHAM  ISN
Sbjct  412   QQCLNALAKAIPGFLGGSADLATSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMGAISN  470

Query  889   GIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEH  710
             GIALH  GLIP+ ATF VF+DYM+ +IRLSAL  + VI++MTHDSIGLGEDGPTHQPVE 
Sbjct  471   GIALHSPGLIPYCATFFVFTDYMRAAIRLSALCGSRVIFVMTHDSIGLGEDGPTHQPVEQ  530

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             L  LRA+P +L+ RP+DGNET+GAYK+A+ NR +PS++ALSRQK+   + GTSA+GV KG
Sbjct  531   LFSLRAMPNILMLRPADGNETSGAYKIAVLNRQRPSVLALSRQKL-QQLKGTSAEGVAKG  589

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYIISDNS    P+IILIGTG EL + E++A  LR +G+ VRVVSLVCW LFE Q  +YK
Sbjct  590   GYIISDNSSGNKPDIILIGTGSELEIVEKAADELRKDGKTVRVVSLVCWELFEEQSEKYK  649

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E V PS V  R+SVEAG   GW +Y+G++G  IG+D FG+S P   ++K+ G T ENV  
Sbjct  650   ESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRFGSSAPAGKIYKELGLTVENVIA  709

Query  169   TAR  161
             TA+
Sbjct  710   TAK  712



>dbj|BAJ87979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/665 (55%), Positives = 475/665 (71%), Gaps = 6/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+V+R  V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP    WF+RDRF
Sbjct  46    ELVER-SVNTIRFLAVDAVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPANHAWFDRDRF  104

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHLAG+Q V IDDLK   + GSRTPGHPEN  T+G+EVTTGPLGQG
Sbjct  105   VLSAGHGCMLHYALLHLAGYQGVTIDDLKAFRQWGSRTPGHPENFETDGVEVTTGPLGQG  164

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
              AN+VGLALAE HLA+RFNKPD+ +VDH TY I+GDGC MEGV NEAASLA HW L KL 
Sbjct  165   FANSVGLALAEKHLAARFNKPDLTVVDHYTYVILGDGCQMEGVANEAASLAGHWGLGKLI  224

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+T +  +ED+ AR+EALGW+TI V N     + ++ A+  A     KP
Sbjct  225   AFYDDNHISIDGSTAIAFTEDVLARYEALGWHTIWVQNGNTGYDDIRAAIKEAKEVIDKP  284

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  + ++ + HG+     +V+  ++ L W     PFHV   + R    
Sbjct  285   TLIKVTTTIGYGSPNKASTHSIHGSALGSKEVEATRKNLSW--AHEPFHVPDEVKRHWAH  342

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G +LE EW++K   Y+ KY QEA +  ++++G +  GWE +LP++    P +ATR 
Sbjct  343   HLDEGASLEAEWNAKFAEYEKKYQQEAAELNSIISGRLPAGWEDALPKYTPESPADATRN  402

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q D+P  RNIR+GVREHAM  I
Sbjct  403   LSQQCLNALAKVIPGFLGGSADLASSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMDAI  461

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIA+H  GLIP+ +TF VF+DYM+ SIRLSALS +GVI++MTHDSIGLGEDGPTHQPV
Sbjct  462   CNGIAVHSPGLIPYCSTFFVFTDYMRASIRLSALSESGVIFVMTHDSIGLGEDGPTHQPV  521

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E L  LRA+P +L+ RP+DG ET+ AY++A+ NR +PS++ALSRQK+   ++GTS +GV 
Sbjct  522   EQLFSLRAMPGILMLRPADGTETSAAYRIAVMNRKRPSILALSRQKL-PQLEGTSVEGVA  580

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY+ISDNS    P++ILIGTG EL + E++A  LR EG+ VRVVSLVCW LFE Q  E
Sbjct  581   KGGYVISDNSSGNKPDLILIGTGSELEIAEKAAEQLRKEGKFVRVVSLVCWELFEEQSEE  640

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLPS V  R+S+EAG  LGW +Y+G +G  IG+D FG+S P   ++K++G T +N+
Sbjct  641   YKESVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRFGSSAPAGKIYKEFGLTVDNL  700

Query  175   SKTAR  161
               TA+
Sbjct  701   IATAQ  705



>ref|NP_001056711.1| Os06g0133800 [Oryza sativa Japonica Group]
 dbj|BAF18625.1| Os06g0133800, partial [Oryza sativa Japonica Group]
Length=678

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/661 (55%), Positives = 468/661 (71%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF+LSA
Sbjct  20    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFILSA  79

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ +V  +DLK+  + GS+TPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  80    GHGCMLQYALLHLAGYDAVLEEDLKQFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANA  139

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TYCI+GDGC MEG++NEA SLA HW L KL   YD
Sbjct  140   VGLALAEKHLAARFNKPDSEIVDHYTYCILGDGCQMEGISNEACSLAGHWGLGKLIAFYD  199

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+SARFEALGW+TI V N     + ++ A+  A   T KPT I+
Sbjct  200   DNHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGNDGYDEIRAAIKEAKAVTDKPTLIK  259

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V+  ++ L W     PF V   +         Q
Sbjct  260   VTTTIGFGSPNKANSYSVHGSALGTKEVEATRENLGWP--YEPFFVPEDVKSHWSRHVPQ  317

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G   E +W++K   Y+ KYP++A    ++++G +  GW  +LP++    P +ATR  S +
Sbjct  318   GAAFEADWNAKFAEYEKKYPEDAATLKSIVSGELPAGWADALPKYTPESPADATRNLSQQ  377

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LAKVVPGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  378   CLNALAKVVPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGI  436

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHL 
Sbjct  437   ALHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLV  496

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYK+A+ NR +PS++ALSRQK+ A + GTS +GV KGGY
Sbjct  497   SFRAMPNILMLRPADGNETAGAYKIAVLNRKRPSVLALSRQKL-AQLPGTSIEGVEKGGY  555

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             I+SDNS    P+ I++ TG EL +  ++A  LR EG+ VRVVS VCW LF+ Q  EYKE 
Sbjct  556   IVSDNSTGNKPDFIVMSTGSELEIVAKAADELRKEGKTVRVVSFVCWELFDEQSAEYKES  615

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP  V  RVS+EAGS LGW++YVG +G  IG+D+FGAS P   ++++YG T ENV  TA
Sbjct  616   VLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKFGASAPAGKIYQEYGITAENVIATA  675

Query  163   R  161
             +
Sbjct  676   K  676



>emb|CAH66254.1| OSIGBa0139I12.3 [Oryza sativa Indica Group]
Length=714

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/663 (55%), Positives = 471/663 (71%), Gaps = 5/663 (1%)
 Frame = -3

Query  2146  VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVL  1967
             V  + V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF+L
Sbjct  54    VVEQSVNTIRFLAVDSVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPKNPYWFDRDRFIL  113

Query  1966  SAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVA  1787
             SAGHG +LQY  LHLAG+ SV +DDLK   + GSRTPGHPEN  T G+EVTTGPLGQG A
Sbjct  114   SAGHGCMLQYALLHLAGYDSVTMDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQGFA  173

Query  1786  NAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLL  1607
             NAVGLALAE HLA+RFNKPD+ IVDH TY I+GDGC MEGV+NEA+SLA HW L KL   
Sbjct  174   NAVGLALAEKHLAARFNKPDLKIVDHHTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAF  233

Query  1606  YDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTF  1427
             YDDNH +IDG+T +  +ED  AR+EALGW+TI V N     + ++ A+  A     KPT 
Sbjct  234   YDDNHISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTL  293

Query  1426  IRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA  1250
             I+V T IG  S  +  + + HG+     +V+  K  L W +   PFHV   + R      
Sbjct  294   IKVTTTIGYGSPNKANTYSVHGSALGTKEVEATKNNLSWHH--EPFHVPDEVKRHWSHHI  351

Query  1249  EQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYS  1070
             ++G +LE EW+ K+  Y+ KY QEA +  ++++G +  GW+ SLP++   +P +ATR  S
Sbjct  352   DEGASLEAEWNKKIVEYEKKYRQEAAELKSIISGELPSGWDNSLPKYTPENPADATRNLS  411

Query  1069  GKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISN  890
              +CLN LAK +PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREHAM  ISN
Sbjct  412   QQCLNALAKAIPGFLGGSADLATSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMGAISN  470

Query  889   GIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEH  710
             GIALH  GLIP+ ATF VF+DYM+ +IRLSAL  + VI++MTHDSIGLGEDGPTHQPVE 
Sbjct  471   GIALHSPGLIPYCATFFVFTDYMRAAIRLSALCGSRVIFVMTHDSIGLGEDGPTHQPVEQ  530

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             L  LRA+P +L+ RP+DGNET+GAYK+A+ NR +PS++ALSRQK+   + GTS +GV KG
Sbjct  531   LFSLRAMPNILMLRPADGNETSGAYKIAVLNRQRPSVLALSRQKL-QQLKGTSVEGVAKG  589

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYIISDNS    P+IILIGTG EL + E++A  LR +G+ VRVVSLVCW LFE Q  +YK
Sbjct  590   GYIISDNSSGNKPDIILIGTGSELEIVEKAADELRKDGKTVRVVSLVCWELFEEQSEKYK  649

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E V PS V  R+SVEAG   GW +Y+G++G  IG+D FG+S P   ++K+ G T ENV  
Sbjct  650   ESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRFGSSAPAGKIYKELGLTVENVIA  709

Query  169   TAR  161
             TA+
Sbjct  710   TAK  712



>ref|XP_006652140.1| PREDICTED: transketolase, chloroplastic-like [Oryza brachyantha]
Length=711

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/663 (56%), Positives = 470/663 (71%), Gaps = 5/663 (1%)
 Frame = -3

Query  2146  VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVL  1967
             V  + V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP+ P WF+RDRFVL
Sbjct  51    VVEQSVNTIRFLAVDAVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPKNPYWFDRDRFVL  110

Query  1966  SAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVA  1787
             SAGHG +LQY  LHLAG+ SV +DDLK   + GSRTPGHPEN  T G+EVTTGPLGQG A
Sbjct  111   SAGHGCMLQYALLHLAGYDSVTMDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQGFA  170

Query  1786  NAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLL  1607
             NAVGLALAE HLA+RFNKPD+ I+DH TY I+GDGC MEGV+NEA+SLA HW L KL   
Sbjct  171   NAVGLALAEKHLAARFNKPDLNIIDHYTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAF  230

Query  1606  YDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTF  1427
             YDDNH +IDG+TD+  +ED+ AR+EALGW+TI V N     + ++ A+  A     KPT 
Sbjct  231   YDDNHISIDGSTDIAFTEDVLARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTL  290

Query  1426  IRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA  1250
             I+V T IG  S  +  + + HG+     +V+  +  L W +   PFHV   + R      
Sbjct  291   IKVTTTIGYGSPNKANTYSVHGSALGSKEVEATRNNLSWLH--EPFHVPDEVKRHWSHHI  348

Query  1249  EQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYS  1070
             ++G +LE EW+ K   Y+ KY QEA    ++++G +  GW+ +LP +   +P +ATR  S
Sbjct  349   DEGSSLEAEWNKKFGEYEKKYHQEAADLKSIISGELPSGWDNALPTYTTENPADATRNLS  408

Query  1069  GKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISN  890
              +CLN LAK +PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREHAM  ISN
Sbjct  409   QQCLNALAKAIPGFLGGSADLATSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMGAISN  467

Query  889   GIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEH  710
             GIALH  GLIP+ ATF VF+DYM+ +IRLSAL  +GVI++MTHDSIGLGEDGPTHQPVE 
Sbjct  468   GIALHSPGLIPYCATFFVFTDYMRAAIRLSALCGSGVIFVMTHDSIGLGEDGPTHQPVEQ  527

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             L  LRA+P +L+ RP+DG ET+GAYK+AI NR  PS++ALSRQK+  ++ GTS +GV KG
Sbjct  528   LFSLRAMPNILMLRPADGKETSGAYKIAILNRKMPSVLALSRQKL-QHLKGTSIEGVAKG  586

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYIISDNS    P++ILIGTG EL + E++A  LR EG+ VRVVSLVCW LFE Q  EYK
Sbjct  587   GYIISDNSTGNKPDLILIGTGSELEIVEKAADELRKEGKAVRVVSLVCWELFEEQSEEYK  646

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E VLP  V  R+SVEAG   GW +YVG +G  IG+D FG+S P   ++K+ G T ENV +
Sbjct  647   ESVLPCEVTARISVEAGVTFGWEKYVGQKGKAIGVDRFGSSAPAGKIYKELGLTVENVIE  706

Query  169   TAR  161
             TA+
Sbjct  707   TAK  709



>dbj|BAJ91301.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/665 (55%), Positives = 474/665 (71%), Gaps = 6/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+V+R  V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP    WF+RDRF
Sbjct  46    ELVER-SVNTIRFLAVDAVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPANHAWFDRDRF  104

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHLAG+Q V IDDLK   + GSRTPGHPEN  T+G+EVTTGPLGQG
Sbjct  105   VLSAGHGCMLHYALLHLAGYQGVTIDDLKAFRQWGSRTPGHPENFETDGVEVTTGPLGQG  164

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
              AN+VGLALAE HLA+RFNKPD+ +VDH TY I+GDGC MEGV NEAASLA HW L KL 
Sbjct  165   FANSVGLALAEKHLAARFNKPDLTVVDHYTYVILGDGCQMEGVANEAASLAGHWGLGKLI  224

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+T +  +ED+ AR+EALGW+TI V N     + ++ A+  A     KP
Sbjct  225   AFYDDNHISIDGSTAIAFTEDVLARYEALGWHTIWVQNGNTGYDDIRAAIKEAKEVIDKP  284

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  + ++ + HG+     +V+  ++ L W     PFHV   + R    
Sbjct  285   TLIKVTTTIGYGSPNKASTHSIHGSALGSKEVEATRKNLSW--AHEPFHVPDEVKRHWAH  342

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               + G +LE EW++K   Y+ KY QEA +  ++++G +  GWE +LP++    P +ATR 
Sbjct  343   HLDGGASLEAEWNAKFAEYEKKYQQEAAELNSIISGRLPAGWEDALPKYTPESPADATRN  402

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q D+P  RNIR+GVREHAM  I
Sbjct  403   LSQQCLNALAKVIPGFLGGSADLASSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMDAI  461

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIA+H  GLIP+ +TF VF+DYM+ SIRLSALS +GVI++MTHDSIGLGEDGPTHQPV
Sbjct  462   CNGIAVHSPGLIPYCSTFFVFTDYMRASIRLSALSESGVIFVMTHDSIGLGEDGPTHQPV  521

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E L  LRA+P +L+ RP+DG ET+ AY++A+ NR +PS++ALSRQK+   ++GTS +GV 
Sbjct  522   EQLFSLRAMPGILMLRPADGTETSAAYRIAVMNRKRPSILALSRQKL-PQLEGTSVEGVA  580

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY+ISDNS    P++ILIGTG EL + E++A  LR EG+ VRVVSLVCW LFE Q  E
Sbjct  581   KGGYVISDNSSGNKPDLILIGTGSELEIAEKAAEQLRKEGKFVRVVSLVCWELFEEQSEE  640

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLPS V  R+S+EAG  LGW +Y+G +G  IG+D FG+S P   ++K++G T +N+
Sbjct  641   YKESVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRFGSSAPAGKIYKEFGLTVDNL  700

Query  175   SKTAR  161
               TA+
Sbjct  701   IATAQ  705



>gb|AAO33154.1| putative transketolase [Oryza sativa Japonica Group]
Length=743

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/660 (55%), Positives = 468/660 (71%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF+LSAG
Sbjct  86    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFILSAG  145

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +V  +DLK+  + GS+TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  146   HGCMLQYALLHLAGYDAVLEEDLKQFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAV  205

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TYCI+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  206   GLALAEKHLAARFNKPDSEIVDHYTYCILGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  265

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+SARFEALGW+TI V N     + ++ A+  A   T KPT I+V
Sbjct  266   NHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGNDGYDEIRAAIKEAKAVTDKPTLIKV  325

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  ++ L W     PF V   +         QG
Sbjct  326   TTTIGFGSPNKANSYSVHGSALGTKEVEATRENLGWP--YEPFFVPEDVKSHWSRHVPQG  383

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E +W++K   Y+ KYP++A    ++++G +  GW  +LP++    P +ATR  S +C
Sbjct  384   AAFEADWNAKFAEYEKKYPEDAATLKSIVSGELPAGWADALPKYTPESPADATRNLSQQC  443

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKVVPGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  444   LNALAKVVPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  502

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHL  
Sbjct  503   LHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLVS  562

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYK+A+ NR +PS++ALSRQK+ A + GTS +GV KGGYI
Sbjct  563   FRAMPNILMLRPADGNETAGAYKIAVLNRKRPSVLALSRQKL-AQLPGTSIEGVEKGGYI  621

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P+ I++ TG EL +  ++A  LR EG+ VRVVS VCW LF+ Q  EYKE V
Sbjct  622   VSDNSTGNKPDFIVMSTGSELEIVAKAADELRKEGKTVRVVSFVCWELFDEQSAEYKESV  681

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V  RVS+EAGS LGW++YVG +G  IG+D+FGAS P   ++++YG T ENV  TA+
Sbjct  682   LPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKFGASAPAGKIYQEYGITAENVIATAK  741



>gb|EAY93323.1| hypothetical protein OsI_15126 [Oryza sativa Indica Group]
Length=714

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/663 (55%), Positives = 471/663 (71%), Gaps = 5/663 (1%)
 Frame = -3

Query  2146  VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVL  1967
             V  + V+ +R L VD V+ AK+GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF+L
Sbjct  54    VVEQSVNTIRFLAVDSVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPKNPYWFDRDRFIL  113

Query  1966  SAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVA  1787
             SAGHG +LQY  LHLAG+ SV +DDLK   + GS TPGHPEN  T G+EVTTGPLGQG A
Sbjct  114   SAGHGCMLQYALLHLAGYDSVTMDDLKAFRQWGSITPGHPENFETPGVEVTTGPLGQGFA  173

Query  1786  NAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLL  1607
             NAVGLALAE HLA+RFNKPD+ IVDH TY I+GDGC MEGV+NEA+SLA HW L KL   
Sbjct  174   NAVGLALAEKHLAARFNKPDLKIVDHHTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAF  233

Query  1606  YDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTF  1427
             YDDNH +IDG+T ++ +ED  AR+EALGW+TI V N     + ++ A+  A     KPT 
Sbjct  234   YDDNHISIDGSTGISFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTL  293

Query  1426  IRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA  1250
             I+V T IG  S  +  + + HG+     +V+  K  L W +   PFHV   + R      
Sbjct  294   IKVTTTIGYGSPNKANTYSVHGSALGTKEVEATKNNLSWHH--EPFHVPDEVKRHWSHHI  351

Query  1249  EQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYS  1070
             ++G +LE EW+ K+  Y+ KY QEA +  ++++G +  GW+ SLP++   +P +ATR  S
Sbjct  352   DEGASLEAEWNKKIVEYEKKYRQEAAELKSIISGELPSGWDNSLPKYTPENPADATRNLS  411

Query  1069  GKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISN  890
              +CLN LAK +PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREHAM  ISN
Sbjct  412   QQCLNALAKAIPGFLGGSADLATSNMTLLKMFGDF-QKDTPEERNIRFGVREHAMGAISN  470

Query  889   GIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEH  710
             GIALH  GLIP+ ATF VF+DYM+ +IRLSAL  + VI++MTHDSIGLGEDGPTHQPVE 
Sbjct  471   GIALHSPGLIPYCATFFVFTDYMRAAIRLSALCGSRVIFVMTHDSIGLGEDGPTHQPVEQ  530

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             L  LRA+P +L+ RP+DGNET+GAYK+A+ NR +PS++ALSRQK+   + GTS +GV KG
Sbjct  531   LFSLRAMPNILMLRPADGNETSGAYKIAVLNRQRPSVLALSRQKL-QQLKGTSVEGVAKG  589

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYIISDNS    P+IILIGTG EL + E++A  LR +G+ VRVVSLVCW LFE Q  +YK
Sbjct  590   GYIISDNSSGNKPDIILIGTGSELEIVEKAADELRKDGKTVRVVSLVCWELFEEQSEKYK  649

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E V PS V  R+SVEAG   GW +Y+G++G  IG+D FG+S P   ++K+ G T ENV  
Sbjct  650   ESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRFGSSAPAGKIYKELGLTVENVIA  709

Query  169   TAR  161
             TA+
Sbjct  710   TAK  712



>ref|XP_008813030.1| PREDICTED: transketolase, chloroplastic [Phoenix dactylifera]
Length=746

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/665 (55%), Positives = 469/665 (71%), Gaps = 5/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E +  + ++ +R L VD V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF
Sbjct  84    EALLEKSINTIRFLAVDAVEKANSGHPGLPMGCAPIGHILYDEVMRYNPKNPYWFNRDRF  143

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG
Sbjct  144   VLSAGHGCMLQYALLHLAGYDSVKEEDLKAFRQWGSKTPGHPENFETPGIEVTTGPLGQG  203

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLASRFNKPD+ IVDH TY I+GDGC MEG++NE+ SLA HW L KL 
Sbjct  204   IANAVGLALAERHLASRFNKPDMEIVDHYTYAILGDGCQMEGISNESCSLAGHWGLGKLI  263

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG T++  +ED++ARFEALGW+TI V N     + ++ A+  A     KP
Sbjct  264   AFYDDNHISIDGDTEIAFTEDVNARFEALGWHTIWVKNGNTGYDEIRAAIKEAKAVKDKP  323

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  S + HG+     +V+  +Q L W     PF V   +      
Sbjct  324   TLIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRQNLGWP--YEPFFVPEDVKSHWSR  381

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
              A +G  LE EW++K   Y+ KY ++A +   ++ G +  GWE +LP +    P +ATR 
Sbjct  382   HAREGAALEAEWNAKFVEYEKKYKEDAAELKQIITGDLPAGWEKALPTYTPESPADATRN  441

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I
Sbjct  442   LSQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAI  500

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+
Sbjct  501   CNGIALHSPGLIPYCATFFVFTDYMRPAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPI  560

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EHL   RA+P +L+ RP+DGNETAGAYKVAI N  +PS++ALSRQK+   + GTSA+GV 
Sbjct  561   EHLISFRAMPNILMLRPADGNETAGAYKVAILNSKRPSILALSRQKL-PQLAGTSAEGVE  619

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYIISDNS    P++I++ TG EL +  ++A  LR EG+ VRVVSLVCW LF+ Q  E
Sbjct  620   KGGYIISDNSSGNKPDLIVMSTGSELEIAAKAADELRKEGKTVRVVSLVCWELFDEQSNE  679

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE +LP++V  RVS+EAG+ LGW +++G +G  IG+D FGAS P   ++K++G T E V
Sbjct  680   YKESILPASVTARVSIEAGATLGWEKFLGTKGKAIGIDRFGASAPAGRIYKEFGLTAEKV  739

Query  175   SKTAR  161
              + A+
Sbjct  740   IEAAK  744



>ref|XP_004970575.1| PREDICTED: transketolase, chloroplastic-like [Setaria italica]
Length=719

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/660 (55%), Positives = 468/660 (71%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L VD V+ A++GH G+ +G A +G+ L+   +RFNP+ P WF+RDRFVLSAG
Sbjct  62    QSVNTIRFLAVDAVEKAQSGHPGLPMGCAPLGHVLFDEFLRFNPKNPAWFDRDRFVLSAG  121

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV +DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG ANAV
Sbjct  122   HGCMLQYALLHLAGYDSVTMDDLKAFRQWRSRTPGHPENFETPGVEVTTGPLGQGFANAV  181

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNK D+ IVDH TY I+GDGC MEGV+NEAASLA HW L KL   YDD
Sbjct  182   GLALAEKHLAARFNKTDLNIVDHYTYVILGDGCQMEGVSNEAASLAGHWGLGKLIAFYDD  241

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG TD+  +E++SAR+EALGW+TI V N     + ++ A+  A     KPT I+V
Sbjct  242   NHISIDGNTDIAFTENVSARYEALGWHTIWVKNGNTGYDDIRAAIKEAKRVKDKPTLIKV  301

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  + + HG+     +V+  +  L+W +   PFHV   + R      ++G
Sbjct  302   TTTIGFGSPNKANTYSVHGSALGSKEVEATRSNLQWFH--EPFHVPDEVKRHWSHHIDEG  359

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              +LE EW++K   Y+ KY QEA +  ++++G +   W+ +LP +      +ATR  S +C
Sbjct  360   ASLEAEWNAKFAEYEKKYHQEAAELKSIISGELPSRWDNALPTYTPESSPDATRNLSQQC  419

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREH M  ISNGIA
Sbjct  420   LNSLAKVIPGFLGGSADLATSNMTLLKMFGDF-QRDTPEERNIRFGVREHGMGAISNGIA  478

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             +H  GLIP+ ATF VF+DYM+ +IRLSALS +GVI++MTHDSIGLGEDGPTHQPVE L  
Sbjct  479   VHSPGLIPYCATFFVFTDYMRAAIRLSALSESGVIFVMTHDSIGLGEDGPTHQPVEQLFS  538

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
             LRA+P +L+ RP+DGNET+GAYKVA+ NR +PS++ALSRQK+   + GTS D V KGGYI
Sbjct  539   LRAMPNILMLRPADGNETSGAYKVAVLNRKRPSVIALSRQKL-PQLKGTSVDSVSKGGYI  597

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS +  P++I+IGTG EL + E++A  LR EGR VRVVSLVCW LFE QP +YKE V
Sbjct  598   ISDNSSDNKPDLIVIGTGSELEIAEKAADELRKEGRTVRVVSLVCWELFEEQPEKYKESV  657

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  R+S+EAG   GW +Y+G +G  IG+D FG S P   +FK+ G T ENV   A+
Sbjct  658   LPSEVTSRISIEAGVTFGWEKYIGQKGKAIGIDSFGISAPAGKIFKELGLTVENVIAAAK  717



>gb|EYU31980.1| hypothetical protein MIMGU_mgv1a001876mg [Erythranthe guttata]
Length=745

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/672 (54%), Positives = 471/672 (70%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K  + +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P 
Sbjct  75    ETLEKTTDALVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPY  134

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  135   WFNRDRFVLSAGHGCMLQYALLHLAGYDAVKEEDLKSFRQWGSKTPGHPENFETPGVEVT  194

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TYCI+GDGC MEG++NEA SLA H
Sbjct  195   TGPLGQGIANAVGLALAESHLAARYNKPDSKIVDHYTYCILGDGCQMEGISNEACSLAGH  254

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +E++  RFEALGW+ I V N     + +++A+  A
Sbjct  255   WGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRDAIKEA  314

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              + T KPT I+V T IG  S  +  S + HG      +V+  ++ L W     PFHV   
Sbjct  315   KSVTDKPTLIKVTTTIGFGSPNKANSYSVHGAALGTKEVEATRENLGWP--YEPFHVPDE  372

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G   E EW+SK   Y+ KYP+EA +  +++ G +  GWE +LP++    
Sbjct  373   VKKHWSRHTPEGAAYESEWNSKFAEYEKKYPEEAAELKSIITGELPSGWEKALPKYTPET  432

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S   LN LAKV+PGLIGGSADL SSN   L  +GD+ Q  +P  RN+R+GVR
Sbjct  433   PGDATRNLSQTNLNALAKVLPGLIGGSADLASSNMTLLKMFGDY-QKKTPEERNVRFGVR  491

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH+M  I NGIALH  G IP+ ATF VF+DYM++++R+SALS AGVIY+MTHDSIGLGED
Sbjct  492   EHSMGAICNGIALHSPGFIPYCATFFVFTDYMRSAMRISALSEAGVIYVMTHDSIGLGED  551

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAG YKVA+ NR +PS++ALSRQK+  N+ G
Sbjct  552   GPTHQPIEHLASFRAMPNILMLRPADGNETAGCYKVAVDNRKRPSVLALSRQKL-PNLAG  610

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGY ISDNS +  P++ILIGTG EL +  ++A  LR EG++VRVVS V W L
Sbjct  611   TSIEGVEKGGYTISDNSSDNKPDVILIGTGSELEIAAKAADELRKEGKKVRVVSFVSWEL  670

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             FE Q  EYKE VLPS V  RVS+EAG+  GW + VG +G  IG+D+FGAS P   ++K+Y
Sbjct  671   FEDQSAEYKESVLPSAVTARVSIEAGTTFGWHKIVGSKGKAIGIDKFGASAPAGKIYKEY  730

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  731   GITAEAVIAAAK  742



>ref|XP_004248560.1| PREDICTED: transketolase, chloroplastic [Solanum lycopersicum]
Length=741

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/707 (52%), Positives = 479/707 (68%), Gaps = 8/707 (1%)
 Frame = -3

Query  2278  LKNTVVSKDEDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDC  2099
             LK+T  +      L      K+ +  +A SA E  E  D     +  + V+ +R L +D 
Sbjct  39    LKSTPFTSSHRRILPSTTVTKQHFSVRASSAVETLEKTDA---AIVEKSVNTIRFLAIDA  95

Query  2098  VQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLA  1919
             V+ A +GH G+ +G A +G+ LY  VM++NP+ P WFNRDRFVLSAGHG +LQY  LHLA
Sbjct  96    VEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLA  155

Query  1918  GFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRF  1739
             G+ SVQ DDLK   + GS+ PGHPEN  T G+EVTTGPLGQG+ANAVGLA+AE HLA+RF
Sbjct  156   GYDSVQEDDLKSFRQWGSKIPGHPENFETPGVEVTTGPLGQGIANAVGLAVAEKHLAARF  215

Query  1738  NKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTV  1559
             NKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL   YDDNH +IDG T++  
Sbjct  216   NKPDAEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAF  275

Query  1558  SEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGT  1379
             +ED+SARFEALGW+ I V N     + ++ A+  A +   KPT I+V T IG  S  +  
Sbjct  276   TEDVSARFEALGWHVIWVKNGNTGYDEIRAAIKEAKSVKDKPTMIKVTTTIGFGSPNKAN  335

Query  1378  SKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYS  1202
             S + HG+     +V+  +  L W     PFHV   +         +G  LE EW++K   
Sbjct  336   SYSVHGSALGAKEVEATRNNLGWP--YEPFHVPEDVKSHWSRHTPEGAALETEWNAKFAE  393

Query  1201  YQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIG  1022
             Y+ KY +EA    +++ G +  GWE +LP +    P +ATR  S + LN LAKVVPG +G
Sbjct  394   YEKKYAEEAADLKSIITGELPAGWEKALPTYTPESPADATRNLSQQNLNALAKVVPGFLG  453

Query  1021  GSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATF  842
             GSADL SSN   L  +GDF Q ++P  RN+R+GVREH M  I NGIALH  GLIP+ ATF
Sbjct  454   GSADLASSNMTLLKMFGDF-QKNTPEERNLRFGVREHGMGAICNGIALHSLGLIPYCATF  512

Query  841   LVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPS  662
              VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+FRP+
Sbjct  513   FVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMFRPA  572

Query  661   DGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEII  482
             DGNETAGAYKVA+  R  PS++ALSRQK+   + GTS +G  KGGYI+SDNS    P++I
Sbjct  573   DGNETAGAYKVAVLKRKTPSILALSRQKL-PQLAGTSIEGAAKGGYIVSDNSSGNKPDVI  631

Query  481   LIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEA  302
             LIGTG EL +  ++A  L+ EG+ VRVVS VCW L++ Q  EYKE VLPS+V  RVS+EA
Sbjct  632   LIGTGSELEIAVKAAEELKKEGKTVRVVSFVCWELYDEQSAEYKESVLPSSVTARVSIEA  691

Query  301   GSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             GS  GW+++VGD+G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  692   GSTFGWQKFVGDKGKAIGVDGFGASAPADKIYKEFGITAEAVVAAAK  738



>dbj|BAJ93658.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=679

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/665 (55%), Positives = 467/665 (70%), Gaps = 6/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E++D+  V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF
Sbjct  18    ELLDK-SVNAIRFLAIDAVEKAVSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRF  76

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHLAG+ +V+ +DLK+  + GS TPGHPEN  T G+EVTTGPLGQG
Sbjct  77    VLSAGHGCMLQYALLHLAGYDAVKEEDLKQFRQWGSSTPGHPENFETPGVEVTTGPLGQG  136

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  IVDH TYCI+GDGC+MEG+  EA SLA HW L KL 
Sbjct  137   IANAVGLALAEKHLAARFNKPDSEIVDHYTYCIVGDGCNMEGILTEACSLAGHWGLGKLI  196

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
             + YDDNH +IDG T++  +ED+S RFEALGW+T+ V N     + ++ A+  A + T KP
Sbjct  197   VFYDDNHISIDGDTEIAFTEDVSGRFEALGWHTLWVKNGNDGYDEIRKAIQEAKSVTDKP  256

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  S A HG      +V+  +  L W     PF V   +      
Sbjct  257   TMIKVTTTIGFGSPNKANSYAVHGAALGTSEVEATRANLGWP--YEPFFVPEDVKSHWSR  314

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                QG  LE +W +K   Y+ KYP++A    +++ G +  GW  +LP++    P +ATR 
Sbjct  315   HIPQGAALEADWDAKFAQYEQKYPEDAATLKSIITGELPAGWADALPQYTTESPADATRN  374

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKVVPGLIGGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I
Sbjct  375   LSQQCLNALAKVVPGLIGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAI  433

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+
Sbjct  434   CNGIALHTPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPI  493

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EHL   RA+P +L+FRP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV 
Sbjct  494   EHLVSFRAMPNMLMFRPADGKETAGAYKVAVLNRKRPSILALSRQKL-PHLPGTSIEGVA  552

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY ISDNS    P+ I++ TG E+ +  ++A  L  EG+ VRVVS VCW LF+ Q  E
Sbjct  553   KGGYTISDNSSGNKPDYIIMSTGSEVEIAVKAAEELTKEGKTVRVVSFVCWELFDEQSDE  612

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++K+YG T ENV
Sbjct  613   YKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKFGASAPAPKIYKEYGITAENV  672

Query  175   SKTAR  161
                A+
Sbjct  673   IAAAK  677



>ref|XP_006656605.1| PREDICTED: transketolase, chloroplastic-like, partial [Oryza 
brachyantha]
Length=674

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/661 (54%), Positives = 466/661 (70%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF+LSA
Sbjct  16    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFILSA  75

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ +V  DDLK+  + GSRTPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  76    GHGCMLQYALLHLAGYDAVMEDDLKQFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANA  135

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TYCI+GDGC MEG++NEA SLA HW L KL   YD
Sbjct  136   VGLALAEKHLAARFNKPDSEIVDHYTYCILGDGCQMEGISNEACSLAGHWGLGKLIAFYD  195

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+SARFEALGW+TI V N     + ++ A+  A   + KPT I+
Sbjct  196   DNHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGNTGYDEIRAAIKEAKAVSDKPTLIK  255

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V+  ++ L W     PF V   +         Q
Sbjct  256   VTTTIGFGSPNKANSYSVHGSALGTKEVEATRENLGWP--YEPFFVPEDVKSHWSRHVSQ  313

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G + E +W++K   Y+ KYP++A    ++++G +  GW  +LP++      +ATR  S +
Sbjct  314   GASFEADWNAKFAEYEKKYPEDAATLKSIVSGELPTGWADALPKYTTESAADATRNLSQQ  373

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LAKVVPGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  374   CLNALAKVVPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGI  432

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHL 
Sbjct  433   ALHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLV  492

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYK+A+ NR +PS++ALSRQK+   + GTS +GV KGGY
Sbjct  493   SFRAMPNILMLRPADGNETAGAYKIAVLNRKRPSVLALSRQKL-PQLPGTSIEGVEKGGY  551

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              ISDNS    P++I++ TG EL +  ++A  LR EG+ VRVVS VCW LF+ Q  EYKE 
Sbjct  552   TISDNSTGNKPDLIVMSTGSELEIAAKAADELRKEGKTVRVVSFVCWELFDEQSDEYKES  611

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP  V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++++YG + E++   A
Sbjct  612   VLPEAVTGRISIEAGSTLGWQKYVGSKGKAIGIDKFGASAPAGKIYQEYGISVESIIAAA  671

Query  163   R  161
             +
Sbjct  672   K  672



>ref|XP_006844816.1| hypothetical protein AMTR_s00058p00047610 [Amborella trichopoda]
 gb|ERN06491.1| hypothetical protein AMTR_s00058p00047610 [Amborella trichopoda]
Length=701

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/660 (55%), Positives = 462/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  43    KSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  102

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  103   HGCMLQYALLHLAGYDSVKEEDLKSFRQWGSKTPGHPENFETRGIEVTTGPLGQGIANAV  162

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKP   +VDH TYCI+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  163   GLALAEKHLAARYNKPGFEVVDHYTYCILGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  222

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  223   NHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIEEAKAVKDKPTLIKV  282

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W     PFHV   +         +G
Sbjct  283   TTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPDDVKSHWSRHVPEG  340

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              +LE EW +KL  Y+ KY +EA +F  L++G    GWE +LP +    P +ATR  S +C
Sbjct  341   ASLEAEWQAKLADYEKKYKEEAAEFKELISGKWPDGWEKALPAYTPESPADATRNLSQQC  400

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREHAM  I NGIA
Sbjct  401   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEQRNVRFGVREHAMGSICNGIA  459

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LHG GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  460   LHGSGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  519

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP DGNETAGAYKVAI NR +PS++ALSRQK+   + GT+ +GV KGGYI
Sbjct  520   FRAMPNILMLRPGDGNETAGAYKVAILNRKRPSVLALSRQKL-PQLAGTTIEGVEKGGYI  578

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P++ILIGTG EL +  ++A V+R EG+ VRVVSLV W LF+ Q  EYKE V
Sbjct  579   VSDNSMRNKPDLILIGTGSELEIAVKAANVIRKEGKAVRVVSLVSWELFDEQSDEYKESV  638

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVSVEAGS  GW + VG +G  IG+D FGAS P   ++K++G T +NV   A+
Sbjct  639   LPAGVSARVSVEAGSTFGWEKIVGSKGKSIGIDRFGASAPAGTLYKEFGITMDNVIAAAK  698



>ref|XP_003557240.1| PREDICTED: transketolase, chloroplastic [Brachypodium distachyon]
Length=741

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/660 (55%), Positives = 465/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  84    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  143

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +V+  DLK+  + GS TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  144   HGCMLQYALLHLAGYDAVKEADLKQFRQWGSSTPGHPENFETPGVEVTTGPLGQGIANAV  203

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TYCI+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  204   GLALAEKHLAARFNKPDSEIVDHYTYCIVGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  263

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+S RFEALGW+TI V N     + ++ A+  A + T KPT I+V
Sbjct  264   NHISIDGDTEIAFTEDVSTRFEALGWHTIWVKNGNDGYDEIRKAIQEAKSVTDKPTLIKV  323

Query  1417  KTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG     ++V+  +Q L W     PF V   +         +G
Sbjct  324   TTTIGFGSPNKANSYSVHGAALGTNEVEATRQNLGWP--YEPFFVPEDVKSHWSRHVPEG  381

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE +W+SK   Y+ KYP++A    +++ G +  GW  +LP++    P +ATR  S +C
Sbjct  382   AALEADWNSKFAQYEKKYPEDAAALKSIITGELPAGWADALPQYTTESPADATRNLSQQC  441

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKVVPGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI 
Sbjct  442   LNALAKVVPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIG  500

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  501   LHTPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  560

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+FRP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV KGGY 
Sbjct  561   FRAMPNMLMFRPADGKETAGAYKVAVLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGYT  619

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P+ I++ TG EL +  ++A  L  EG+ VRVVS VCW LF+ Q  EYKE V
Sbjct  620   ISDNSTGNKPDFIIMSTGSELEIAVKAAEELTKEGKTVRVVSFVCWELFDDQSDEYKESV  679

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++K+YG T E+V   A+
Sbjct  680   LPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKFGASAPAGIIYKEYGITAESVIAAAK  739



>gb|KDO85798.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
 gb|KDO85799.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=748

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/691 (54%), Positives = 469/691 (68%), Gaps = 8/691 (1%)
 Frame = -3

Query  2230  LEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLA  2051
             L   + + P +A +    E   D     +  + V+ +R L VD V+ A +GH G+ +G A
Sbjct  62    LSTSQASLPIRAAAVETLETSTDA---ALVEKSVNTIRFLAVDAVEKANSGHPGLPMGCA  118

Query  2050  EVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKL  1871
              +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ DDLK   + 
Sbjct  119   PMGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEDDLKNFRQW  178

Query  1870  GSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIM  1691
             GS+TPGHPEN  T GIEVTTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+
Sbjct  179   GSKTPGHPENFETPGIEVTTGPLGQGMANAVGLALAEKHLAARYNKPDNEIVDHYTYVIL  238

Query  1690  GDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTI  1511
             GDGC MEG+ NEA+SLA H  L KL   YDDNH +IDG T++  +E++  RFE LGW+ I
Sbjct  239   GDGCQMEGIANEASSLAGHLGLGKLIAFYDDNHISIDGDTEIAFTENVDKRFEGLGWHVI  298

Query  1510  TVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQ  1334
              V N     + ++ A+  A   T KPT IRV T IG  S  +  S + HG+     +V  
Sbjct  299   WVKNGNTGYDDIRAAIKEAKAVTDKPTLIRVTTTIGFGSPNKANSYSVHGSALGAKEVDA  358

Query  1333  MKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALL  1154
              ++ L W     PFHV   + +       +G TLE EW++K   Y+ KYP+EA +F ++ 
Sbjct  359   TRKNLGWP--YEPFHVPEDVKKHWSRHVAEGATLEAEWNAKFAEYEKKYPEEAAEFKSIS  416

Query  1153  NGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGY  974
             +G +  GWE +LP +    P EATR  S  CLN LAK +PGL+GGSADL SSN   L  +
Sbjct  417   SGQLPAGWEKALPTYTPESPAEATRNLSQTCLNALAKTLPGLLGGSADLASSNMTLLKMF  476

Query  973   GDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSAL  794
             GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL
Sbjct  477   GDF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISAL  535

Query  793   SHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANR  614
               AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ANR
Sbjct  536   CEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVANR  595

Query  613   DKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAG  434
              +PS++ALSRQK+  ++ GTS DGV KG YIISDNS    P++ILIGTG EL +  ++A 
Sbjct  596   KRPSILALSRQKL-PHLAGTSIDGVEKGAYIISDNSSGNKPDVILIGTGSELEIAAKAAE  654

Query  433   VLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVV  254
              LR  G+ VRVVS V W LF+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  
Sbjct  655   ELRKGGKAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKA  714

Query  253   IGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             IG+D FGAS P   ++K++G T E V   A+
Sbjct  715   IGIDRFGASAPAGKIYKEFGITAEAVITAAK  745



>ref|XP_002446209.1| hypothetical protein SORBIDRAFT_06g004280 [Sorghum bicolor]
 gb|EES10537.1| hypothetical protein SORBIDRAFT_06g004280 [Sorghum bicolor]
Length=726

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/664 (55%), Positives = 468/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+V++  V+ +R L VD V+ A++GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF
Sbjct  65    ELVEQ-SVNTIRFLAVDAVEKAQSGHPGLPMGCAPLGHVLFDEFLRFNPKNPAWFDRDRF  123

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHLAG+ +V++DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG
Sbjct  124   VLSAGHGCMLQYALLHLAGYDAVKMDDLKAFRQWRSRTPGHPENFETPGVEVTTGPLGQG  183

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
              ANAVGLALAE HLASRFNK D+ IVDH TY I+GDGC MEGV+NEAASLA HW L KL 
Sbjct  184   FANAVGLALAEKHLASRFNKTDMKIVDHYTYVILGDGCQMEGVSNEAASLAGHWGLGKLI  243

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG TD+  +ED+ AR+EALGW+TI V N     + ++ A+  A     KP
Sbjct  244   AFYDDNHISIDGNTDIAFTEDVLARYEALGWHTIWVKNGNTGYDDIRAAIKEAKGVKDKP  303

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  + + HGT     +V+  +  L W +   PFHV   + R    
Sbjct  304   TLIKVTTTIGFGSPNKANTYSVHGTALGSKEVEATRSNLGWLH--EPFHVPDEVKRHWSH  361

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               + G +LE EW+++   Y  KY QEA +  ++++G +  GW+ +LP +      +ATR 
Sbjct  362   HIDDGASLEAEWNARFVEYDKKYHQEAAELKSIISGELPSGWDNALPTYAPEISPDATRN  421

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL +SN   L  +GDF Q D+P  RNIR+GVREH M  I
Sbjct  422   LSQQCLNALAKVIPGFLGGSADLATSNMTLLKMFGDF-QRDTPEERNIRFGVREHGMGAI  480

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
             SNGIA+H  GLIP+ ATF VF+DYM+ SIRLSALS +GVI++MTHDSIGLGEDGPTHQPV
Sbjct  481   SNGIAVHSPGLIPYCATFFVFTDYMRASIRLSALSESGVIFVMTHDSIGLGEDGPTHQPV  540

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E L  LRA+P +L+ RP+DGNET+GAYK+A+ NR +PS++ALSRQK+   + GTS D V 
Sbjct  541   EQLFSLRAMPNILMLRPADGNETSGAYKIAVLNRKRPSIIALSRQKL-PQVKGTSVDAVS  599

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYIISDNS    P+ ILIGTG EL + E +AG LRN+GR VRVVSLVCW LFE QP E
Sbjct  600   KGGYIISDNSSGNKPDFILIGTGSELEIAENAAGELRNKGRTVRVVSLVCWELFEEQPEE  659

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP+ V  R+S+EAG   GW +Y+G +G  IG+D FG S P   ++++ G T ENV
Sbjct  660   YKESVLPNEVTSRISIEAGVTFGWEKYIGQKGKAIGIDRFGVSAPAGKIYEELGLTVENV  719

Query  175   SKTA  164
                A
Sbjct  720   IAAA  723



>ref|XP_008669591.1| PREDICTED: LOW QUALITY PROTEIN: transketolase, chloroplastic-like 
[Zea mays]
Length=724

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/664 (55%), Positives = 467/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+V++  V+ +R L VD V+ A +GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF
Sbjct  63    ELVEQX-VNTIRFLAVDAVEKAHSGHPGLPMGCAPLGHVLFDEFLRFNPKNPAWFDRDRF  121

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG ++QY  LHLAG+  V++DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG
Sbjct  122   VLSAGHGCMIQYALLHLAGYNGVKMDDLKTFRQWRSRTPGHPENFETPGVEVTTGPLGQG  181

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
              ANAVGLALAE HLASRFNK D+ +VDH TY I+GDGC MEGV+NEAASLA HW L KL 
Sbjct  182   FANAVGLALAEKHLASRFNKTDMKVVDHYTYVILGDGCQMEGVSNEAASLAGHWGLGKLI  241

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG TD+  +ED+ AR+EALGW+TI V N     + ++ A+N A     KP
Sbjct  242   AFYDDNHISIDGNTDIAFTEDVLARYEALGWHTIWVKNGNTGYDDIRTAINEAKGVKDKP  301

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T   H       +V+  +  L W +   PFHV   + R    
Sbjct  302   TLIKVTTTIGFGSPNKANTYSVHGNALGSKEVEATRSNLGWFH--EPFHVPDEVKRHWSR  359

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G +LE EW+++   Y+ KY QEA +  ++++G +  GWE +L  +      +ATR 
Sbjct  360   HIDEGASLEAEWNARFVEYEKKYNQEAAELKSIISGELASGWENALRNYTPEMSPDATRN  419

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGS+DL +SN   L  +GDF Q D+P  RNIR+GVREHAM  I
Sbjct  420   LSQQCLNALAKVIPGFLGGSSDLATSNMTLLKKFGDF-QRDTPEERNIRFGVREHAMGAI  478

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
             SNGIA+H  GLIP+ ATF VF+DYM+ SIRLSALS +GVI++MTHDS+GLGEDGPTHQPV
Sbjct  479   SNGIAVHSPGLIPYCATFFVFTDYMRASIRLSALSESGVIFVMTHDSVGLGEDGPTHQPV  538

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EHL  LRA+P +L+ RP+DGNET+GAYK+A+ NR +PS++ALSRQK+   + GTS D V 
Sbjct  539   EHLFSLRAMPNILMLRPADGNETSGAYKIAVLNRKRPSVIALSRQKL-PQLRGTSVDAVS  597

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYI+SD+S    P+ ILIGTG EL + E +AG LR +GR VRVVSLVCW LFE QP E
Sbjct  598   KGGYIVSDDSSGNKPDFILIGTGSELEIAENAAGELRKKGRTVRVVSLVCWELFEEQPEE  657

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLPS V  R+S+EAG   GW +Y+G +G  IG+D FGAS P   ++K+ G T E+V
Sbjct  658   YKESVLPSEVTSRISIEAGVTFGWEKYIGQKGKAIGIDRFGASAPAGKIYKELGLTVEHV  717

Query  175   SKTA  164
                A
Sbjct  718   IAAA  721



>ref|XP_006445277.1| hypothetical protein CICLE_v10018991mg [Citrus clementina]
 ref|XP_006490909.1| PREDICTED: transketolase-2, chloroplastic-like [Citrus sinensis]
 gb|ESR58517.1| hypothetical protein CICLE_v10018991mg [Citrus clementina]
Length=748

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/660 (55%), Positives = 459/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L VD V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  90    KSVNTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  149

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SVQ DDLK   + GS+TPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  150   HGCMLQYALLHLAGYDSVQEDDLKNFRQWGSKTPGHPENFETPGIEVTTGPLGQGMANAV  209

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG+ NEA+SLA H  L KL   YDD
Sbjct  210   GLALAEKHLAARYNKPDNDIVDHYTYVILGDGCQMEGIANEASSLAGHLGLGKLIAFYDD  269

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFE LGW+ I V N     + ++ A+  A   T KPT IRV
Sbjct  270   NHISIDGDTEIAFTENVDKRFEGLGWHVIWVKNGNTGYDDIRAAIKEAKAVTDKPTLIRV  329

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   + +       +G
Sbjct  330   TTTIGFGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPEDVKKHWSRHVAEG  387

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              TLE EW++K   Y+ KYP+EA +F ++ +G +  GWE +LP +    P EATR  S  C
Sbjct  388   ATLEAEWNAKFAEYEKKYPEEAAEFKSISSGQLPAGWEKALPTYTPESPAEATRNLSQTC  447

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAK +PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  448   LNALAKTLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  506

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  507   LHSPGLIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  566

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ANR +PS++ALSRQK+  ++ GTS DGV KG YI
Sbjct  567   FRAMPNILMLRPADGNETAGAYKVAVANRKRPSILALSRQKL-PHLAGTSIDGVEKGAYI  625

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR  G+ VRVVS V W LF+ Q   YKE V
Sbjct  626   ISDNSSGNKPDVILIGTGSELEIAAKAAEELRKGGKAVRVVSFVSWELFDEQSDAYKESV  685

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  686   LPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVITAAK  745



>ref|NP_001275202.1| transketolase, chloroplastic [Solanum tuberosum]
 sp|Q43848.1|TKTC_SOLTU RecName: Full=Transketolase, chloroplastic; Short=TK; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA90427.1| transketolase precursor [Solanum tuberosum]
Length=741

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/707 (52%), Positives = 477/707 (67%), Gaps = 8/707 (1%)
 Frame = -3

Query  2278  LKNTVVSKDEDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDC  2099
             LK+T  +      L      K+ +  +A +A E  E  D     +  + V+ +R L +D 
Sbjct  39    LKSTPFTSSHRRILPSTTVTKQQFSVRASAAVETLEKTDA---AIVEKSVNTIRFLAIDA  95

Query  2098  VQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLA  1919
             V+ A +GH G+ +G A +G+ LY  VM++NP+ P WFNRDRFVLSAGHG +LQY  LHLA
Sbjct  96    VEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLA  155

Query  1918  GFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRF  1739
             G+ SVQ DDLK   + GSR PGHPEN  T G+EVTTGPLGQG+ANAVGLA+AE HLA+RF
Sbjct  156   GYDSVQEDDLKSFRQWGSRIPGHPENFETPGVEVTTGPLGQGIANAVGLAVAEKHLAARF  215

Query  1738  NKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTV  1559
             NKPD  IVDH TY I+GDGC MEG++NE  SLA HW L KL   YDDNH +IDG T++  
Sbjct  216   NKPDAEIVDHYTYVILGDGCQMEGISNEVCSLAGHWGLGKLIAFYDDNHISIDGDTEIAF  275

Query  1558  SEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGT  1379
             +ED+SARFE+LGW+ I V N     + ++ A+  A     KPT I+V T IG  S  +  
Sbjct  276   TEDVSARFESLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTMIKVTTTIGFGSPNKAN  335

Query  1378  SKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYS  1202
             S + HG+     +V+  +  L W     PFHV   +         +G  LE EW++K   
Sbjct  336   SYSVHGSGLGAKEVEATRNNLGWP--YEPFHVPEDVKSHWSRHTPEGAALETEWNAKFAE  393

Query  1201  YQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIG  1022
             Y+ KY +EA    +++ G +  GWE +LP +    P +ATR  S + LN LAKV+PG +G
Sbjct  394   YEKKYAEEAADLKSIITGELPAGWEKALPTYTPESPADATRNLSQQNLNALAKVLPGFLG  453

Query  1021  GSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATF  842
             GSADL SSN   L  +GDF Q ++P  RN+R+GVREH M  I NGIALH  GLIP+ ATF
Sbjct  454   GSADLASSNMTLLKMFGDF-QKNTPEERNLRFGVREHGMGAICNGIALHSLGLIPYCATF  512

Query  841   LVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPS  662
              VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+FRP+
Sbjct  513   FVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMFRPA  572

Query  661   DGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEII  482
             DGNETAGAYKVA+  R  PS++ALSRQK+   + GTS +G  KGGYI+SDNS    P++I
Sbjct  573   DGNETAGAYKVAVLKRKTPSILALSRQKL-PQLAGTSIEGAAKGGYIVSDNSSGNKPDVI  631

Query  481   LIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEA  302
             LIGTG EL +  ++A  L+ EG+ VRVVS VCW L++ Q  EYKE VLPS+V  RVS+EA
Sbjct  632   LIGTGSELEIAVKAAEELKKEGKTVRVVSFVCWELYDEQSAEYKESVLPSSVTARVSIEA  691

Query  301   GSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             GS  GW+++VGD+G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  692   GSTFGWQKFVGDKGKAIGIDGFGASAPADKIYKEFGITAEAVVAAAK  738



>ref|XP_004964445.1| PREDICTED: transketolase, chloroplastic-like [Setaria italica]
Length=743

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/660 (55%), Positives = 466/660 (71%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  86    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  145

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK+  + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  146   HGCMLQYALLHLAGYDSVKEEDLKQFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  205

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  206   GLALAEKHLAARFNKPDSEIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  265

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+S RFEALGW+TI V N     + ++ A+  A   T KPT I+V
Sbjct  266   NHISIDGDTEIAFTEDVSTRFEALGWHTIWVKNGNTGYDDIRAAIKEAKAVTDKPTLIKV  325

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  +Q L W      F V   +         +G
Sbjct  326   TTTIGFGSPNKSNSYSVHGSALGTKEVEATRQNLGWP--YEAFFVPEDVKSHWSRHTPEG  383

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE +W++K   Y+ KYP++A    +++ G +  GW  +LP++    P +ATR  S +C
Sbjct  384   AALEADWNAKFAEYEKKYPEDAATLKSIITGELPTGWADALPKYTPEIPGDATRNLSQQC  443

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKVVPGLIGGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  444   LNALAKVVPGLIGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  502

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G +P+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL  
Sbjct  503   LHSPGFVPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLVS  562

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  N+ GTS +GV KGGY 
Sbjct  563   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PNLPGTSIEGVEKGGYT  621

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++I++GTG EL +  ++A  LR EG+ VRVVS V W LFE Q  EYKE V
Sbjct  622   ISDNSTGNKPDLIVMGTGSELEIAAKAADELRKEGKTVRVVSFVSWELFEEQSDEYKESV  681

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP++V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++++YG T E++   A+
Sbjct  682   LPASVSARISIEAGSTLGWQKYVGAQGKAIGIDKFGASAPAGKIYQEYGITVESILAAAK  741



>ref|XP_008803984.1| PREDICTED: transketolase, chloroplastic-like [Phoenix dactylifera]
Length=743

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/698 (53%), Positives = 482/698 (69%), Gaps = 7/698 (1%)
 Frame = -3

Query  2251  EDYRLSWLEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHG  2072
             ++ RL      +RA  ++A +A E  E     + +VD+  V+ +R+L +D V+ A +GH 
Sbjct  50    QNRRLQAAPRPRRATVTRA-AAVETLEGKAATEALVDK-SVNTIRLLAIDGVEKANSGHP  107

Query  2071  GMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDD  1892
             G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ DD
Sbjct  108   GLPMGCAPLGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEDD  167

Query  1891  LKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVD  1712
             LK   + GS+TPGHPEN  T GIEVTTGPLGQGVANAVGLALAE HLA+RFNKPD+ IVD
Sbjct  168   LKAFRQWGSKTPGHPENFETPGIEVTTGPLGQGVANAVGLALAERHLAARFNKPDLEIVD  227

Query  1711  HRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFE  1532
             H TY I GDGC MEG++NEA SLA HW L KL   YDDNH +IDG T +  SED++ARFE
Sbjct  228   HYTYVIAGDGCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTKIAFSEDVNARFE  287

Query  1531  ALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-F  1355
             ALGW+TI V N     +A++ A+  A     KPT I++ T IG  S  +  S + HG+  
Sbjct  288   ALGWHTIWVKNGNTGYDAIRAAIKEAKAVKDKPTLIKITTTIGYGSPNKANSHSVHGSAL  347

Query  1354  EEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEA  1175
                +V+  ++ L W     PF V   +         +G  LE EW++K   Y+ KY ++A
Sbjct  348   GAKEVEATRKNLGWP--YEPFFVPEDVKSHWSHHVPEGAALEAEWNAKFAEYEKKYEEDA  405

Query  1174  KQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSN  995
              +   +++G +  GWE +LP +    P +ATR  S +CLN LAKV+PG +GGSADL SSN
Sbjct  406   AELKRIISGELPTGWEKALPTYTTESPADATRNLSQQCLNALAKVLPGFLGGSADLASSN  465

Query  994   QAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKN  815
                L  +G+F Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ 
Sbjct  466   MTLLKMFGNF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRA  524

Query  814   SIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAY  635
             +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAY
Sbjct  525   AIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLISFRAMPNILMLRPADGNETAGAY  584

Query  634   KVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELC  455
             KVA+ NR + +++ALSRQK+   + GTS +GV KGGYIISDNS    P++I++ +G EL 
Sbjct  585   KVAVLNRKRAAILALSRQKL-PQLSGTSVEGVEKGGYIISDNSSGNKPDLIIMSSGSELE  643

Query  454   LCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREY  275
             +  ++A  LR EG+ VRVVSLV W LF+ Q  EYKE VLP+ V  R+S+EAGS LGW ++
Sbjct  644   IAAKAADELRKEGKTVRVVSLVSWELFDEQTDEYKESVLPAAVAARISIEAGSTLGWEKF  703

Query  274   VGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             VG +G  IG+D FGAS P   ++K++G T ENV + AR
Sbjct  704   VGTKGKAIGIDRFGASAPAGRIYKEFGITAENVIEVAR  741



>ref|XP_010469147.1| PREDICTED: transketolase-1, chloroplastic-like isoform X1 [Camelina 
sativa]
 ref|XP_010469148.1| PREDICTED: transketolase-1, chloroplastic-like isoform X2 [Camelina 
sativa]
Length=742

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/664 (55%), Positives = 463/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  81    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  139

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ++DLK   +LGS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  140   LSAGHGCMLLYALLHLAGYDSVQVEDLKNFRQLGSKTPGHPENFETPGIEVTTGPLGQGI  199

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  200   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  259

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  260   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  319

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  320   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  377

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G +LE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  378   TPEGASLESDWTAKFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  437

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M GI 
Sbjct  438   SQQCLNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGGIC  496

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  497   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  556

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  557   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  615

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +   +A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  616   GGYTISDDSAGNKPDVILIGTGSELEIAAHAAEVLRKEGKTVRVVSFVCWELFDEQSDEY  675

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  676   KESVLPSDVSARVSIEAASTFGWEKIVGGKGKSIGINSFGASAPAPFLYKEFGITAEAVV  735

Query  172   KTAR  161
               A+
Sbjct  736   DAAK  739



>gb|ABK95795.1| unknown [Populus trichocarpa]
Length=744

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/661 (55%), Positives = 459/661 (69%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSA
Sbjct  85    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSA  144

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  145   GHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANA  204

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG++NEA SLAAHW L KL   YD
Sbjct  205   VGLALAEKHLAARYNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAAHWGLGKLIAFYD  264

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+  RFE LGW+ I V N     + ++ A+  A +   KPT I+
Sbjct  265   DNHISIDGDTEIAFTEDVDKRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKSVKDKPTLIK  324

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +        
Sbjct  325   VTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKQHWSRHTPA  382

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G   E EW++K   Y+ KY +EA +  ++ NG +  GWE +LP +    P +ATR  S +
Sbjct  383   GAAFEAEWNAKFAEYEKKYSEEAAELKSIANGELPAGWEKALPTYTPESPADATRNLSQQ  442

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
              LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  443   NLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGI  501

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA
Sbjct  502   ALHCPGLIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLA  561

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY
Sbjct  562   SFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGY  620

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             IISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE 
Sbjct  621   IISDNSSSNKPDVILIGTGSELEIAAKAAEELRKEGKAVRVVSFVSWELFDEQSDAYKES  680

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  RVS+EAGS  GW + VGD+G  IG+D FGAS P   ++K+YG T E V   A
Sbjct  681   VLPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRFGASAPAGKIYKEYGITTEAVIAAA  740

Query  163   R  161
             +
Sbjct  741   K  741



>ref|XP_009781082.1| PREDICTED: transketolase, chloroplastic [Nicotiana sylvestris]
Length=741

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/672 (54%), Positives = 465/672 (69%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P 
Sbjct  71    ETIEKTETALVDKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPY  130

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  131   WFNRDRFVLSAGHGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPENFETPGVEVT  190

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++ EA SLA H
Sbjct  191   TGPLGQGIANAVGLALAEKHLAARFNKPDTEIVDHYTYVILGDGCQMEGISQEACSLAGH  250

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +ED+ ARFEALGW+ I V N     + ++ A+  A
Sbjct  251   WGLGKLIAFYDDNHISIDGDTEIAFTEDVGARFEALGWHVIWVKNGNTGYDEIRAAIKEA  310

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              T T KPT I+V T IG  S  +  S + HG+     +V+  +  L W     PFHV   
Sbjct  311   KTVTDKPTMIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRSNLGWP--YEPFHVPED  368

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +         +G  LE  W++K   Y+ KYP+EA +  ++  G +  GWE +LP +    
Sbjct  369   VKSHWSRHVPEGAALEAGWNTKFAEYEKKYPEEAAELKSITTGELPAGWEKALPTYTPES  428

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN LAKV+PG +GGSADL SSN   +  +GDF Q ++P  RN+R+GVR
Sbjct  429   PADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLMKMFGDF-QKNTPEERNLRFGVR  487

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGED
Sbjct  488   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGED  547

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+FRP+DGNETAGAYKVA+  R  PS++ALSRQK+   + G
Sbjct  548   GPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKVAVLKRKTPSILALSRQKL-PQLAG  606

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             +S +G  KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW L
Sbjct  607   SSIEGAAKGGYILSDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVCWEL  666

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             FE Q  +YKE VLPS+V  RVS+EAGS  GW +YVG +G  IG+D +GAS P   ++K+Y
Sbjct  667   FEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRWGASAPAGIIYKEY  726

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  727   GITAEAVIAAAK  738



>ref|XP_010671991.1| PREDICTED: transketolase, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/666 (54%), Positives = 461/666 (69%), Gaps = 5/666 (1%)
 Frame = -3

Query  2155  QEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDR  1976
             ++ V  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDR
Sbjct  75    KDQVVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDR  134

Query  1975  FVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQ  1796
             FVLSAGHG +LQY  LHLAG+ SV  +DLK   + GSR PGHPEN  T G+EVTTGPLGQ
Sbjct  135   FVLSAGHGCMLQYALLHLAGYDSVTEEDLKTFRQWGSRIPGHPENFETPGVEVTTGPLGQ  194

Query  1795  GVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKL  1616
             G+AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC MEG+  EA SLA HW L KL
Sbjct  195   GIANGVGLALAEKHLAARFNKPDAEIIDHYTYVILGDGCQMEGIAQEACSLAGHWGLGKL  254

Query  1615  TLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQK  1436
                YDDNH +IDG T +  +E +  RFEALGW+ I V N     + ++ A+  A + T K
Sbjct  255   IAFYDDNHISIDGDTAIAFTESVDQRFEALGWHVIWVKNGNTGYDEIRAAVKEAQSVTDK  314

Query  1435  PTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMK  1259
             PT I+V T IG  S  +  S + HG+     +V+  +Q L W     PFHV   + +   
Sbjct  315   PTLIKVTTTIGFGSPNKSNSYSVHGSALGAKEVEATRQNLGWP--YEPFHVPEEVKKHWS  372

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                 +G +LE EW SK   Y+ KYP EA +  +++ G +  GWE +LP +    P +ATR
Sbjct  373   RHTPEGASLEAEWDSKFAEYEKKYPAEAAELKSIITGELPAGWEKALPTYTPETPGDATR  432

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               S +CLN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  
Sbjct  433   NLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGA  491

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP
Sbjct  492   ICNGIALHSPGFIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQP  551

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             +EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR  PS++ALSRQK+  N+ GTS +GV
Sbjct  552   IEHLASFRAMPNILMLRPADGNETAGAYKVAVENRKTPSILALSRQKL-PNLPGTSIEGV  610

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KGGYII+DNS    P++ILIGTG EL +  ++   LR EG+ VRVVS V W LF++Q  
Sbjct  611   EKGGYIITDNSSGNKPDVILIGTGSELEIAAKAGDELRKEGKSVRVVSFVSWELFDQQSD  670

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
             EYKE VLP+ V  RVS+EAG+  GW++ VG +G  IG+D+FG S P   ++K+YG T E 
Sbjct  671   EYKESVLPAAVTARVSIEAGTTFGWQKIVGSKGKAIGIDKFGQSAPAGKIYKEYGITAEA  730

Query  178   VSKTAR  161
             V + A+
Sbjct  731   VIEAAK  736



>gb|KFK35277.1| hypothetical protein AALP_AA5G264000 [Arabis alpina]
Length=732

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 462/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  71    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  129

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAGF SVQ++DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  130   LSAGHGCMLLYALLHLAGFDSVQVEDLKEFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  189

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  190   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  249

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  250   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  309

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  310   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPADVKSHWSRH  367

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  368   TPEGATLESDWTAKYAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  427

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  428   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIC  486

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  487   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  546

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  547   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  605

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++ILIGTG EL +  ++A V++ EG+ VRVVS VCW LF+ Q  EY
Sbjct  606   GGYTISDNSSGNKPDVILIGTGSELEIAAQAAEVIKKEGKTVRVVSFVCWELFDEQSDEY  665

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  666   KESVLPSAVSARVSIEAASTFGWGKIVGGQGKSIGINSFGASAPAPLLYKEFGITIEAVV  725

Query  172   KTAR  161
               A+
Sbjct  726   DAAK  729



>ref|XP_011034130.1| PREDICTED: transketolase, chloroplastic [Populus euphratica]
Length=744

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/660 (55%), Positives = 459/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  86    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  145

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  146   HGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  205

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLAAHW L KL   YDD
Sbjct  206   GLALAEKHLAARFNKPDSEIVDHYTYAILGDGCQMEGISNEACSLAAHWGLGKLIAFYDD  265

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  266   NHISIDGDTEIAFTEDVDRRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  325

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +        G
Sbjct  326   TTTIGYGSPNKSNSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKQHWSRHIPAG  383

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KY +EA +F +++ G +  GWE +LP +    P +ATR  S + 
Sbjct  384   AAFEAEWNTKFAEYEKKYSEEAAEFKSIMAGELPTGWEKALPTYTPDSPADATRNLSQQN  443

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  444   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  502

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  503   LHSPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  562

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGYI
Sbjct  563   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGYI  621

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++IL+GTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE V
Sbjct  622   ISDNSSGNKPDVILMGTGSELEIAAKAAEELRKEGKAVRVVSFVSWELFDEQSDAYKESV  681

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  682   LPAAVTARVSIEAGSTFGWQKLVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVIAAAK  741



>ref|XP_010264166.1| PREDICTED: transketolase, chloroplastic [Nelumbo nucifera]
Length=747

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/672 (54%), Positives = 461/672 (69%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  DK    +    ++ +R L +D V+ A +GH G+ +G A +G+ LY  VM +NP+ PK
Sbjct  76    ETLDKTDTTLVENSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMEYNPKNPK  135

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  136   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSQTPGHPENFETPGVEVT  195

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA H
Sbjct  196   TGPLGQGIANAVGLALAEKHLAARFNKPDCDIVDHYTYVILGDGCQMEGIANEACSLAGH  255

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG TD+  +E +  RFE LGW+ I V N     + ++ A+  A
Sbjct  256   WGLGKLIAFYDDNHISIDGDTDIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKEA  315

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
                  KPT I+V T IG  S  +  S + HG+     +V   ++ L W     PFHV   
Sbjct  316   KAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPED  373

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW++K   Y+ KY +EA +  +L++G +  GW+ +LP +    
Sbjct  374   VKKHWSRHVPEGAALEAEWNAKFAEYEKKYKEEAAELKSLISGELPAGWDKALPTYTPES  433

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S +CLN LAKV+PGL+GGSADL SSN   L  YGDF Q D+P  RN+R+GVR
Sbjct  434   PADATRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMYGDF-QKDTPEERNVRFGVR  492

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGED
Sbjct  493   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGED  552

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ N+ +PS++ALSRQK+   + G
Sbjct  553   GPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNKKRPSILALSRQKL-PQLPG  611

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYIISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W L
Sbjct  612   TSIEGVEKGGYIISDNSSGNKPDVILIGTGSELEISAKAADELRKEGKAVRVVSFVSWEL  671

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YKE VLP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++
Sbjct  672   FDEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEF  731

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  732   GITAEAVIAAAK  743



>ref|XP_009418330.1| PREDICTED: transketolase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/660 (54%), Positives = 463/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM++ P+ P WFNRDRFVLSAG
Sbjct  95    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYIPKNPYWFNRDRFVLSAG  154

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +L Y  LHLAG+ SV+I+D+K   + GSRTPGHPEN  T GIEVTTGPLGQGVANAV
Sbjct  155   HGCMLHYALLHLAGYDSVKIEDIKEFRQWGSRTPGHPENFETPGIEVTTGPLGQGVANAV  214

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  215   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  274

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+ ARFEALGW+TI V N     + ++ A+  A     KPT I+V
Sbjct  275   NHISIDGDTEIAFTEDVMARFEALGWHTIWVKNGNNGYDDIRAAIKEAKAVKDKPTLIKV  334

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  + + HG+     +V   +Q L W     PFHV   +         +G
Sbjct  335   TTTIGYGSPNKANTYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEEVKSHWSCHVPEG  392

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              + E EW++K   Y+ KY ++A Q   +++G +  GWET+LP +    P +ATR  S +C
Sbjct  393   ASFEAEWNAKFAEYEKKYKEDAAQLKGIISGELPAGWETALPTYTSESPADATRNLSQQC  452

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I NGIA
Sbjct  453   LNALAKVLPGFLGGSADLASSNMTLLKTFGDF-QKGTPEERNVRFGVREHGMGAICNGIA  511

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GL+P+ ATF VF+DYM+ ++R+SALS A VIY+MTHDSIGLGEDGPTHQP+EHL  
Sbjct  512   LHSPGLLPYCATFFVFTDYMRAAMRISALSEARVIYVMTHDSIGLGEDGPTHQPIEHLIS  571

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ N+ +PS++ALSRQK+   + GTSA+GV KGGYI
Sbjct  572   FRAMPNILMLRPADGNETAGAYKVAVLNKKRPSVLALSRQKL-PQLAGTSAEGVEKGGYI  630

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++I +GTG EL +  ++A  LR EG+ VRVVSLV W LF+ Q  EYKE V
Sbjct  631   ISDNSSGNRPDLIFMGTGSELEIAAKAADELRKEGKTVRVVSLVSWELFDEQSDEYKESV  690

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              P++V  R+S+EAG+ LGW ++VG +G  IG+D FGAS P   ++K++G T EN+  TAR
Sbjct  691   FPASVTARISIEAGTTLGWEKFVGSKGKAIGIDRFGASAPAGRIYKEFGITAENIIATAR  750



>ref|XP_002301278.1| transketolase family protein [Populus trichocarpa]
 gb|EEE80551.1| transketolase family protein [Populus trichocarpa]
Length=744

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/661 (55%), Positives = 458/661 (69%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSA
Sbjct  85    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSA  144

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  145   GHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANA  204

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG++NEA SLAAHW L KL   YD
Sbjct  205   VGLALAEKHLAARYNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAAHWGLGKLIAFYD  264

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+  RFE LGW+ I V N     + ++ A+  A +   KPT I+
Sbjct  265   DNHISIDGDTEIAFTEDVDKRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKSVKDKPTLIK  324

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +        
Sbjct  325   VTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKQHWSRHTPA  382

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G   E EW++K   Y+ KY +EA +  ++ NG +  GWE +LP +    P +ATR  S +
Sbjct  383   GAAFEAEWNAKFAEYEKKYSEEAAELKSIANGELPAGWEKALPTYTPESPADATRNLSQQ  442

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
              LN L KV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  443   NLNALVKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGI  501

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA
Sbjct  502   ALHCPGLIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLA  561

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY
Sbjct  562   SFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGY  620

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             IISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE 
Sbjct  621   IISDNSSSNKPDVILIGTGSELEIAAKAAEELRKEGKAVRVVSFVSWELFDEQSDAYKES  680

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  RVS+EAGS  GW + VGD+G  IG+D FGAS P   ++K+YG T E V   A
Sbjct  681   VLPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRFGASAPAGKIYKEYGITTEAVIAAA  740

Query  163   R  161
             +
Sbjct  741   K  741



>ref|XP_009411523.1| PREDICTED: transketolase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=750

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/665 (54%), Positives = 468/665 (70%), Gaps = 5/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E +  + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF
Sbjct  88    EALVEKSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRF  147

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHLAG+ SVQ++D+K+  + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  148   VLSAGHGCMLQYALLHLAGYDSVQMEDIKQFRQWGSRTPGHPENFETPGVEVTTGPLGQG  207

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             VANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA S+A HW L KL 
Sbjct  208   VANAVGLALAERHLAARFNKPDNEIVDHYTYVILGDGCQMEGIANEACSIAGHWGLGKLI  267

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG T++  +ED+SARF+ALGW+TI V N     + ++ A+  A     KP
Sbjct  268   AFYDDNHISIDGDTEIAFTEDVSARFDALGWHTIWVKNGNTGYDDIRAAIMEAKAVKDKP  327

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  S + HG+     +V   +Q L W     PFHV   +      
Sbjct  328   TLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDIKSHWSR  385

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                +G +LE EW++K   Y+ KY ++A +  A+++G +  GWE +LP +    P +ATR 
Sbjct  386   HVAEGASLEAEWNAKFAEYEKKYKEDAAELKAIVSGELPAGWEKALPTYTPESPADATRN  445

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S + LN LAKV+PGL+GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I
Sbjct  446   LSQQNLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKGTPEERNVRFGVREHGMGAI  504

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GL+P+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+
Sbjct  505   CNGIALHSPGLLPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPI  564

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EHL   RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV 
Sbjct  565   EHLISFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSVLALSRQKL-PQLAGTSIEGVE  623

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYI+SDNS    P++IL+GTG EL +  ++A  LR  G+ VRVVSLVCW LFE Q  E
Sbjct  624   KGGYIVSDNSSGNKPDLILMGTGSELEIAAKAADELRKTGKTVRVVSLVCWELFEEQSDE  683

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP+ V  ++S+EAG+ LGW +YVG +G  IG+D FGAS P   ++K++G + +++
Sbjct  684   YKESVLPAAVTAKISIEAGATLGWEKYVGGKGKAIGIDRFGASAPAGRIYKEFGISADSI  743

Query  175   SKTAR  161
                A+
Sbjct  744   ITAAK  748



>ref|XP_009596626.1| PREDICTED: transketolase, chloroplastic [Nicotiana tomentosiformis]
Length=743

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/682 (53%), Positives = 466/682 (68%), Gaps = 5/682 (1%)
 Frame = -3

Query  2203  SQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRH  2024
             S A  A    E  +K +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  
Sbjct  63    SPAIRASAATETIEKTETALVDKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDE  122

Query  2023  VMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPE  1844
             VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPE
Sbjct  123   VMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPE  182

Query  1843  NVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGV  1664
             N  T G+EVTTGPLGQG+ANAVGLAL E HLA+RFNKPD  IVDH TY I+GDGC MEG+
Sbjct  183   NFETPGVEVTTGPLGQGIANAVGLALVEKHLAARFNKPDAEIVDHYTYVILGDGCQMEGI  242

Query  1663  TNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDM  1484
             + EA SLA HW L KL   YDDNH +IDG T++  +ED+ ARFEALGW+ I V N     
Sbjct  243   SQEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVGARFEALGWHVIWVKNGNTGY  302

Query  1483  EALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDN  1307
             + ++ A+  A T T KPT I+V T IG  S  +  S + HG+     +V+  +  L W  
Sbjct  303   DEIRAAIKEAKTVTDKPTMIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRSNLGWP-  361

Query  1306  GRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWE  1127
                PFHV   +         +G  LE  W++K   Y+ KYP+EA    ++  G +  GWE
Sbjct  362   -YEPFHVPEDVKSHWSRHVPEGAALEAGWNTKFAEYEKKYPEEAAVLKSITTGELPAGWE  420

Query  1126  TSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSP  947
              +LP +    P +ATR  S + LN LAKV+PG +GGSADL SSN   +  +GDF Q ++P
Sbjct  421   KALPTYTPESPADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLMKMFGDF-QKNTP  479

Query  946   RGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIM  767
               RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+M
Sbjct  480   EERNLRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVM  539

Query  766   THDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALS  587
             THDSIGLGEDGPTHQP+EHLA  RA+P +L+FRP+DGNETAGAYKVA+  R  PS++ALS
Sbjct  540   THDSIGLGEDGPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKVAVLKRKTPSILALS  599

Query  586   RQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRV  407
             RQK+   + G+S +G  KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ V
Sbjct  600   RQKL-PQLAGSSIEGAAKGGYILSDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAV  658

Query  406   RVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGAS  227
             RVVS VCW LFE Q  +YKE VLPS+V  RVS+EAGS  GW +YVG +G  IG+D +GAS
Sbjct  659   RVVSFVCWELFEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRWGAS  718

Query  226   GPDTHVFKKYGFTEENVSKTAR  161
              P   ++K+YG T E V   A+
Sbjct  719   APAGKIYKEYGITAEAVVAAAK  740



>ref|XP_002876580.1| hypothetical protein ARALYDRAFT_486548 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52839.1| hypothetical protein ARALYDRAFT_486548 [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 463/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ A +GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKANSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  +LGS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQLGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGATLESDWSAKFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  IS
Sbjct  437   SQQCLNALAKVIPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIS  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  556   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  615   GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQSDEY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  675   KESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  734

Query  172   KTAR  161
               A+
Sbjct  735   DAAK  738



>ref|XP_004497357.1| PREDICTED: transketolase, chloroplastic-like [Cicer arietinum]
Length=739

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/673 (54%), Positives = 465/673 (69%), Gaps = 6/673 (1%)
 Frame = -3

Query  2173  EDDDKFQEM-VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  DK  E+ +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P
Sbjct  68    ETLDKTAELSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNP  127

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T GIEV
Sbjct  128   SWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKEFRQWGSKTPGHPENFETYGIEV  187

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+AN VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA 
Sbjct  188   TTGPLGQGIANGVGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGISNEACSLAG  247

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +ED+  RFEALGW+ I V N     + ++ A+  
Sbjct  248   HWGLGKLIAFYDDNHISIDGDTEIAFTEDVDKRFEALGWHVIWVKNGNTGYDEIRAAIKE  307

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A T T KPT I+V T IG  S  +  S + HG      +V   +Q L W     PFHV  
Sbjct  308   AKTVTDKPTLIKVTTTIGFGSPNKANSYSVHGAALGAKEVDATRQNLGWP--YEPFHVPE  365

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              + +       +G  LE EW++K   Y+ KY +EA +  A++   +  GWE +LP +   
Sbjct  366   DVKKHWSRHTPEGAALEAEWNAKFAEYEKKYAEEAAELKAIITRELPAGWEKALPTYTPE  425

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S + LN LAKV+PGL+GGSADL SSN   L  +GDF Q  +P  RN+R+GV
Sbjct  426   TPADATRNLSQQNLNALAKVLPGLLGGSADLASSNMTLLKSFGDF-QKGTPEERNVRFGV  484

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REHAM  I NGIALH  G IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGE
Sbjct  485   REHAMGAICNGIALHSPGFIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGE  544

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAY+VA+ N+ +PS++ALSRQK+  N+ 
Sbjct  545   DGPTHQPIEHLASFRAMPNVLMLRPADGNETAGAYRVAVLNQKRPSILALSRQKL-PNLP  603

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGYIISDNS    P++ILIGTG EL +   +A  LR EG+ VRVVS V W 
Sbjct  604   GTSIEGVEKGGYIISDNSSGNKPDVILIGTGSELEIAAAAADDLRKEGKAVRVVSFVSWE  663

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q  EYKE VLPS+V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K+
Sbjct  664   LFDDQSDEYKESVLPSSVTARVSIEAGSTFGWHKIVGSKGKTIGIDRFGASAPAGKIYKE  723

Query  199   YGFTEENVSKTAR  161
             +G T+E V   A+
Sbjct  724   FGITKEAVISAAK  736



>gb|ABK92500.1| unknown [Populus trichocarpa]
Length=744

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/661 (55%), Positives = 458/661 (69%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSA
Sbjct  85    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSA  144

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQGVANA
Sbjct  145   GHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGVANA  204

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLAAHW L KL   YD
Sbjct  205   VGLALAEKHLAARFNKPDSEIVDHYTYAILGDGCQMEGISNEACSLAAHWGLGKLIAFYD  264

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+  RFE LGW+ I V N     + ++ A+  A     KPT I+
Sbjct  265   DNHISIDGDTEIAFTEDVDKRFEGLGWHVIWVKNGNNGYDEIRAAIKEAKAVKDKPTLIK  324

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +        
Sbjct  325   VTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--FEPFHVPEDVKQHWSRHIPA  382

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G   E EW++K   Y+ KY +EA +F +++ G +  GWE +LP +    P +ATR  S +
Sbjct  383   GAAFEAEWNTKFAEYEKKYSEEAAEFKSIMTGELPTGWEKALPTYTPESPADATRNLSQQ  442

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
              LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  443   NLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGSICNGI  501

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA
Sbjct  502   ALHSPGLIPYCATFFVFTDYMRGAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLA  561

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYKVA+ N  +PS++ALSRQK+   + GTS +GV KGGY
Sbjct  562   SFRAMPNILMLRPADGNETAGAYKVAVLNSKRPSILALSRQKL-PQLPGTSIEGVEKGGY  620

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             IISDNS    P++IL+GTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE 
Sbjct  621   IISDNSSGNKPDVILMGTGSELEIAAKAAEELRKEGKAVRVVSFVSWELFDEQSVAYKES  680

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K++G T E V   A
Sbjct  681   VLPAAVTARVSIEAGSTFGWQKLVGAKGKAIGIDRFGASAPAGKIYKEFGITAEAVIAAA  740

Query  163   R  161
             +
Sbjct  741   K  741



>ref|WP_015144512.1| transketolase [Pleurocapsa minor]
 ref|YP_007081768.1| transketolase [Pleurocapsa sp. PCC 7327]
 gb|AFY78211.1| transketolase [Pleurocapsa sp. PCC 7327]
Length=668

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/665 (54%), Positives = 465/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++ RC++++R L +D V+ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEERCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +D++K   + GS+TPGHPEN IT G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDEIKNFRQWGSKTPGHPENHITPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  +VDH TY I+GDGC+MEG++ EA SLA H  L KL 
Sbjct  126   IANAVGLAIAEAHLAAKFNKPDCKLVDHYTYVILGDGCNMEGISGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+E++  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVLHVEDGNKDIESITKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+VK  ++ L W     PF V        + 
Sbjct  246   SMIKVTTTIGYGSPNKANTAGVHGAALGSDEVKATRENLGWQ--YEPFVVPDDALAHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G + E EW   L  Y+ KYPQEA +F  LL+G +  GWE +LP +   D  +ATR 
Sbjct  304   AVERGASYEAEWQETLAQYKTKYPQEAAEFERLLSGKLPEGWEKALPTYTPEDKAQATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   LN LA +VP LIGGSADL  SN   +   GDF Q    + RN+R+GVREH M  I
Sbjct  364   FSEAMLNALAPIVPELIGGSADLTHSNNTLIKVSGDF-QKGQYQNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+N+IRLSALS AGVI+IMTHDS+GLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYGATFLVFTDYMRNAIRLSALSEAGVIWIMTHDSVGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP L V RP+DGNET+GAYKVAI NR  P+L+ALSRQ +  N+ G+S +   
Sbjct  483   EHIASLRAIPNLTVIRPADGNETSGAYKVAIENRHAPTLLALSRQNL-PNLAGSSIEATT  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD+ G   P++ILIGTG E  LC ++A  LR EG++VRVVS+  W LFE+Q   
Sbjct  542   KGAYILSDSEGT--PDLILIGTGSETQLCVKAAEALRGEGKKVRVVSMPSWELFEKQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE V P  VRKR++VEAGS +GW  YV DEG  I +D FGAS P   V +K+GFT +NV
Sbjct  600   YKESVFPKAVRKRLAVEAGSSMGWCRYVTDEGASISIDTFGASAPGNVVMEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   IAKAK  664



>ref|XP_011017481.1| PREDICTED: transketolase, chloroplastic [Populus euphratica]
Length=745

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/660 (55%), Positives = 457/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  87    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  146

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  147   HGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  206

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG++NEA SLAAHW L KL   YDD
Sbjct  207   GLALAEKHLAARYNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAAHWGLGKLIAFYDD  266

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED+  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  267   NHISIDGDTEIAFTEDVDKRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  326

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +        G
Sbjct  327   TTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKQHWSRHTPAG  384

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KY +EA +  ++ NG +  GWE +LP +    P +ATR  S + 
Sbjct  385   AAFEAEWNAKFAEYEKKYSEEAAELKSIANGELPAGWEKALPTYTPESPADATRNLSQQN  444

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  445   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  503

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G+IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  504   LHCPGMIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  563

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGYI
Sbjct  564   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGYI  622

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE V
Sbjct  623   ISDNSSSNKPDVILIGTGSELEIAAKAAEELRKEGKAVRVVSFVSWELFDEQSDAYKESV  682

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW + VGD+G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  683   LPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRFGASAPAGKIYKEFGLTTEAVIAAAK  742



>ref|XP_003592793.1| Transketolase [Medicago truncatula]
 ref|XP_003614796.1| Transketolase [Medicago truncatula]
 gb|AES63044.1| plastid transketolase [Medicago truncatula]
 gb|AES97754.1| plastid transketolase [Medicago truncatula]
Length=735

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/686 (53%), Positives = 466/686 (68%), Gaps = 5/686 (1%)
 Frame = -3

Query  2215  RAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYF  2036
             R   + A  A   E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ 
Sbjct  51    RRRTTPAIRATAVETLDKTTEASLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHI  110

Query  2035  LYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTP  1856
             LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ DDLK+  + GS+TP
Sbjct  111   LYDEVMRYNPKNPSWFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEDDLKQFRQWGSKTP  170

Query  1855  GHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCS  1676
             GHPEN  T GIEVTTGPLGQG+AN VGLALAE HLA+RFNKPD  IVDH TY I+GDGC 
Sbjct  171   GHPENFETYGIEVTTGPLGQGIANGVGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQ  230

Query  1675  MEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNT  1496
             MEG++NEA SLA HW L KL   YDDNH +IDG T++  +E++  RFEALGW+ I V N 
Sbjct  231   MEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNG  290

Query  1495  QGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKL  1319
                 + ++ A+  A   T KPT I+V T IG  S  +  S + HG      +V   +Q L
Sbjct  291   NTGYDEIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGAALGAKEVDATRQNL  350

Query  1318  RWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIV  1139
              W     PFHV   + +       +G  LE EW++K   Y+ KY +EA +  A++N  + 
Sbjct  351   GWP--YEPFHVPEDVKKHWSRHTPEGAALEAEWNAKFAEYEKKYKEEAAELKAIINRELP  408

Query  1138  PGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQ  959
               WE +LP +    P +ATR  S + LN LAKV+PGLIGGSADL SSN   L  +GDF Q
Sbjct  409   ADWEKALPTYTPETPADATRNLSQQNLNALAKVLPGLIGGSADLASSNMTLLKSFGDF-Q  467

Query  958   PDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGV  779
               +P  RN+R+GVREHAM  I NGIALH  G IP+ ATF VF+DYM+ +IR+SAL  AGV
Sbjct  468   KATPEERNVRFGVREHAMGAICNGIALHSPGFIPYCATFFVFTDYMRAAIRISALCEAGV  527

Query  778   IYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSL  599
             IY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+Y+VA+ N+ +PS+
Sbjct  528   IYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNVLMLRPADGNETAGSYRVAVLNQKRPSI  587

Query  598   MALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNE  419
             +ALSRQK+  N+ GTS +GV KGGY ISDNS    P++ILIGTG EL +   +A  LR E
Sbjct  588   LALSRQKL-PNLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAAAADDLRKE  646

Query  418   GRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDE  239
             G+ VRVVS V W LF+ Q  EYKE VLP++V  RVS+EAGS  GW + VG +G  IG+D 
Sbjct  647   GKTVRVVSFVSWELFDDQSDEYKESVLPASVTARVSIEAGSTFGWHKIVGSKGKTIGIDR  706

Query  238   FGASGPDTHVFKKYGFTEENVSKTAR  161
             FGAS P   ++K+YG T+E V   A+
Sbjct  707   FGASAPAGKIYKEYGITKEAVISAAK  732



>ref|XP_008344551.1| PREDICTED: transketolase, chloroplastic, partial [Malus domestica]
Length=667

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/661 (54%), Positives = 459/661 (69%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSA
Sbjct  7     EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSA  66

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  67    GHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANA  126

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+R+NKPD  IVDH TYCI+GDGC MEG++NEAASLA HW L KL   YD
Sbjct  127   VGLALAEKHLAARYNKPDSEIVDHYTYCILGDGCQMEGISNEAASLAGHWGLGKLIAFYD  186

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A   T KPT I+
Sbjct  187   DNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPTLIK  246

Query  1420  VKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG      +V   ++ L W     PFHV   +         +
Sbjct  247   VTTTIGFGSPNKANSYSVHGAALGSKEVDATRKNLGWP--YEPFHVPEDVKSHWSRHTAE  304

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G  LE EW++K   Y+ KY +EA +  +++ G +  GWE +LPR+    P +ATR  S  
Sbjct  305   GSALEVEWNAKFAEYEKKYAEEAAELKSIVKGELPAGWEKALPRYTPESPADATRNLSQA  364

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
              LN L+KV+PGLIGGSADL SSN   L  +GDF Q ++P  RN+R+GVREH M  I NGI
Sbjct  365   NLNALSKVLPGLIGGSADLASSNMTLLKSFGDF-QKNTPEERNVRFGVREHGMGAICNGI  423

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA
Sbjct  424   ALHSPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLA  483

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAY+VA+ NR +PS++ALSRQK+  N+ GTS +GV KGGY
Sbjct  484   SFRAMPNILMLRPADGNETAGAYRVAVLNRKRPSILALSRQKL-PNLPGTSIEGVEKGGY  542

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              ISDNS    P++IL+ TG EL +  ++   LR EG+ VRVVS V W LF+ Q  +YKE 
Sbjct  543   TISDNSSGNKPDVILMATGSELEIVAKAGDELRKEGKTVRVVSFVSWELFDDQSDDYKES  602

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  RVS+EAGS  GW + VG +G VIG+D+FGAS P   ++K+YG T E V   A
Sbjct  603   VLPAAVTARVSLEAGSTFGWHKIVGSKGKVIGIDKFGASAPAGKIYKEYGITVEAVVAAA  662

Query  163   R  161
             +
Sbjct  663   K  663



>gb|AAO29950.1| Unknown protein [Arabidopsis thaliana]
Length=741

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 464/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKALPTYTPESPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  437   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNVRFGVREHGMGAIC  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+  ++ GTS +GV K
Sbjct  556   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PHLPGTSIEGVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR +G+ VRVVS VCW LF+ Q  EY
Sbjct  615   GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSFVCWELFDEQSDEY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  675   KESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  734

Query  172   KTAR  161
               A+
Sbjct  735   DAAK  738



>ref|XP_008354845.1| PREDICTED: transketolase, chloroplastic [Malus domestica]
Length=747

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/673 (53%), Positives = 463/673 (69%), Gaps = 5/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P
Sbjct  75    ETLDKTTETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNP  134

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EV
Sbjct  135   YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSKTPGHPENFETPGVEV  194

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TYCI+GDGC MEG++NEAASLA 
Sbjct  195   TTGPLGQGIANAVGLALAEKHLAARYNKPDSEIVDHYTYCILGDGCQMEGISNEAASLAG  254

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  
Sbjct  255   HWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKE  314

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A   T KPT I+V T IG  S  +  S + HG      +V   ++ L W     PFHV  
Sbjct  315   AKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGAALGSKEVDATRKNLGWP--YEPFHVPE  372

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +         +G  LE EW++K   Y+ KY +EA +  +++ G +  GWE +LPR+   
Sbjct  373   DVKSHWSRHTAEGSALEVEWNAKFAEYEKKYAEEAAELKSIVKGELPAGWEKALPRYTPE  432

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S   LN L+KV+PGLIGGSADL SSN   L  +GDF Q ++P  RN+R+GV
Sbjct  433   SPADATRNLSQANLNALSKVLPGLIGGSADLASSNMTLLKSFGDF-QKNTPEERNVRFGV  491

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGE
Sbjct  492   REHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGE  551

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAY+VA+ NR +PS++ALSRQK+  N+ 
Sbjct  552   DGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYRVAVLNRKRPSILALSRQKL-PNLP  610

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGY ISDNS    P++IL+ TG EL +  ++   LR EG+ VRVVS V W 
Sbjct  611   GTSIEGVEKGGYTISDNSSGNKPDVILMATGSELEIVAKAGDELRKEGKTVRVVSFVSWE  670

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q  +YKE VLP+ V  RVS+EAGS  GW + VG +G VIG+D+FGAS P   ++K+
Sbjct  671   LFDDQSDDYKESVLPAAVTARVSLEAGSTFGWHKIVGSKGKVIGIDKFGASAPAGKIYKE  730

Query  199   YGFTEENVSKTAR  161
             YG T E V   A+
Sbjct  731   YGITVEAVVAAAK  743



>ref|NP_567103.1| transketolase [Arabidopsis thaliana]
 sp|Q8RWV0.1|TKTC1_ARATH RecName: Full=Transketolase-1, chloroplastic; Short=TK; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM14045.1| putative transketolase [Arabidopsis thaliana]
 gb|AAM91794.1| putative transketolase [Arabidopsis thaliana]
 gb|AEE80103.1| transketolase [Arabidopsis thaliana]
Length=741

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 464/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKALPTYTPESPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  437   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIC  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+  ++ GTS +GV K
Sbjct  556   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PHLPGTSIEGVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR +G+ VRVVS VCW LF+ Q  EY
Sbjct  615   GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSFVCWELFDEQSDEY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  675   KESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  734

Query  172   KTAR  161
               A+
Sbjct  735   DAAK  738



>ref|XP_007153461.1| hypothetical protein PHAVU_003G037400g [Phaseolus vulgaris]
 gb|ESW25455.1| hypothetical protein PHAVU_003G037400g [Phaseolus vulgaris]
Length=730

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/687 (53%), Positives = 470/687 (68%), Gaps = 6/687 (1%)
 Frame = -3

Query  2218  KRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             +RA P +A    +  E       +V++  V+ +R L +D V+ A +GH G+ +G A +G+
Sbjct  46    RRAAPVRASVPLKTVEKATSDIALVEK-SVNTIRFLAIDSVEKANSGHPGLPMGCAPMGH  104

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY   M++NP+ PKWFNRDRFVLSAGHG +LQY  LHLAGF SV+ +DL++  + GSRT
Sbjct  105   VLYDEAMKYNPKNPKWFNRDRFVLSAGHGCMLQYALLHLAGFDSVKEEDLRQFRQWGSRT  164

Query  1858  PGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGC  1679
             PGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC
Sbjct  165   PGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYAILGDGC  224

Query  1678  SMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDN  1499
              MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +E + +RFE LGW+ I V N
Sbjct  225   QMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGNTEIAFTESVDSRFEGLGWHVIWVKN  284

Query  1498  TQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQK  1322
                  + ++ A+  A +   KPT I+V T IG  S  +  S + HG+     +V   +Q 
Sbjct  285   GNNGYDDIRAAIEEAKSVKDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAKEVDATRQN  344

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             L W     PFHV   + +       +G  LE EW+ K   Y+ KY +EA +  +++NG +
Sbjct  345   LGWP--YEPFHVPEDVKKHWSRHIPEGAALEAEWNIKFAEYEKKYKEEAAELKSIINGDL  402

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
               GWE +LP +    P +ATR  S + LN LAKV+PGL+GGSADL SSN   L  +GDF 
Sbjct  403   PAGWEKALPTYTPESPADATRNLSQQNLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-  461

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
             Q D+P  RN+R+GVREH M  I NGIALH   LIP+ ATF VF+DYM+ +IRLSALS AG
Sbjct  462   QKDTPAERNVRFGVREHGMGAICNGIALHSPALIPYCATFFVFTDYMRGAIRLSALSEAG  521

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS
Sbjct  522   VIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPS  581

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRN  422
             ++ALSRQK+  N+ G+S +GV KGGY ISDNS    P+ ILIGTG EL +  ++A  LR 
Sbjct  582   ILALSRQKL-PNLPGSSIEGVEKGGYTISDNSTGNKPDAILIGTGSELEIAAKAAEDLRK  640

Query  421   EGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMD  242
             EG+ VRVVSLV W LF+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D
Sbjct  641   EGKTVRVVSLVSWELFDEQSEAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGID  700

Query  241   EFGASGPDTHVFKKYGFTEENVSKTAR  161
              FGAS P   ++K++G T+E V   A+
Sbjct  701   RFGASAPAGKIYKEFGITKEAVIAAAK  727



>ref|XP_002872970.1| chloroplast transketolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49229.1| chloroplast transketolase [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/664 (54%), Positives = 462/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A +G+ L+  VM++NP+ P WFNRDRF+
Sbjct  73    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMGHILFDEVMQYNPKNPYWFNRDRFI  131

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +LQY  LHLAG+ SV+ DDLK   + GSRTPGHPEN  T G+EVTTGPLGQG+
Sbjct  132   LSAGHGCMLQYALLHLAGYDSVREDDLKNFRQWGSRTPGHPENFETPGVEVTTGPLGQGI  191

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKP   IVDH TY I+GDGC MEG+ NEA SLA HW L KL  
Sbjct  192   ANAVGLALAEKHLAARFNKPGNQIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIA  251

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RF+ LGW+ I V N     + ++ A+  A     KPT
Sbjct  252   FYDDNHISIDGDTEIAFTENVETRFQGLGWHVIWVKNGNTAYDEIRAAIKEAKAVKDKPT  311

Query  1429  FIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I++ T IG  S  +  S + HG+   E +V   ++ L W    GPFHV   +       
Sbjct  312   LIKITTTIGYGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YGPFHVPEDVKSHWSRH  369

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE EW++K   Y+NKYPQEA +  +++   +  GWE SLP +    P +ATR  
Sbjct  370   IPKGAALETEWNAKFADYENKYPQEAAELKSIVTVNLPTGWEKSLPTYTPESPADATRNL  429

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVREH+M  I 
Sbjct  430   SQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNAPEERNLRFGVREHSMGAIC  488

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGI  H  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  489   NGITCHSPGLIPYCATFFVFTDYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPIE  548

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV K
Sbjct  549   HVASFRAMPNILMLRPADGTETAGAYKVAVENRKRPSILALSRQKL-LHLPGTSVEGVEK  607

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY+ISDNS    P++IL+GTG EL +  ++   LR EGR VRVVSLV W LF+ Q  EY
Sbjct  608   GGYVISDNSTGNKPDVILMGTGSELEIAAKAGEKLREEGRAVRVVSLVSWELFDEQSEEY  667

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++KK+G T + V 
Sbjct  668   KESVLPSEVSARVSIEAGSTFGWEKMVGSKGKAIGVDSFGASAPADVLYKKFGLTVDAVV  727

Query  172   KTAR  161
               A+
Sbjct  728   AAAK  731



>ref|XP_003521870.1| PREDICTED: transketolase, chloroplastic [Glycine max]
Length=731

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/660 (55%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY   M++NP+ P WFNRDRFVLSAG
Sbjct  73    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDETMKYNPKNPFWFNRDRFVLSAG  132

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAGF SV+ +DL+   + GSRTPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  133   HGCMLQYALLHLAGFDSVKEEDLREFRQWGSRTPGHPENFETPGIEVTTGPLGQGIANAV  192

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  193   GLALAEKHLAARYNKPDNEIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  252

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E + +RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  253   NHISIDGNTEIAFTESVDSRFEGLGWHVIWVKNGNNGYDDIRAAIKEAKAVKDKPTLIKV  312

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W +   PFHV   + +       +G
Sbjct  313   TTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWSH--EPFHVPEDVKKHWSRHTPEG  370

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +  +++NG    GWE +LP +    P +ATR  S   
Sbjct  371   AALEAEWNAKFAEYEKKYKEEAAELKSIINGEFPAGWEKALPTYTPESPADATRNLSQTN  430

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  431   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPAERNVRFGVREHGMGAICNGIA  489

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  490   LHSPGLIPYCATFFVFTDYMRGAIRLSALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  549

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  550   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGYT  608

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLV W LF+ Q   YKE V
Sbjct  609   ISDNSTGNKPDVILIGTGSELEIAAKAADDLRKEGKAVRVVSLVSWELFDEQSEAYKESV  668

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              P+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  669   FPAAVSARVSIEAGSTFGWEKIVGAKGKAIGIDRFGASAPAGRIYKEFGITKEAVVAAAK  728



>emb|CDX71785.1| BnaC08g30890D [Brassica napus]
Length=739

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/664 (55%), Positives = 459/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  78    IVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  136

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  137   LSAGHGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  196

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLAL E HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL  
Sbjct  197   ANAVGLALVEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIA  256

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  257   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  316

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  317   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFKVPDEVKSHWSRH  374

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
                G+ LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  375   TPDGKALESDWNASFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  434

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M GI 
Sbjct  435   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGGIC  493

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  494   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPVE  553

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HLA  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  554   HLASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  612

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++IL+GTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  613   GGYTISDNSSGNKPDVILVGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQTDEY  672

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG EG  IG++ FGAS P   ++K++G T E V 
Sbjct  673   KESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSFGASAPAPLLYKEFGITVEAVV  732

Query  172   KTAR  161
               A+
Sbjct  733   DAAK  736



>ref|XP_008438176.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
Length=742

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P WFNRDRF+LSAG
Sbjct  84    KSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFILSAG  143

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  144   HGCMLQYALLHLAGYDSVREEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  203

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG+ NEA SLA HW L KL  LYDD
Sbjct  204   GLALAEKHLAARFNKPDSEVVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIALYDD  263

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  264   NHISIDGDTEIAFTESVDTRFEALGWHVIWVKNGNTGYDEIRAAIQEAKAVKDKPTMIKV  323

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  +  L W     PFHV   + +        G
Sbjct  324   TTTIGFGSPNKANSYSVHGSALGAKEVEATRSNLGWP--YEPFHVPEDVQKHWSRHTPLG  381

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KYP+EA +  +++ G    GWE +LP++    P +ATR  S +C
Sbjct  382   ADFEAEWNAKFAEYEKKYPEEAAELKSIITGERPAGWEDALPKYTPESPGDATRNLSQQC  441

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  YGDF Q ++P  RN+R+GVREH M  I NGIA
Sbjct  442   LNALAKVLPGFLGGSADLASSNMTLLKMYGDF-QKNTPEERNLRFGVREHGMGAICNGIA  500

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  501   LHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  560

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+FRP+DGNETAGAYKVA+ NR +PS+MALSRQK+  ++ GTS +GV KGGYI
Sbjct  561   FRAMPNILMFRPADGNETAGAYKVAVVNRKRPSIMALSRQKL-PHLPGTSIEGVEKGGYI  619

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++   LR EG+ VRVVS V W LFE Q   YKE V
Sbjct  620   ISDNSSGNKPDVILIGTGSELEIAFQAGEELRKEGKAVRVVSFVSWELFEEQSDAYKESV  679

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   AR
Sbjct  680   LPEAVSARVSIEAGSTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITVEAVVAAAR  739



>ref|XP_004306931.1| PREDICTED: transketolase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/691 (53%), Positives = 468/691 (68%), Gaps = 5/691 (1%)
 Frame = -3

Query  2230  LEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLA  2051
             L  + R   S+   A   E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A
Sbjct  54    LARVPRRRLSRPVRAAAVETLDKTTETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCA  113

Query  2050  EVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKL  1871
              +G+ LY  +MR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + 
Sbjct  114   PMGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKGFRQW  173

Query  1870  GSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIM  1691
             GS+TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TYCI+
Sbjct  174   GSKTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYCIL  233

Query  1690  GDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTI  1511
             GDGC MEG++NEAASLA HW L KL   YDDNH +IDG T++  +E++ AR+EALGW+ +
Sbjct  234   GDGCQMEGISNEAASLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDARYEALGWHVL  293

Query  1510  TVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQ  1334
              V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG      +V  
Sbjct  294   WVKNGNTGYDEIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGAALGAKEVDA  353

Query  1333  MKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALL  1154
              +Q L W     PFHV   +         +G  LE EW++K   Y+ KY +EA +  +++
Sbjct  354   TRQNLGWP--YEPFHVPEDVKSHWSRHTPEGAALEAEWNAKFAEYEKKYAEEAAELKSII  411

Query  1153  NGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGY  974
              G +  GWE +LP +    P +ATR  S   LN LA V+PGLIGGSADL SSN   +  +
Sbjct  412   TGELPAGWEKALPTYTPEVPADATRNLSQANLNALAPVLPGLIGGSADLASSNMTLMKMF  471

Query  973   GDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSAL  794
             GDF Q  +P  RNIR+GVREHAM  ISNGI+LH  G IP+ ATF VF+DYM+N+IRLSAL
Sbjct  472   GDF-QKGTPEERNIRFGVREHAMGAISNGISLHSPGFIPYCATFFVFTDYMRNAIRLSAL  530

Query  793   SHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANR  614
             + + VIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+YKVA+ N+
Sbjct  531   AESRVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVENK  590

Query  613   DKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAG  434
              +PS++ALSRQK+  N+ GTS +GV  GGYI+SDNS    P++ILIGTG EL +  ++  
Sbjct  591   KRPSILALSRQKL-PNLAGTSVEGVATGGYIVSDNSTGNKPDVILIGTGSELEIAYKAGE  649

Query  433   VLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVV  254
              LR EG+ VRVVS V W LFE Q   YKE VLP+ V  RVS+EAGS  GW + +G +G  
Sbjct  650   ELRKEGKAVRVVSFVSWELFEDQSDAYKESVLPAAVTARVSIEAGSTFGWHKIIGTKGKA  709

Query  253   IGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             IG+D FGAS P   ++K+YG T E V   A+
Sbjct  710   IGIDRFGASAPAPIIYKEYGITVEAVIAAAK  740



>emb|CDY41143.1| BnaA09g38720D [Brassica napus]
Length=738

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/664 (55%), Positives = 460/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  77    IVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  135

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  136   LSAGHGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  195

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL  
Sbjct  196   ANAVGLALAEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIA  255

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A + T KPT
Sbjct  256   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKSVTDKPT  315

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  316   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFKVPDEVKSHWSRH  373

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
                G+ LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  374   TPDGKALESDWNASFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  433

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  434   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIC  492

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  493   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPVE  552

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HLA  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  553   HLASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  611

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++IL+GTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  612   GGYTISDNSSGNKPDVILVGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQTDEY  671

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG EG  IG++ FGAS P   ++K++G T E V 
Sbjct  672   KESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSFGASAPAPLLYKEFGITVEAVV  731

Query  172   KTAR  161
               A+
Sbjct  732   DAAK  735



>ref|XP_006290638.1| hypothetical protein CARUB_v10016731mg [Capsella rubella]
 gb|EOA23536.1| hypothetical protein CARUB_v10016731mg [Capsella rubella]
Length=741

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/664 (54%), Positives = 462/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYSLLHLAGYDSVQEEDLKNFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TYCI+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYCILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE +W +K  +Y+ KYP+EA +  ++++G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGAALESDWSAKFAAYEKKYPEEAAELKSIISGELPTGWEKALPTYTPESPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I 
Sbjct  437   SQQCLNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAIC  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+  ++ GTS +GV K
Sbjct  556   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PHLPGTSIEGVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  615   GGYTISDDSAGNKPDVILIGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQSDEY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  675   KESVLPSAVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  734

Query  172   KTAR  161
               A+
Sbjct  735   DAAK  738



>ref|XP_003581128.1| PREDICTED: transketolase, chloroplastic-like [Brachypodium distachyon]
Length=721

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/665 (54%), Positives = 469/665 (71%), Gaps = 6/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+V++  V+ +R L VD V+ A +GH G+ +G A +G+ L+   +RFNP+ P WF+RDRF
Sbjct  60    ELVEQ-SVNTIRFLAVDAVEKANSGHPGLPMGCAPLGHVLFDEFLRFNPRNPGWFDRDRF  118

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHLAG+  V +DDLK   + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  119   VLSAGHGCMLQYALLHLAGYPGVTMDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQG  178

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
              ANAVGLALAE HLA+RFNKPD+ IVDH TY ++GDGC MEGV NEA+SLA HW L KL 
Sbjct  179   FANAVGLALAEKHLAARFNKPDLCIVDHYTYVVLGDGCQMEGVVNEASSLAGHWGLGKLI  238

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD+  SE++ AR+EALGW+T+ V N     + ++ A+  A     KP
Sbjct  239   AFYDDNHISIDGSTDIAFSENVLARYEALGWHTVWVKNGNSGYDDIRAAIKEAKEVKDKP  298

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  + ++ + HG+     +V+  +  L W +   PFHV   + R    
Sbjct  299   SLIKVTTTIGYGSPNKASTHSVHGSALGPKEVEATRNNLLWLH--EPFHVPDEVKRHWGH  356

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G +LE EW++K   Y+ KY QEA +  ++++G +  GW+ +LP +    P +ATR 
Sbjct  357   HIDEGASLEAEWNAKFSEYEKKYHQEAAELNSIISGELHAGWDKALPTYTPESPADATRN  416

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q D+P+ RNIR+GVREHAM  I
Sbjct  417   ISQQCLNALAKVIPGFLGGSADLASSNMTLLKMFGDF-QKDTPQERNIRFGVREHAMGAI  475

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              N IALH  GLIP+ +TF VF+DYM+  IRLSAL  +GVIY+MTHDSIGLGEDGPTHQPV
Sbjct  476   CNAIALHSPGLIPYCSTFFVFTDYMRAPIRLSALCGSGVIYVMTHDSIGLGEDGPTHQPV  535

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E L  LRA+P +LV RP+DGNET+ AY+ A+ NR +PS++A SRQK+   + GTS +GV 
Sbjct  536   EQLFSLRAMPNILVLRPADGNETSAAYRTAVVNRQRPSILAFSRQKL-PQLAGTSVEGVA  594

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYIISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLVCW LFE Q  E
Sbjct  595   KGGYIISDNSSGNKPDLILIGTGSELEIAAKAADDLRKEGKTVRVVSLVCWELFEEQSEE  654

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YK+ VLPS V  R+S+EAG  LGW +Y+G +G  IG+D FG+S P   ++K+ G T E++
Sbjct  655   YKDSVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRFGSSAPAGKIYKELGLTVEHI  714

Query  175   SKTAR  161
               TA+
Sbjct  715   IATAK  719



>gb|ACF60500.1| plastid transketolase [Nicotiana tabacum]
Length=744

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/672 (53%), Positives = 462/672 (69%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P 
Sbjct  74    ETIEKTETALVDKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPY  133

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  134   WFNRDRFVLSAGHGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPENFETPGVEVT  193

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLAL E HLA+RFNKPD  IVDH TY I+GDGC MEG++ EA SLA H
Sbjct  194   TGPLGQGIANAVGLALVEKHLAARFNKPDAEIVDHYTYVILGDGCQMEGISQEACSLAGH  253

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +ED+ ARFEALGW+ I V N     + ++ A+  A
Sbjct  254   WGLGKLIAFYDDNHISIDGDTEIAFTEDVGARFEALGWHVIWVKNGNTGYDEIRAAIKEA  313

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              T T KPT I+V T IG  S  +  S + HG+     +V+  +  L W     PFHV   
Sbjct  314   KTVTDKPTMIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRSNLGWP--YEPFHVPED  371

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +         +G  LE  W++K   Y+ KYP+EA +  ++  G +  GWE +LP +    
Sbjct  372   VKSHWSRHVTEGAALEAGWNTKFAEYEKKYPEEAAELKSITTGELPAGWEKALPTYTPES  431

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN L KV+PG +GGSADL SSN   +  +GDF Q ++P  RN+R+GVR
Sbjct  432   PADATRNLSQQNLNALVKVLPGFLGGSADLASSNMTLMKMFGDF-QKNTPEERNLRFGVR  490

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGED
Sbjct  491   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGED  550

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+FRP+DGNETAGAYKVA+     PS++ALSRQK+   + G
Sbjct  551   GPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKVAVLKWKTPSILALSRQKL-PQLAG  609

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             +S +G  KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW L
Sbjct  610   SSIEGAAKGGYILSDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVCWEL  669

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             FE Q  +YKE VLPS+V  RVS+EAGS  GW +YVG +G  IG+D +GAS P   ++K+Y
Sbjct  670   FEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRWGASAPAGKIYKEY  729

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  730   GITAEAVVAAAK  741



>gb|AAM62766.1| transketolase-like protein [Arabidopsis thaliana]
Length=741

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/664 (54%), Positives = 463/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++   FEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDQLFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKALPTYTPESPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  437   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIC  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+  ++ GTS +GV K
Sbjct  556   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PHLPGTSIEGVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR +G+ VRVVS VCW LF+ Q  EY
Sbjct  615   GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSFVCWELFDEQSDEY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  675   KESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  734

Query  172   KTAR  161
               A+
Sbjct  735   DAAK  738



>ref|XP_010941046.1| PREDICTED: transketolase, chloroplastic [Elaeis guineensis]
Length=743

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/666 (54%), Positives = 465/666 (70%), Gaps = 6/666 (1%)
 Frame = -3

Query  2155  QEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDR  1976
             + +VD+  V+ +R L VD V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDR
Sbjct  81    EALVDK-SVNTIRFLAVDAVEKATSGHPGLPMGCAPLGHILYDEIMRYNPKNPYWFNRDR  139

Query  1975  FVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQ  1796
             FVLSAGHG +L Y  LHLAG+ SV+ DDLK   +  S+TPGHPEN  T GIEVTTGPLGQ
Sbjct  140   FVLSAGHGCMLHYALLHLAGYDSVKEDDLKAFRQWESKTPGHPENFETPGIEVTTGPLGQ  199

Query  1795  GVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKL  1616
             G+ANAVGLALAE HLA+RFNKPD+ I+DH TY ++GDGC MEG++NE  SLA HW L KL
Sbjct  200   GIANAVGLALAERHLAARFNKPDMEIIDHYTYVVVGDGCQMEGISNETCSLAGHWGLGKL  259

Query  1615  TLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQK  1436
                YDDNH +IDG T++  +ED++ARFEALGW+TI V N     + ++ A+  A     K
Sbjct  260   IAFYDDNHISIDGDTEIAFTEDVNARFEALGWHTIWVKNGNTGYDEIRAAIKEAKAVKDK  319

Query  1435  PTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMK  1259
             PT I+V T IG  S  +  + + HG+     +V   +Q L W     PF V   +     
Sbjct  320   PTLIKVTTTIGYGSPNKANTYSVHGSALGAKEVDATRQNLGWP--YEPFFVPEDVKSHWS  377

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                 +G  LE EW++K   Y+ KY ++A +   +++G +  GWE +LP + +  P +ATR
Sbjct  378   HHVPEGAALEAEWNAKFAEYEKKYKEDAAELKRIISGELPTGWEKALPTYTLESPADATR  437

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               S +CLN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GVREH M  
Sbjct  438   NLSQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGNF-QKDTPEERNVRFGVREHGMGA  496

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP
Sbjct  497   ICNGIALHSLGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQP  556

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             +EHL   RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV
Sbjct  557   IEHLISFRAMPNILMLRPADGTETAGAYKVAVLNRKRPSILALSRQKL-PQLAGTSVEGV  615

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KGGYIISDNS    P++I++ TG EL +  ++A  LR EG+ VRVVSLV W LF+ Q  
Sbjct  616   EKGGYIISDNSSGNKPDLIVMSTGSELEIAAKAADELRKEGKTVRVVSLVSWELFDEQSD  675

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
             EYKE VLP+ V  R+S+EAGS LGW ++VG +G  IG+D FGAS P   ++K++G T E 
Sbjct  676   EYKESVLPAAVTARISIEAGSTLGWEKFVGTKGKAIGIDRFGASAPAGRIYKEFGITAEK  735

Query  178   VSKTAR  161
             V + AR
Sbjct  736   VIEAAR  741



>ref|XP_010413521.1| PREDICTED: transketolase-1, chloroplastic [Camelina sativa]
Length=742

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/664 (54%), Positives = 461/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  81    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  139

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  140   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQFGSKTPGHPENFETPGIEVTTGPLGQGI  199

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  200   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  259

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  260   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  319

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  320   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  377

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G +LE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  378   TPEGASLESDWTAKFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  437

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I 
Sbjct  438   SQQCLNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAIC  496

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  497   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  556

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  557   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  615

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  616   GGYTISDDSAGNKPDVILIGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQSDEY  675

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  676   KESVLPSAVTARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  735

Query  172   KTAR  161
               A+
Sbjct  736   DAAK  739



>ref|XP_009780210.1| PREDICTED: transketolase, chloroplastic [Nicotiana sylvestris]
Length=743

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/663 (54%), Positives = 458/663 (69%), Gaps = 5/663 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  DK   ++  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P 
Sbjct  73    ETLDKTDAVLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPY  132

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  133   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEEDLKSFRQWGSKTPGHPENFETPGVEVT  192

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++ EA SLA H
Sbjct  193   TGPLGQGIANAVGLALAEKHLAARFNKPDTEIVDHYTYVILGDGCQMEGISQEACSLAGH  252

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +ED+ ARFEALGW+ I V N     + ++ A+  A
Sbjct  253   WGLGKLIAFYDDNHISIDGDTEIAFTEDVGARFEALGWHVIWVKNGNTGYDEIRAAIKEA  312

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              +   KPT I+V T IG  S  +  S + HG+     +V+  +  L W     PFH+   
Sbjct  313   KSVKDKPTMIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRNNLGWP--YEPFHLPED  370

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +       A +G   E EW++K   Y+ KYP EA +  ++  G +  GWE +LP +    
Sbjct  371   VKSHWSRHAAEGAAFETEWNAKFAEYEKKYPVEAAELKSIFTGELPAGWEKALPTYTPES  430

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
               +ATR  S + LN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVR
Sbjct  431   AADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNTPEERNLRFGVR  489

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGED
Sbjct  490   EHGMGAICNGIALHSPGFIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGED  549

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+FRP+DGNETAGAYKVA+  R  PS++ALSRQK+   + G
Sbjct  550   GPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKVAVLRRKTPSILALSRQKL-PQLAG  608

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +G  KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW L
Sbjct  609   TSIEGTAKGGYIVSDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVCWEL  668

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ QP +YKE VLP +V  RVS+EA S  GW++ VGD+G  IG+D FGAS P   ++K++
Sbjct  669   FDEQPADYKESVLPESVTARVSIEAASTFGWQKIVGDKGKAIGIDGFGASAPAGKIYKEF  728

Query  196   GFT  188
             G T
Sbjct  729   GIT  731



>ref|XP_004506536.1| PREDICTED: transketolase, chloroplastic-like [Cicer arietinum]
Length=735

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/732 (51%), Positives = 483/732 (66%), Gaps = 13/732 (2%)
 Frame = -3

Query  2353  PQNNKRLIALRLVQCRSNPKSKSPVLKNTVVSKDEDYRLSWLEELKRAYPSQACSAHEWE  2174
             P   +     RL    S    +SP   +T +S    +       L+R     +    +  
Sbjct  13    PHLTRLTSTTRLSSLPSTISLRSPTTPSTHLSLSHTH-------LRRTSVKSSAVVTQTS  65

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E+      +V++  V+ +R L +D V+ A +GH G+ +G A +G+ +Y  V+R+NP+ PK
Sbjct  66    ENSTADLSLVEK-SVNTIRFLAIDSVEKANSGHPGLPMGCAPMGHVIYDEVLRYNPKNPK  124

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   +  S+TPGHPEN  T G+EVT
Sbjct  125   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKAFRQWESKTPGHPENFETPGVEVT  184

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  I+DH TYCI+GDGC MEG+ NEA SLA H
Sbjct  185   TGPLGQGIANAVGLALAEKHLAARFNKPDNEIIDHYTYCILGDGCQMEGIANEACSLAGH  244

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A
Sbjct  245   WGLGKLIAFYDDNHISIDGDTEIAFTESVEKRFEGLGWHVIWVKNGNTGYDEIRAAIREA  304

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              +   +PT I+V T IG  S  +  S + HG+     +V   +  L W +   PFHV   
Sbjct  305   KSVKDRPTLIKVTTTIGYGSPNKSNSYSVHGSALGAKEVDATRNNLGWSH--EPFHVPAD  362

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW++K   Y+ KY +EA    ++++G +  GWE +LP +    
Sbjct  363   VKKHWSRHIPEGAALESEWNAKFAEYEKKYKEEAAVLKSIISGDLPSGWEKALPTYTPET  422

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN LAKV+PGL+GGSADL SSN   L  +GDF Q DSP  RN+R+GVR
Sbjct  423   PADATRILSQQNLNALAKVLPGLLGGSADLASSNMTLLKTFGDF-QSDSPGERNVRFGVR  481

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGED
Sbjct  482   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAIRLSALSEAGVIYVMTHDSIGLGED  541

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  N+ G
Sbjct  542   GPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PNLAG  600

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W L
Sbjct  601   TSIEGVEKGGYIVSDNSTGNKPDVILIGTGSELEIAYKAAEDLRKEGKAVRVVSFVSWEL  660

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++
Sbjct  661   FDEQSEAYKESVLPAAVSARVSIEAGSTFGWHKIVGSKGKAIGIDRFGASAPAGRIYKEF  720

Query  196   GFTEENVSKTAR  161
             G T+E V   A+
Sbjct  721   GITKEAVIAAAK  732



>ref|NP_001190145.1| transketolase [Arabidopsis thaliana]
 gb|AEE80104.1| transketolase [Arabidopsis thaliana]
Length=740

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 464/664 (70%), Gaps = 7/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQ-EDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  197

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  198   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  257

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  258   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  317

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  318   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  375

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  376   TPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKALPTYTPESPGDATRNL  435

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I 
Sbjct  436   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREHGMGAIC  494

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  495   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  554

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+  ++ GTS +GV K
Sbjct  555   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PHLPGTSIEGVEK  613

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR +G+ VRVVS VCW LF+ Q  EY
Sbjct  614   GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSFVCWELFDEQSDEY  673

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V 
Sbjct  674   KESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVV  733

Query  172   KTAR  161
               A+
Sbjct  734   DAAK  737



>ref|XP_007142668.1| hypothetical protein PHAVU_007G006600g [Phaseolus vulgaris]
 gb|ESW14662.1| hypothetical protein PHAVU_007G006600g [Phaseolus vulgaris]
Length=740

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/687 (52%), Positives = 465/687 (68%), Gaps = 5/687 (1%)
 Frame = -3

Query  2218  KRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             +R   +    A   E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+
Sbjct  55    RRGASTSVVRATAVETLDQTTEVSLVEKSVNTIRFLSIDAVEKANSGHPGLPMGCAPMGH  114

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  +MR+NP+ P WFNRDRF+LSAGHG +LQY  LHLAG+ SVQ +DLK   +  SRT
Sbjct  115   ILYDEIMRYNPKNPTWFNRDRFILSAGHGCMLQYALLHLAGYDSVQEEDLKNFRQWESRT  174

Query  1858  PGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGC  1679
             PGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC
Sbjct  175   PGHPENFETLGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYVILGDGC  234

Query  1678  SMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDN  1499
              MEG++NEA+SLA HW L KL   YDDNH +IDG T++  +E++  RFEALGW+ I V N
Sbjct  235   QMEGISNEASSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKN  294

Query  1498  TQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQK  1322
                  + ++ A+  A     KPT I+V T IG  S  +  S + HG+     +V   ++ 
Sbjct  295   GNTGYDEIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGSKEVDATRKN  354

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             L W     PFHV   + +       +G  LE EW++K   Y+ KY +EA +  A+  G +
Sbjct  355   LGWP--YEPFHVPEDVKKHWSRHVPEGSKLEAEWNAKFAEYEKKYSEEAAELKAIFTGEL  412

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
               GWE +LP +    P +ATR  S + LN L KV+PGL+GGSADL SSN   L  YGDF 
Sbjct  413   PAGWEKALPTYTPESPADATRNLSQQNLNALVKVLPGLLGGSADLASSNMTLLKSYGDF-  471

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
             Q  +P  RN+R+GVREH M  I NGIALH  G IP+ ATF VF+DYM+ +IR+SALS +G
Sbjct  472   QKGTPEERNVRFGVREHGMGAICNGIALHSPGFIPYCATFFVFTDYMRAAIRISALSESG  531

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+YKVA+ NR +PS
Sbjct  532   VIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVLNRKRPS  591

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRN  422
             ++ALSRQK+ A + GTS +GV KGGY ISDNS    P++ILIGTG EL +   +A  LR 
Sbjct  592   ILALSRQKL-AQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAAAADDLRK  650

Query  421   EGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMD  242
             EG+ VRVVS V W LF+ Q  EYKE VLP++V  RVS+EAGS  GW + VG +G  IG+D
Sbjct  651   EGKAVRVVSFVSWELFDEQSDEYKESVLPASVTARVSIEAGSTFGWGKIVGSKGKAIGID  710

Query  241   EFGASGPDTHVFKKYGFTEENVSKTAR  161
              FGAS P   ++K++G T+E +   A+
Sbjct  711   RFGASAPAGKIYKEFGLTKEAIIAAAK  737



>ref|XP_006827830.1| hypothetical protein AMTR_s00009p00268850 [Amborella trichopoda]
 gb|ERM95246.1| hypothetical protein AMTR_s00009p00268850 [Amborella trichopoda]
Length=751

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/671 (54%), Positives = 466/671 (69%), Gaps = 7/671 (1%)
 Frame = -3

Query  2170  DDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKW  1991
             D     E++++  ++ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P W
Sbjct  84    DQTSTTELIEK-SINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYW  142

Query  1990  FNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTT  1811
             FNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T GIEVTT
Sbjct  143   FNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSKTPGHPENFETPGIEVTT  202

Query  1810  GPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHW  1631
             GPLGQGVANAVGLALAE HLA+R+NKP   IVDH T+CI+GDGC MEG++NEA SLA HW
Sbjct  203   GPLGQGVANAVGLALAEKHLAARYNKPGFEIVDHYTFCILGDGCQMEGISNEACSLAGHW  262

Query  1630  KLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAH  1451
              L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A 
Sbjct  263   GLGKLIAFYDDNHISIDGDTEIAFTETVDTRFEGLGWHVIWVKNGNTGYDEIRAAIEEAK  322

Query  1450  TETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPML  1274
                 KPT I+V T IG  S  +  S + HG+     +V   +Q L W     PFHV   +
Sbjct  323   AVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPDDV  380

Query  1273  YREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDP  1094
                      +G +LE EW +KL  Y+ KY +EA +F  L++G +  GWE +LP +    P
Sbjct  381   KSHWSRHVSEGASLEAEWQAKLAEYEKKYKEEAVEFKELISGQLPDGWEKALPVYTAESP  440

Query  1093  VEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVRE  914
              +ATR  S +CLN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVRE
Sbjct  441   ADATRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEQRNVRFGVRE  499

Query  913   HAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDG  734
             H+M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDG
Sbjct  500   HSMGAICNGIALH-SGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDG  558

Query  733   PTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGT  554
             PTHQP+EH+A  RA+P +L+ RP DGNETAGAYKVA+ NR +PS++ALSRQK+   + GT
Sbjct  559   PTHQPIEHIASFRAMPNILMLRPGDGNETAGAYKVAVLNRKRPSVLALSRQKL-PQLAGT  617

Query  553   SADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLF  374
             + +GV KGGYI+SDNS    P++ILIGTG EL +  ++A  +R EG+ VRVVSLV W LF
Sbjct  618   TIEGVEKGGYIVSDNSMRNKPDLILIGTGSELEIAVKAADEIRKEGKAVRVVSLVSWELF  677

Query  373   ERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYG  194
             + Q  +YKE VLP+ V  RVSVEAGS  GW + VG +G  IG+D FGAS P   ++K++G
Sbjct  678   DEQSDDYKESVLPAEVTARVSVEAGSTFGWEKIVGSKGKSIGIDRFGASAPAGTLYKEFG  737

Query  193   FTEENVSKTAR  161
              T +NV   A+
Sbjct  738   ITVDNVIAAAK  748



>gb|KDP28769.1| hypothetical protein JCGZ_14540 [Jatropha curcas]
Length=751

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 457/668 (68%), Gaps = 5/668 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P
Sbjct  80    ETVDATTETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNP  139

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EV
Sbjct  140   YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKNFRQWGSRTPGHPENFETPGVEV  199

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG+ NEA SLA 
Sbjct  200   TTGPLGQGIANAVGLALAEKHLAARYNKPDNEIVDHYTYVILGDGCQMEGIANEACSLAG  259

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T +  +E +  RFE LGW+ I V N     + ++ A+  
Sbjct  260   HWGLGKLIAFYDDNHISIDGDTAIAFTESVDKRFEGLGWHVIWVKNGNTGYDEIRAAIKE  319

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A     KPT I+V T IG  S  +  S + HG+     +V   ++ L W     PFHV  
Sbjct  320   AKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPE  377

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              + +       QG T E EW++K   Y+ KY +EA +  +++ G +  GWE +LP +   
Sbjct  378   DVKKHWSRHVPQGATFEAEWNAKFAEYEKKYKEEAAELKSIITGELPAGWEKALPTYTPE  437

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
             DP EATR  S   LN LAKV+PGL+GGSADL SSN   L  +GDF Q ++P  RN+R+GV
Sbjct  438   DPAEATRNLSQANLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKETPEERNVRFGV  496

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGE
Sbjct  497   REHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGE  556

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  N+ 
Sbjct  557   DGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PNLP  615

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W 
Sbjct  616   GTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAKAAEELRKEGKAVRVVSFVSWE  675

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q   YKE VLP+ V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K+
Sbjct  676   LFDEQSEAYKESVLPAAVEARVSIEAGSTFGWQKIVGAKGKAIGIDRFGASAPAGKIYKE  735

Query  199   YGFTEENV  176
             +G T E V
Sbjct  736   FGLTVEAV  743



>ref|XP_010692960.1| PREDICTED: transketolase, chloroplastic-like [Beta vulgaris subsp. 
vulgaris]
Length=740

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/660 (54%), Positives = 455/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  82    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSAG  141

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV  +DLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  142   HGCMLQYALLHLAGYDSVTEEDLKNFRQWESRTPGHPENFETPGVEVTTGPLGQGIANAV  201

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKP   IVDH TY I+GDGC MEGV+ EA SLA HW L KL   YDD
Sbjct  202   GLALAEKHLAARFNKPGAEIVDHYTYAIVGDGCQMEGVSQEACSLAGHWGLGKLIAFYDD  261

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG TD+  +ED+  RFEALGW+ I V N     + ++ A+  A   T KPT I+V
Sbjct  262   NHISIDGNTDIAFTEDVDKRFEALGWHVIWVKNGNTGYDEIRAAIREAKAVTDKPTLIKV  321

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  +  L W +   PFHV   + +       +G
Sbjct  322   TTTIGYGSPNKANSYSVHGSALGAKEVEATRSNLGWPH--EPFHVSEDVKKHWSRHTPEG  379

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY  EA +  +++ G +  GWE +LP +    P +ATR  S +C
Sbjct  380   AALEAEWNAKFAEYERKYKDEAAELKSIITGELPSGWENALPTYTTESPADATRNLSQQC  439

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GVREHAM  I NGIA
Sbjct  440   LNALAKVLPGFLGGSADLASSNMTLLKMFGNF-QKDTPEERNLRFGVREHAMGSICNGIA  498

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              H  G IP+ ATF VF+DYM+ SIR++ALS AGVI++MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  499   HHSPGFIPYCATFFVFTDYMRASIRMAALSQAGVIFVMTHDSIGLGEDGPTHQPIEHLAS  558

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DG ETAGAYKVA   R  P+++ALSRQK+   + GTS +GV KGGY+
Sbjct  559   FRAMPNVLMLRPADGTETAGAYKVAALKRKTPAILALSRQKL-PQLAGTSVEGVEKGGYV  617

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++IL+GTG EL +  ++A  LR EG+ VRVVS V W LF+ QP  YKE V
Sbjct  618   ISDNSKANKPDVILMGTGSELEIAAKAADELRKEGKAVRVVSFVSWELFDAQPDSYKESV  677

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EAGS  GW +YVG +G  IG+D FGAS P   ++K++G T+E V + A+
Sbjct  678   LPSDVTARVSIEAGSTFGWLKYVGSKGKAIGIDRFGASAPAGKIYKEFGITKEAVVEAAK  737



>ref|XP_010098926.1| Transketolase [Morus notabilis]
 gb|EXB76228.1| Transketolase [Morus notabilis]
Length=746

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/689 (53%), Positives = 468/689 (68%), Gaps = 7/689 (1%)
 Frame = -3

Query  2218  KRAYPSQ--ACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEV  2045
             +RA  S+  A  A   E  D   +  +  + ++ +R L +D V+ A +GH G+ +G A +
Sbjct  59    RRAKSSRGGAVRAAAVETLDKTTETSLVEKSINTIRFLAIDAVEKANSGHPGLPMGCAPM  118

Query  2044  GYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGS  1865
             G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS
Sbjct  119   GHVLYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKNFRQWGS  178

Query  1864  RTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGD  1685
             RTPGHPEN  T GIEVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GD
Sbjct  179   RTPGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYAILGD  238

Query  1684  GCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITV  1505
             GC MEG++NEA SLA HW L KL   YDDNH +IDG TD+  +E++  RFEALGW+ I V
Sbjct  239   GCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTDIAFTENVGQRFEALGWHVIWV  298

Query  1504  DNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMK  1328
              N     + ++ A+  A     KPT I+V T IG  S  +  S + HG+     +V   +
Sbjct  299   KNGNTGYDDIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATR  358

Query  1327  QKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNG  1148
             + L W     PFHV   + +       +G  LE EW++K   Y+ KY +EA +  +++ G
Sbjct  359   KNLGWP--FEPFHVPEDVKQHWSRHTPEGAALEAEWNAKFAEYEKKYSEEAAELKSIITG  416

Query  1147  GIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGD  968
              +  GWE +LP +    P +ATR  S + LN LAKV+PGL+GGSADL SSN   L  +GD
Sbjct  417   ELPAGWEKALPTYTPESPADATRNLSQQNLNALAKVLPGLLGGSADLASSNMTLLKMFGD  476

Query  967   FEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSH  788
             F Q D+P  RN+R+GVREH M  I NGIALH  GL P+ ATF VF+DYM+ +IR+SAL  
Sbjct  477   F-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLFPYCATFFVFTDYMRAAIRISALCE  535

Query  787   AGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDK  608
             AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +
Sbjct  536   AGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNVLMLRPADGNETAGAYKVAVLNRKR  595

Query  607   PSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVL  428
             PS++ALSRQK+   + GTS +GV KGGYI+SDNS    P++ILIGTG EL +  ++A  L
Sbjct  596   PSILALSRQKL-PQLPGTSIEGVEKGGYIVSDNSSGNKPDVILIGTGSELEIAAKAAEEL  654

Query  427   RNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIG  248
             R EG+ VRVVSLV W LF+ Q   YKE V P+ V  RVS+EAGS  GW + VG +G  IG
Sbjct  655   RKEGKAVRVVSLVSWELFDEQSDAYKESVFPAAVSARVSIEAGSTFGWEKIVGSKGKAIG  714

Query  247   MDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             ++ FGAS P   ++K++G T E V   A+
Sbjct  715   INSFGASAPAGKIYKEFGITPEAVIAAAK  743



>ref|XP_009116754.1| PREDICTED: transketolase-1, chloroplastic-like [Brassica rapa]
Length=738

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/664 (55%), Positives = 458/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  77    IVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  135

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  136   LSAGHGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  195

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL  
Sbjct  196   ANAVGLALAEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIA  255

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  256   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  315

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  316   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFKVPDEVKSHWSRH  373

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
                G+ LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  374   TPDGKALESDWNAAFSAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  433

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R GVREH M  I 
Sbjct  434   SQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRLGVREHGMGAIC  492

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  493   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPVE  552

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HLA  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  553   HLASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  611

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++IL+GTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  612   GGYTISDNSSGNKPDVILVGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQTDEY  671

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EA S  GW + VG EG  IG++ FGAS P   ++K++G T E V 
Sbjct  672   KESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSFGASAPAPLLYKEFGITVEAVV  731

Query  172   KTAR  161
               A+
Sbjct  732   DAAK  735



>ref|XP_010419543.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=730

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/664 (54%), Positives = 461/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A +G+ L+  VM++NP+ P WFNRDRF+
Sbjct  69    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPIGHILFDEVMKYNPKNPYWFNRDRFI  127

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV+  DLK   +  SRTPGHPEN  T G+EVTTGPLGQG+
Sbjct  128   LSAGHGCMLHYALLHLAGYDSVREQDLKNFRQWESRTPGHPENFETPGVEVTTGPLGQGI  187

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL  
Sbjct  188   ANAVGLALAEKHLAARFNKPDSQIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIA  247

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E+++ RFEALGW+ I V N     + ++ A+  A     KPT
Sbjct  248   FYDDNHISIDGDTEIAFTENVATRFEALGWHVIWVKNGNTGYDDIRAAIKEAKAVQDKPT  307

Query  1429  FIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I++ T IG  S  +  S + HG+   E +V   ++ L W    GPFHV   +       
Sbjct  308   LIKITTTIGYGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YGPFHVPEDVKSHWSRH  365

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE EW++K   Y+ KYPQEA +  +++   +  GWE SLP +    P +ATR  
Sbjct  366   VSEGAALETEWNAKFADYEKKYPQEAAELKSIVTVNLPTGWEKSLPTYTPESPADATRNL  425

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVREH+M  I 
Sbjct  426   SQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNAPEERNLRFGVREHSMGAIC  484

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGI  H  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  485   NGITCHSPGLIPYCATFFVFTDYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPIE  544

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV K
Sbjct  545   HVASFRAMPNILMLRPADGTETAGAYKVAVENRKRPSILALSRQKL-PHLPGTSVEGVEK  603

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY+ISDNS    P++IL+GTG EL +  ++   LR EGR VRVVSLV W LF+ Q  EY
Sbjct  604   GGYVISDNSTGNRPDVILMGTGSELEIAAKAGEKLRGEGRAVRVVSLVSWELFDEQSEEY  663

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++KK+G T + V 
Sbjct  664   KESVLPSEVSARVSIEAGSTFGWEKMVGCKGKAIGVDSFGASAPADVLYKKFGLTVDAVV  723

Query  172   KTAR  161
               A+
Sbjct  724   AAAK  727



>ref|XP_003605140.1| Transketolase [Medicago truncatula]
 gb|AES87337.1| plastid transketolase [Medicago truncatula]
Length=735

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/660 (55%), Positives = 457/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L VD V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  77    KSVNTIRFLAVDSVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPFWFNRDRFVLSAG  136

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+++DLK+  +  SRTPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  137   HGCMLQYALLHLAGYDSVKVEDLKQFRQWESRTPGHPENFETPGIEVTTGPLGQGIANAV  196

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  I+DH TYCI+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  197   GLALAEKHLAARFNKPDNEIIDHYTYCILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  256

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     +PT I+ 
Sbjct  257   NHISIDGDTEIAFTESVEKRFEGLGWHVIWVKNGNTGFDEIRAAIKEAKAVKDRPTLIKF  316

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +  L W     PFHV   + +       +G
Sbjct  317   TTTIGYGSPNKSNSYSVHGSALGAKEVDATRNNLGWP--YEPFHVPEDVKKHWSRHIREG  374

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA    ++++G +  GWE +LP +    P +ATR  S + 
Sbjct  375   AALESEWNAKFADYEKKYKEEAAVLKSIISGDLPAGWEKALPTYTPEIPADATRNLSQQN  434

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LA V+PGLIGGSADL SSN   L  +GDF Q DSP  RN+R+GVREH M  I NGIA
Sbjct  435   LNALANVLPGLIGGSADLASSNMTLLKKFGDF-QSDSPAERNVRFGVREHGMGAICNGIA  493

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  494   LHSRGLIPYCATFFVFTDYMRGAIRLSALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  553

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  N+ GTS +GV KGGYI
Sbjct  554   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PNLAGTSIEGVEKGGYI  612

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P++ILIGTG EL +  ++   LR EG+ VRVVS V W LF+ Q + YKE V
Sbjct  613   VSDNSTGNKPDVILIGTGSELEIAYKAGEDLRKEGKAVRVVSFVSWELFDEQSQAYKESV  672

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  673   LPTAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGTIYKEFGITKEAVIAAAK  732



>ref|XP_008460106.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
 ref|XP_008460107.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
Length=745

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/673 (54%), Positives = 460/673 (68%), Gaps = 5/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P
Sbjct  74    ETLDKTTETSLIEKSVNTIRFLSIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNP  133

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   +  SRTPGHPEN  T GIEV
Sbjct  134   YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKNFRQWESRTPGHPENFETPGIEV  193

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQGVANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA 
Sbjct  194   TTGPLGQGVANAVGLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGIANEACSLAG  253

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +E +  RF+ALGW+ I V N     + ++ A+  
Sbjct  254   HWGLGKLIAFYDDNHISIDGDTEIAFTESVDKRFDALGWHVIWVKNGNNGYDEIRAAIRE  313

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A     KPT I+V T IG  S  +  S + HG+     +V   +Q L W     PFHV  
Sbjct  314   AKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPE  371

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              + +       QG  LE EW++K   Y+ KY +EA +  ++++G +  GWE +LP +   
Sbjct  372   DVKKHWSRHTPQGAALEAEWNAKFAEYEKKYAEEAAELKSIISGKLPAGWEKALPTYTPE  431

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S + LN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GV
Sbjct  432   SPADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLLKSFGNF-QKDTPEERNLRFGV  490

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGE
Sbjct  491   REHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSQAGVIYVMTHDSIGLGE  550

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  N+ 
Sbjct  551   DGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PNLP  609

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGYI+SDNS    P++ILIGTG EL +  ++A  LR EG+ VR+VS V W 
Sbjct  610   GTSIEGVEKGGYILSDNSSGNKPDVILIGTGSELEIAAKAAEELRKEGKAVRLVSFVSWE  669

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF  Q   YKE VLP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K+
Sbjct  670   LFNEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKE  729

Query  199   YGFTEENVSKTAR  161
             +G T E V   A+
Sbjct  730   FGITVEAVIAAAK  742



>sp|Q7SIC9.1|TKTC_MAIZE RecName: Full=Transketolase, chloroplastic; Short=TK [Zea mays]
 pdb|1ITZ|A Chain A, Maize Transketolase In Complex With Tpp
 pdb|1ITZ|B Chain B, Maize Transketolase In Complex With Tpp
 pdb|1ITZ|C Chain C, Maize Transketolase In Complex With Tpp
Length=675

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/661 (54%), Positives = 461/661 (70%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSA
Sbjct  17    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSA  76

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK+  + GSRTPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  77    GHGCMLQYALLHLAGYDSVKEEDLKQFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANA  136

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YD
Sbjct  137   VGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIAFYD  196

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+S RFEALGW+TI V N     + ++ A+  A   T KPT I+
Sbjct  197   DNHISIDGDTEIAFTEDVSTRFEALGWHTIWVKNGNTGYDDIRAAIKEAKAVTDKPTLIK  256

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V+  +Q L W      F V   +         +
Sbjct  257   VTTTIGFGSPNKANSYSVHGSALGAKEVEATRQNLGWP--YDTFFVPEDVKSHWSRHTPE  314

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G  LE +W++K   Y+ KY  +A    +++ G +  GW  +LP++    P +ATR  S +
Sbjct  315   GAALEADWNAKFAEYEKKYADDAATLKSIITGELPTGWVDALPKYTPESPGDATRNLSQQ  374

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LA VVPGLIGGSADL SSN   L  +GDF Q D+   RN+R+GVREH M  I NGI
Sbjct  375   CLNALANVVPGLIGGSADLASSNMTLLKMFGDF-QKDTAEERNVRFGVREHGMGAICNGI  433

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  G +P+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL 
Sbjct  434   ALHSPGFVPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLV  493

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV KGGY
Sbjct  494   SFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGY  552

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              ISDNS    P++I++GTG EL +  ++A  LR EG+ VRVVS V W LF+ Q  EYKE 
Sbjct  553   TISDNSTGNKPDLIVMGTGSELEIAAKAADELRKEGKTVRVVSFVSWELFDEQSDEYKES  612

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++K+YG T E++   A
Sbjct  613   VLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKFGASAPAGTIYKEYGITVESIIAAA  672

Query  163   R  161
             +
Sbjct  673   K  673



>ref|XP_009391858.1| PREDICTED: transketolase, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=751

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 462/660 (70%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM +NP+ P WFNRDRFVLSAG
Sbjct  94    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMNYNPKNPYWFNRDRFVLSAG  153

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+++DLK+  + GS+TPGHPEN  T GIEVTTGPLGQGVANAV
Sbjct  154   HGCMLQYALLHLAGYDSVKMEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGVANAV  213

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  I+DH TY ++GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  214   GLALAERHLAARFNKPDNEIIDHYTYVMLGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  273

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED   RFEALGW+TI V N     + ++ A+  A     KPT I+V
Sbjct  274   NHISIDGDTEIAFTEDAIDRFEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTLIKV  333

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  + + HG+     +V   +Q L W     PF+V   +       A +G
Sbjct  334   TTTIGYGSPNKANTYSVHGSALGAKEVDATRQSLEWP--YEPFYVPEDVKSHWSRHAPEG  391

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW+++   Y+ KY ++A +  A+++G +  GWE +LPR+    P +ATR  S + 
Sbjct  392   AALEAEWNARFAEYEEKYKEDAAELKAIISGELPAGWEKALPRYTPESPADATRNLSQQN  451

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +G+F Q  +P  RN+R+GVREH M  I NGIA
Sbjct  452   LNALAKVLPGLLGGSADLASSNMTLLKMFGNF-QKGTPEERNVRFGVREHGMGAICNGIA  510

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GL+P+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL  
Sbjct  511   LHSPGLLPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLIS  570

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS + V KGGY 
Sbjct  571   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSVLALSRQKL-PQLPGTSIEDVEKGGYT  629

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLVCW LF+ QP EYKE V
Sbjct  630   ISDNSTGNKPDLILIGTGSELEIAAKAADELRKEGKTVRVVSLVCWELFDEQPDEYKESV  689

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              P+ V  R+S+EAG  LGW +YVG +G  IG+D FGAS P   ++K++G T E++   A+
Sbjct  690   FPAAVTARISIEAGVTLGWEKYVGSKGKAIGIDRFGASAPAGRIYKEFGITAESIIAAAK  749



>ref|XP_010426578.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=733

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/664 (54%), Positives = 461/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A +G+ L+  VM++NP+ P WFNRDRF+
Sbjct  71    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMGHILFDEVMKYNPKNPYWFNRDRFI  129

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV+  DLK   +  SRTPGHPEN  T G+EVTTGPLGQG+
Sbjct  130   LSAGHGCMLHYALLHLAGYDSVREQDLKNFRQWESRTPGHPENFETPGVEVTTGPLGQGI  189

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL  
Sbjct  190   ANAVGLALAEKHLAARFNKPDSQIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIA  249

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E+++ RFEALGW+ I V N     + ++ A+  A     KPT
Sbjct  250   FYDDNHISIDGDTEIAFTENVATRFEALGWHVIWVKNGNTGYDDIRAAIKEAKAVQDKPT  309

Query  1429  FIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I++ T IG  S  +  S + HG+   E +V   ++ L W    GPFHV   +       
Sbjct  310   LIKITTTIGYGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YGPFHVPEDVKSHWSRH  367

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE EW++K   Y+ KYPQEA +  +++   +  GWE SLP +    P +ATR  
Sbjct  368   VSEGAALETEWNAKFADYEKKYPQEAAELKSIVTVNLPTGWEKSLPTYTPESPADATRNL  427

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVREH+M  I 
Sbjct  428   SQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNAPEERNLRFGVREHSMGAIC  486

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGI  H  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  487   NGITCHSPGLIPYCATFFVFTDYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPIE  546

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV K
Sbjct  547   HVASFRAMPNILMLRPADGTETAGAYKVAVENRKRPSILALSRQKL-PHLPGTSVEGVEK  605

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY+ISDNS    P++IL+GTG EL +  ++   LR EGR VRVVSLV W LF+ Q  EY
Sbjct  606   GGYVISDNSTGNRPDVILMGTGSELEIAAKAGEKLRGEGRAVRVVSLVSWELFDEQSEEY  665

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++KK+G T + V 
Sbjct  666   KESVLPSEVSARVSIEAGSTFGWEKMVGCKGKAIGIDSFGASAPADVLYKKFGLTVDAVV  725

Query  172   KTAR  161
               A+
Sbjct  726   AAAK  729



>ref|XP_003556551.1| PREDICTED: transketolase, chloroplastic [Glycine max]
 gb|KHN27089.1| Transketolase, chloroplastic [Glycine soja]
Length=740

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/660 (55%), Positives = 458/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRF+LSAG
Sbjct  82    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPTWFNRDRFILSAG  141

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV  +DLK   + GSRTPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  142   HGCMLQYALLHLAGYDSVLEEDLKEFRQWGSRTPGHPENFETVGIEVTTGPLGQGIANAV  201

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL  LYDD
Sbjct  202   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIALYDD  261

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  262   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTMIKV  321

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   + +       +G
Sbjct  322   TTTIGFGSPNKANSYSVHGSALGTKEVDATRKNLGWP--YEPFHVPEDVKKHWSRHTPEG  379

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +  A++ G +  GWE +LP +    P +ATR  S + 
Sbjct  380   AKLEAEWNAKFAEYEKKYSEEAAELKAIITGELPAGWEKALPTYTPESPADATRNLSQQN  439

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PGL+GGSADL SSN   L  YGDF Q ++P  RN+R+GVREH M  I NGIA
Sbjct  440   LNALVKVLPGLLGGSADLASSNMTLLKSYGDF-QKNTPEERNVRFGVREHGMGAICNGIA  498

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  499   LHSPGFIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  558

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+ RP+DGNETAG+YKVA+ NR +PS++ALSRQK+   + GTS +GV KGGYI
Sbjct  559   FRAMPNTLMLRPADGNETAGSYKVAVVNRKRPSILALSRQKL-TQLPGTSIEGVEKGGYI  617

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +   +A  LR EG+ VRVVS V W LF+ Q  EYKE V
Sbjct  618   ISDNSSGNKPDVILIGTGSELEIAAAAAEDLRKEGKAVRVVSFVSWELFDEQSDEYKESV  677

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP++V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  678   LPASVTVRVSIEAGSTFGWQKIVGSQGKAIGIDRFGASAPAGKIYKEFGITKEAVIAAAK  737



>emb|CDO97702.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/672 (53%), Positives = 460/672 (68%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K    +  + ++ +R L VD V+ A +GH G+ +G A +G+ LY  VM++NP+ P 
Sbjct  75    ETLEKTDTALVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPY  134

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+  + GS+TPGHPEN  T G+EVT
Sbjct  135   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQFRQWGSKTPGHPENFETPGVEVT  194

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEGV+NE  SLA H
Sbjct  195   TGPLGQGIANAVGLALAEKHLAARYNKPDAEIVDHYTYAILGDGCQMEGVSNEVCSLAGH  254

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +E +  RFEALGW+ I V N     + ++ A+  A
Sbjct  255   WGLGKLIAFYDDNHISIDGDTEIAFTESVELRFEALGWHVIWVKNGNTGYDEIRAAIKEA  314

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
                  KPT I+V T IG  S  +  S + HG+     +V+  +Q L W     PFHV   
Sbjct  315   KAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVEATRQNLGWP--YEPFHVPED  372

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +        G   E EW++K   Y+ KYP+EA +  +L+ G +  GWE +LP +    
Sbjct  373   VKKHWSRHVPVGAAYEAEWNAKFAEYEKKYPEEAAELKSLITGELPAGWEKALPAYTPES  432

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN L KV+PGL+GGSADL SSN   L  +GDF Q  +P  RN+R+GVR
Sbjct  433   PADATRNLSQQNLNALVKVLPGLLGGSADLASSNMTLLKMFGDF-QKKTPEERNVRFGVR  491

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GL+P+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGED
Sbjct  492   EHGMGSICNGIALHSPGLLPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGED  551

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAG+YKVA+ NR +PS++ALSRQK+   + G
Sbjct  552   GPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVLNRKRPSILALSRQKL-PQLAG  610

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYIISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLV W L
Sbjct  611   TSIEGVAKGGYIISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSLVSWEL  670

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q  EYKE V P+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K+ 
Sbjct  671   FDEQSAEYKESVFPAAVTARVSIEAGSTFGWEKIVGPKGKAIGIDRFGASAPAGKIYKEL  730

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  731   GITAEAVVAAAK  742



>ref|XP_004160671.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
Length=745

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  87    KSVNTIRFLSIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSAG  146

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   +  SRTPGHPEN  T GIEVTTGPLGQGVANAV
Sbjct  147   HGCMLQYALLHLAGYDSVKEEDLKNFRQWESRTPGHPENFETPGIEVTTGPLGQGVANAV  206

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  207   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  266

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  267   NHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNNGYDEIRAAIREAKAVKDKPTLIKV  326

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +       QG
Sbjct  327   TTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKKHWSRHTPQG  384

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +   +++G +  GWE +LP +    P +ATR  S + 
Sbjct  385   AALEAEWNAKFAEYEKKYAEEAAELKGIISGELPAGWEKALPTYTPESPADATRNLSQQN  444

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GVREH M  I NGIA
Sbjct  445   LNALAKVLPGFLGGSADLASSNMTLLKSFGNF-QKDTPEERNLRFGVREHGMGAICNGIA  503

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  504   LHSPGLIPYCATFFVFTDYMRAAIRISALSQAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  563

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ N+ +PS++ALSRQK+  N+ GTS +GV KGGYI
Sbjct  564   FRAMPNILMLRPADGNETAGAYKVAVLNQKRPSILALSRQKL-PNLPGTSIEGVEKGGYI  622

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P++ILIGTG EL +  ++A  LR EG+ VR+VS V W LF  Q   YKE V
Sbjct  623   LSDNSSGNKPDVILIGTGSELEIAAKAAEELRKEGKAVRLVSFVSWELFNEQSDAYKESV  682

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  683   LPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITVEAVIAAAK  742



>dbj|BAD67886.1| putative transketolase 1 [Oryza sativa Japonica Group]
 dbj|BAD68864.1| putative transketolase 1 [Oryza sativa Japonica Group]
Length=633

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/635 (56%), Positives = 452/635 (71%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  VMR+NP+ P WFNRDRF+LSAGHG +LQY  LHLAG+ +V  +DLK+
Sbjct  1     MGCAPMGHILYDEVMRYNPKNPYWFNRDRFILSAGHGCMLQYALLHLAGYDAVLEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS+TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             YCI+GDGC MEG++NEA SLA HW L KL   YDDNH +IDG T++  +ED+SARFEALG
Sbjct  121   YCILGDGCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKNGNDGYDEIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGTK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  ++ L W     PF V   +         QG   E +W++K   Y+ KYP++A   
Sbjct  241   EVEATRENLGWP--YEPFFVPEDVKSHWSRHVPQGAAFEADWNAKFAEYEKKYPEDAATL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              ++++G +  GW  +LP++    P +ATR  S +CLN LAKVVPGL+GGSADL SSN   
Sbjct  299   KSIVSGELPAGWADALPKYTPESPADATRNLSQQCLNALAKVVPGLLGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R
Sbjct  359   LKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYK+A
Sbjct  418   ISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKIA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+ A + GTS +GV KGGYI+SDNS    P+ I++ TG EL +  
Sbjct  478   VLNRKRPSVLALSRQKL-AQLPGTSIEGVEKGGYIVSDNSTGNKPDFIVMSTGSELEIVA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR EG+ VRVVS VCW LF+ Q  EYKE VLP  V  RVS+EAGS LGW++YVG 
Sbjct  537   KAADELRKEGKTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGS  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D+FGAS P   ++++YG T ENV  TA+
Sbjct  597   KGKAIGIDKFGASAPAGKIYQEYGITAENVIATAK  631



>ref|XP_010934663.1| PREDICTED: transketolase, chloroplastic-like [Elaeis guineensis]
Length=746

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/687 (52%), Positives = 471/687 (69%), Gaps = 7/687 (1%)
 Frame = -3

Query  2218  KRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             +R+  ++A +    EE      E +  + ++ +R L VD V+ A +GH G+ +G A +G+
Sbjct  64    RRSAVTRAAAVETLEEK--AATEALLEKSINTIRFLAVDAVEKANSGHPGLPMGCAPIGH  121

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+T
Sbjct  122   ILYDEVMRYNPKNPFWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKAFRQWGSKT  181

Query  1858  PGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGC  1679
             PGHPEN  T G+EVTTGPLGQG+ANAVGLAL E HLASRFNKPD+ IVDH TY I+GDGC
Sbjct  182   PGHPENFETLGVEVTTGPLGQGIANAVGLALVEKHLASRFNKPDMEIVDHYTYVILGDGC  241

Query  1678  SMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDN  1499
              MEG++NE  SLA HW L KL   YDDNH +IDG T++  +ED++ARF+ALGW+TI V N
Sbjct  242   QMEGISNEVCSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVNARFDALGWHTIWVKN  301

Query  1498  TQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQK  1322
                  + ++ A+  A     KPT I+V T IG  S  +  + + HG+     +V+  +Q 
Sbjct  302   GNTGYDEIRAAIKEAKAVKDKPTLIKVTTTIGFGSPNKANTYSVHGSALGAKEVEATRQN  361

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             L W     PF V   +         +G  LE EW++K   Y+ KY +EA +   ++ G +
Sbjct  362   LGWP--YEPFFVPEDVKSHWSRHVLEGPVLEAEWNAKFVQYEKKYKEEAAELKQIITGEL  419

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
               GWE + P +    P +ATR  S +CLN LAKV+PG +GGSADL SSN   L  +GDF 
Sbjct  420   PAGWEEAFPTYTPESPADATRNLSQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-  478

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
             Q D+P  RN+R+GVREH M  I NGIALH  G+IP+ ATF VF+DYM+ +IR+SALS AG
Sbjct  479   QKDTPEERNLRFGVREHGMGAICNGIALHSLGMIPYCATFFVFTDYMRAAIRISALSEAG  538

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYKVAI NR +PS
Sbjct  539   VIYVMTHDSIGLGEDGPTHQPIEHLISFRAMPNILMLRPADGNETAGAYKVAILNRKRPS  598

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRN  422
             ++ALSRQK+   + GTSA+ V KGGY ISDNS    P++I++ TG EL +  ++A  LR 
Sbjct  599   ILALSRQKL-PQLAGTSAERVAKGGYTISDNSSGNKPDLIIMSTGSELEIAAKAADELRK  657

Query  421   EGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMD  242
             EG+ VRVVSLV W LF+ Q  EYKE +LP++V  R+S+EAG+ LGW ++VG  G  IG+D
Sbjct  658   EGKTVRVVSLVSWELFDEQSDEYKESILPASVTARISIEAGATLGWEKFVGAGGKSIGID  717

Query  241   EFGASGPDTHVFKKYGFTEENVSKTAR  161
              FGAS P   ++K++G T E V + A+
Sbjct  718   RFGASAPGGRIYKEFGITAEKVIEAAK  744



>ref|XP_004964449.1| PREDICTED: transketolase, chloroplastic-like isoform X2 [Setaria 
italica]
Length=784

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/687 (53%), Positives = 476/687 (69%), Gaps = 10/687 (1%)
 Frame = -3

Query  2206  PSQACSAH----EWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             PS  C+ H    E  E +    +++++ CV+ +R L +D V++AK+GH GM +G A +G+
Sbjct  101   PSTKCAVHAIAIETLERNAASGQLLEK-CVNTIRFLAIDAVENAKSGHAGMPMGCAALGH  159

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  L+LAG+ S+   +LK+L + GSRT
Sbjct  160   ILYDEVMRYNPKNPYWFNRDRFVLSAGHGCVLQYALLYLAGYDSISEHELKQLGQWGSRT  219

Query  1858  PGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGC  1679
             PGHPE+ +T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKP   IVDH TY I+GDGC
Sbjct  220   PGHPESFLTAGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPGSEIVDHYTYVILGDGC  279

Query  1678  SMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDN  1499
              MEG++NEA SLA HW L KL   YDDNH ++DG T +  +ED+SARFEALGW+TI V N
Sbjct  280   QMEGISNEACSLAGHWGLGKLIAFYDDNHISVDGDTGIAFTEDVSARFEALGWHTIWVKN  339

Query  1498  TQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTS-KAHHGTFEEDDVKQMKQK  1322
                  + ++ A+  A   T +PT I+V T IG  S  +  S  AH G     +V+  +  
Sbjct  340   GNTGYDDIREAIKQAKAVTDRPTLIKVTTTIGFGSPNKANSYSAHGGPLGTKEVEATRHN  399

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             L W     PF V   +         QG+ LE +W++K   Y+ KYP++A     +++G +
Sbjct  400   LGWP--YEPFFVPEDVKSHWSHHVPQGDALEADWNAKFAEYEKKYPEDAATLKIIISGEL  457

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
                W   LP++  + P +ATR  S +CLN LAKV+PGL+GGSADL  SN   L  +GDF 
Sbjct  458   PADWVDVLPKYTQASPADATRNLSQQCLNALAKVLPGLLGGSADLAPSNMTLLKMFGDF-  516

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
             Q D+P  RN+R+GVREH M  I NGIALH  GL+P+ AT+  FSDYM+ ++R+SALS AG
Sbjct  517   QRDTPEERNVRFGVREHGMGAICNGIALHSPGLVPYCATYFAFSDYMRAAMRVSALSEAG  576

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VI+IMTHDSIG+G++GPTHQP+EHL   R +P +LV RP+DGNETAGAYKVA+ NR +PS
Sbjct  577   VIHIMTHDSIGVGKNGPTHQPIEHLMSFRTMPNILVLRPADGNETAGAYKVAVLNRKRPS  636

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRN  422
             ++ALS QK+  ++ GTS +GV KGGYIISDNS    P++I++ TG EL +  ++A  LR 
Sbjct  637   VLALSMQKL-PHLPGTSVEGVEKGGYIISDNSTGNKPDLIMLSTGSELQIAVKAADELRK  695

Query  421   EGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMD  242
             EG+ VRVVSLVCW LFE Q  EYKE VLP +V  R+SVEAG  LGW++YVG +G +IG+D
Sbjct  696   EGKAVRVVSLVCWELFEEQSDEYKESVLPESVTARISVEAGCTLGWQKYVGTKGKIIGID  755

Query  241   EFGASGPDTHVFKKYGFTEENVSKTAR  161
              FGAS P   +F++YG T  +V   AR
Sbjct  756   RFGASAPGEKIFEEYGITVGSVITAAR  782



>ref|XP_004145002.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 ref|XP_004154093.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 gb|KGN46249.1| hypothetical protein Csa_6G077460 [Cucumis sativus]
Length=745

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  87    KSVNTIRFLSIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSAG  146

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   +  SRTPGHPEN  T GIEVTTGPLGQGVANAV
Sbjct  147   HGCMLQYALLHLAGYDSVKEEDLKNFRQWESRTPGHPENFETPGIEVTTGPLGQGVANAV  206

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  207   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  266

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  267   NHISIDGHTEIAFTENVDKRFEALGWHVIWVKNGNNGYDEIRAAIREAKAVKDKPTLIKV  326

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   +Q L W     PFHV   + +       QG
Sbjct  327   TTTIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWP--YEPFHVPEDVKKHWSRHTPQG  384

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +   +++G +  GWE +LP +    P +ATR  S + 
Sbjct  385   AALEAEWNAKFAEYEKKYAEEAAELKGIISGELPAGWEKALPTYTPESPADATRNLSQQN  444

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GVREH M  I NGIA
Sbjct  445   LNALAKVLPGFLGGSADLASSNMTLLKSFGNF-QKDTPEERNLRFGVREHGMGAICNGIA  503

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  504   LHSPGLIPYCATFFVFTDYMRAAIRISALSQAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  563

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ N+ +PS++ALSRQK+  N+ GTS +GV KGGYI
Sbjct  564   FRAMPNILMLRPADGNETAGAYKVAVLNQKRPSILALSRQKL-PNLPGTSIEGVEKGGYI  622

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P++ILIGTG EL +  ++A  LR EG+ VR+VS V W LF  Q   YKE V
Sbjct  623   LSDNSSGNKPDVILIGTGSELEIAAKAAEELRKEGKAVRLVSFVSWELFNEQSDAYKESV  682

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  683   LPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITVEAVIAAAK  742



>ref|XP_010544646.1| PREDICTED: transketolase-1, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=739

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/673 (54%), Positives = 458/673 (68%), Gaps = 5/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  V  + ++ +R L +D VQ A +GH G+ +G A +G+ LY  VMR+NP+ P
Sbjct  68    ETIDTTTEASVVEKSINTIRFLAIDAVQKANSGHPGLPMGCAPMGHILYDEVMRYNPKNP  127

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T GIEV
Sbjct  128   YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKNFRQWGSRTPGHPENFETPGIEV  187

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+AN VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA 
Sbjct  188   TTGPLGQGIANGVGLALAERHLAARFNKPDSEIVDHYTYVILGDGCQMEGISNEACSLAG  247

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  
Sbjct  248   HWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKE  307

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A     KPT I+V T IG  S  +  S + HG+   E +V+  ++ L W     P HV  
Sbjct  308   AKAVKDKPTLIKVTTTIGFGSPNKANSYSVHGSALGEKEVEATRKNLGWP--YEPLHVPD  365

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +         +G  LE +W++K   Y+ KYP+EA +  A++ G +  GWE +LP +   
Sbjct  366   DVKSHWSRHTPEGAALEADWNAKFAEYEKKYPEEAAELKAIITGELPSGWEKALPTYTPE  425

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S +CLN LA VVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GV
Sbjct  426   SPGDATRNLSQQCLNALANVVPGFLGGSADLASSNMTLLKMFGDF-QKGTPEERNLRFGV  484

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGI LH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGE
Sbjct  485   REHGMGAICNGITLHSPGLIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGE  544

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQPVEHL   RA+P +L+FRP+DGNETAGAYK+A++ R  PS++ALSRQK+   + 
Sbjct  545   DGPTHQPVEHLVSFRAMPNILMFRPADGNETAGAYKIAVSKRKTPSVLALSRQKL-PQLP  603

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW 
Sbjct  604   GTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAKAAEELRKEGKAVRVVSFVCWE  663

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF  Q   YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K+
Sbjct  664   LFAEQSDAYKESVLPSDVSARVSIEAGSTFGWEKVVGSKGKAIGIDSFGASAPAGLLYKE  723

Query  199   YGFTEENVSKTAR  161
             +G T + V   A+
Sbjct  724   FGITVDAVIAAAK  736



>ref|XP_007052090.1| Transketolase [Theobroma cacao]
 gb|EOX96247.1| Transketolase [Theobroma cacao]
Length=745

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/686 (53%), Positives = 462/686 (67%), Gaps = 5/686 (1%)
 Frame = -3

Query  2215  RAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYF  2036
             R+Y ++   A   E      +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ 
Sbjct  61    RSYQNRQVRAAAVETIGTAAETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHI  120

Query  2035  LYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTP  1856
             LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV  +DLK   + GS+TP
Sbjct  121   LYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVLEEDLKNFRQWGSKTP  180

Query  1855  GHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCS  1676
             GHPEN  T G+EVTTGPLGQGVANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC 
Sbjct  181   GHPENFETLGVEVTTGPLGQGVANAVGLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQ  240

Query  1675  MEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNT  1496
             MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N 
Sbjct  241   MEGIANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTESVDKRFEGLGWHVIWVKNG  300

Query  1495  QGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKL  1319
                 + ++ A+  A     KPT I++ T IG  S  +  S + HG+     +V   ++ L
Sbjct  301   NTGYDDIRAAIKEAKAVKDKPTLIKLTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNL  360

Query  1318  RWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIV  1139
              W     PFHV   +         QG  LE EW++K   Y+ KY +EA +   ++ G + 
Sbjct  361   GWP--YEPFHVPEDVKTHWSRHVPQGAALEAEWNAKFAEYEKKYKEEAAELKTIITGELP  418

Query  1138  PGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQ  959
              GWE +LP +    P +ATR  S + LN L KV+PGL+GGSADL SSN   L  YGDF Q
Sbjct  419   AGWEKALPTYTPESPPDATRNLSQQNLNALVKVLPGLLGGSADLASSNMTLLKMYGDF-Q  477

Query  958   PDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGV  779
              D+P  RN+R+GVREH M  ISNGIALH  GLIP+ ATF VF+DYM+ +IR+SAL  AGV
Sbjct  478   KDTPEERNVRFGVREHGMGAISNGIALHSPGLIPYCATFFVFTDYMRAAIRISALCEAGV  537

Query  778   IYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSL  599
             IY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS+
Sbjct  538   IYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSI  597

Query  598   MALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNE  419
             +ALSRQK+   + GTS +GV KGGYI+SDNS    P++ILIGTG EL +  ++A  LRN 
Sbjct  598   LALSRQKL-PQLAGTSIEGVEKGGYIVSDNSSGNKPDVILIGTGSELEIAAKAAEELRNG  656

Query  418   GRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDE  239
             G+ VRVVSLV W LF+ Q   YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D 
Sbjct  657   GKAVRVVSLVSWELFDEQSDAYKESVLPSAVSARVSIEAGSTFGWEKIVGSKGKSIGIDR  716

Query  238   FGASGPDTHVFKKYGFTEENVSKTAR  161
             FGAS P   ++K++G T E V   A+
Sbjct  717   FGASAPAGRIYKEFGLTPEAVVTAAK  742



>emb|CDX89074.1| BnaA04g01120D [Brassica napus]
Length=735

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 458/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  77    KSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFVLSAG  136

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  137   HGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETRGIEVTTGPLGQGIANAV  196

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL   YDD
Sbjct  197   GLALAEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIAFYDD  256

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT I+V
Sbjct  257   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPTLIKV  316

Query  1417  KTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG    E +V+  +  L W     PF V   +         +G
Sbjct  317   TTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPEEVKSHWSRHTPEG  374

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
             + LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  S +C
Sbjct  375   KALESDWNATFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNLSQQC  434

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I NGIA
Sbjct  435   LNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAICNGIA  493

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EH+A 
Sbjct  494   LHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIAS  553

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  554   FRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVAKGGYT  612

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISD+S    P++ILIGTG EL +  ++A V+R EG+ VRVVS VCW LF+ Q  EYKE V
Sbjct  613   ISDDSTGNKPDVILIGTGSELEIAAQAAEVIRKEGKTVRVVSFVCWELFDEQTDEYKESV  672

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V   A+
Sbjct  673   LPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVVDAAK  732



>ref|XP_010541872.1| PREDICTED: transketolase, chloroplastic-like [Tarenaya hassleriana]
Length=743

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 457/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ AK+GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  85    KSVNTIRFLAIDAVEKAKSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  144

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  145   HGCMLQYALLHLAGYDSVKEEDLKNFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  204

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL  LYDD
Sbjct  205   GLALAEKHLAARFNKPDNEIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIALYDD  264

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     KPT I++
Sbjct  265   NHISIDGDTEIAFTESVERRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKI  324

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+   E +V   ++ L W     PFHV   +         +G
Sbjct  325   TTTIGFGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YEPFHVPEDVKSHWSRHISEG  382

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW+SK   Y+ +YPQEA +  +++ G    GWE +LP +   +P +ATR  S +C
Sbjct  383   SNLEAEWNSKFAEYEREYPQEAAELKSIITGQFPAGWEKALPTFTPENPGDATRNLSQQC  442

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +G+F Q D+P  RN+R+GVREH M  I NGI 
Sbjct  443   LNALAKVLPGFLGGSADLASSNMTLLKMFGNF-QKDTPEERNLRFGVREHGMGAICNGIT  501

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              H  G+IP+ ATF VF+DYM+ +IRLSALS  GVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  502   CHSPGIIPYCATFFVFTDYMRAAIRLSALSQTGVIYVMTHDSIGLGEDGPTHQPIEHLAS  561

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNET+GAY+VAI NR +PS++ALSRQK+   + GTS + V KGGY+
Sbjct  562   FRAMPNILMLRPADGNETSGAYRVAILNRKRPSILALSRQKL-PQLPGTSIEAVQKGGYV  620

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS  + P++ILIGTG EL +  ++A  LR EG+ VRVVSLV W LF+ Q  EYKE +
Sbjct  621   VSDNSTGKYPDVILIGTGSELEIAAKAAEQLRKEGKAVRVVSLVSWELFDEQSEEYKESI  680

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T + V   A+
Sbjct  681   LPRAVSARVSIEAGSTFGWEKIVGSKGKSIGIDRFGASAPANVLYKEFGLTVDGVIAAAK  740



>ref|XP_009138817.1| PREDICTED: transketolase-1, chloroplastic [Brassica rapa]
Length=735

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 458/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  77    KSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFVLSAG  136

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQG+ANAV
Sbjct  137   HGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETPGIEVTTGPLGQGIANAV  196

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL   YDD
Sbjct  197   GLALAEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIAFYDD  256

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT I+V
Sbjct  257   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPTLIKV  316

Query  1417  KTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG    E +V+  +  L W     PF V   +         +G
Sbjct  317   TTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPEEVKSHWSRHTPEG  374

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
             + LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  S +C
Sbjct  375   KALESDWNATFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNLSQQC  434

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I NGIA
Sbjct  435   LNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAICNGIA  493

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EH+A 
Sbjct  494   LHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIAS  553

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  554   FRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVAKGGYT  612

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISD+S    P++ILIGTG EL +  ++A V+R EG+ VRVVS VCW LF+ Q  EYKE V
Sbjct  613   ISDDSTGNKPDVILIGTGSELEIAAQAAEVIRKEGKTVRVVSFVCWELFDEQTDEYKESV  672

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V   A+
Sbjct  673   LPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVVDAAK  732



>ref|NP_001267600.1| transketolase [Cucumis sativus]
 ref|XP_004155784.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 gb|AEQ59483.1| chloroplast transketolase [Cucumis sativus]
 gb|KGN56609.1| hypothetical protein Csa_3G126240 [Cucumis sativus]
Length=742

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 455/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P WFNRDRF+LSAG
Sbjct  84    KSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFILSAG  143

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  144   HGCMLQYALLHLAGYDSVREEDLKSFRQWESRTPGHPENFETPGVEVTTGPLGQGIANAV  203

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL  LYDD
Sbjct  204   GLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIALYDD  263

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  264   NHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIQEAKAVKDKPTMIKV  323

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  +  L W     PFHV   + +        G
Sbjct  324   TTTIGFGSPNKANSYSVHGSALGAKEVEATRSNLGWP--YEPFHVPEDVQKHWSRHTPLG  381

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KYP+EA +  +++ G +  GWE +LP++    P +ATR  S +C
Sbjct  382   ADFEAEWNAKFAEYEKKYPEEAAELKSIITGELPAGWEDALPKYTPESPGDATRNLSQQC  441

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  YGDF Q ++P  RN+R+GVREH M  I NGIA
Sbjct  442   LNALAKVLPGFLGGSADLASSNMTLLKMYGDF-QKNTPEERNLRFGVREHGMGAICNGIA  500

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  501   LHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  560

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+FRP+DGNETAGAYKVA+ NR +PS+MALSRQK+  ++ GTS +GV KGGYI
Sbjct  561   FRAMPNILMFRPADGNETAGAYKVAVVNRKRPSIMALSRQKL-PHLPGTSIEGVEKGGYI  619

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SDNS    P++ILIGTG EL +  ++   LR EG+ VRVVS V W LF+ Q   YKE V
Sbjct  620   VSDNSSGNKPDVILIGTGSELEIAFQAGEELRKEGKAVRVVSFVSWELFDDQSDAYKESV  679

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP  V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   AR
Sbjct  680   LPEAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGLTVEAVVAAAR  739



>ref|XP_010456321.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=733

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ AK+GH G+ +G A +G+ L+  VM +NP+ P WFNRDRF+LSAG
Sbjct  75    KSVNTIRFLAIDAVEKAKSGHPGLPMGCAPMGHILFDEVMNYNPKNPYWFNRDRFILSAG  134

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+  DLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  135   HGCMLQYALLHLAGYDSVREQDLKNFRQWESRTPGHPENFETPGVEVTTGPLGQGIANAV  194

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  195   GLALAEKHLAARFNKPDSQIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  254

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFE LGW+ I V N     + ++ A+  A     KPT I++
Sbjct  255   NHISIDGDTEIAFTENVETRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVQDKPTLIKI  314

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+   E +V   ++ L W    GPFHV   +         +G
Sbjct  315   TTTIGYGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YGPFHVPEDVKSHWSRHVSEG  372

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KYPQEA +  +++   +  GWE SLP +    P +ATR  S +C
Sbjct  373   AALETEWNAKFADYEKKYPQEAAELKSIVTVNLPTGWEKSLPTYTPESPADATRNLSQQC  432

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVREH+M  I NGI 
Sbjct  433   LNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNAPEERNLRFGVREHSMGAICNGIT  491

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              H  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+EH+A 
Sbjct  492   CHSPGLIPYCATFFVFTDYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPIEHVAS  551

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV KGGY+
Sbjct  552   FRAMPNILMLRPADGTETAGAYKVAVENRKRPSILALSRQKL-PHLPGTSVEGVEKGGYV  610

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++IL+GTG EL +  ++   LR EGR VRVVSLV W LF+ Q  EYKE V
Sbjct  611   ISDNSTGNRPDVILMGTGSELEIAAKAGEKLRGEGRAVRVVSLVSWELFDEQSEEYKESV  670

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++KK+G T + V   A+
Sbjct  671   LPSEVSARVSIEAGSTFGWEKMVGCKGKAIGVDSFGASAPADVLYKKFGLTVDAVVAAAK  730



>gb|AGH33875.1| transketolase [Camellia sinensis]
Length=747

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/672 (53%), Positives = 465/672 (69%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P 
Sbjct  77    ETLNKTETALVDKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPC  136

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  137   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEEDLKGFRQWGSKTPGHPENFETPGVEVT  196

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA H
Sbjct  197   TGPLGQGIANAVGLALAERHLAARFNKPDSEIVDHYTYVILGDGCQMEGIANEACSLAGH  256

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A
Sbjct  257   WGLGKLIAFYDDNHISIDGDTEIAFTECVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKEA  316

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              T T KPT I+V T IG  S  +  S + HG+     +V   ++ L W     PFHV   
Sbjct  317   KTVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPED  374

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW++K   Y+ KY +EA +  ++++G +  GWE +LP +    
Sbjct  375   VKKHWSRHVPEGAALEAEWNAKFAEYEKKYKEEAAELKSIISGELPAGWEKALPTYTPES  434

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVR
Sbjct  435   PADATRNLSQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNTPEERNLRFGVR  493

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGI  H  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGED
Sbjct  494   EHGMGAICNGIDHHTPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGED  553

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQPVEHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+ +++ G
Sbjct  554   GPTHQPVEHLASFRAMPNVLMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-SHLPG  612

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGY +SDNS +  P++IL+GTG EL +  ++A  LR EG+ VRVVS V W L
Sbjct  613   TSVEGVEKGGYTVSDNSSDNKPDVILMGTGSELEIASKAADELRKEGKAVRVVSFVSWEL  672

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YK+ VLP+ V  RVS+EAGS  GW +++G +G  IG+D FGAS P   ++K++
Sbjct  673   FDEQSDAYKDSVLPAAVTARVSIEAGSTFGWTKHIGSKGKAIGIDRFGASAPAGKIYKEF  732

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  733   GITAEAVIAAAK  744



>gb|KHN37298.1| Transketolase, chloroplastic [Glycine soja]
Length=742

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAG
Sbjct  84    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPAWFNRDRFVLSAG  143

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +VQ  DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  144   HGCMLQYALLHLAGYDTVQEQDLKEFRQWGSRTPGHPENFETLGVEVTTGPLGQGIANAV  203

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL  LYDD
Sbjct  204   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIALYDD  263

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  264   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  323

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   + +       +G
Sbjct  324   TTTIGFASPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPEDVKKHWSRHTPEG  381

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ +Y +EA +  A++ G +  GWE +LP +    P +ATR  S + 
Sbjct  382   AKLEAEWNAKFVEYEKQYSEEAAELKAIITGELPAGWEKALPTYTPESPADATRNLSQQN  441

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PGL+GGSADL SSN   L  YGDF Q ++P  RN+R+GVREH M  I NGIA
Sbjct  442   LNALVKVLPGLLGGSADLASSNMTLLKSYGDF-QKNTPEERNVRFGVREHGMGAICNGIA  500

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  501   LHSPGFIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  560

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+ RP+DGNETAG+YKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  561   FRAMPNTLMLRPADGNETAGSYKVAVVNRKRPSILALSRQKL-TQLPGTSIEGVEKGGYT  619

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +   +A  LR EG+ VRVVS V W LF+ Q  EYKE V
Sbjct  620   ISDNSSGNKPDVILIGTGSELEIAAAAAEDLRKEGKAVRVVSFVSWELFDEQSDEYKESV  679

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP++V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  680   LPASVTARVSIEAGSTFGWHKIVGSKGKAIGIDRFGASAPAGKIYKEFGITKEAVIAAAK  739



>ref|XP_010524370.1| PREDICTED: transketolase-1, chloroplastic-like [Tarenaya hassleriana]
Length=740

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/673 (53%), Positives = 460/673 (68%), Gaps = 5/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + ++ +R L +D V+ AK+GH G+ +G A +G+ LY  VMR+NP+ P
Sbjct  69    ETIDATTEASLVEKSINTIRFLAIDAVEKAKSGHPGLPMGCAPMGHVLYDEVMRYNPKNP  128

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +L Y  LHLAG+ SV+ +DLK   +  SRTPGHPEN  T GIEV
Sbjct  129   YWFNRDRFVLSAGHGCMLHYALLHLAGYDSVKEEDLKNFRQWESRTPGHPENFETPGIEV  188

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLALAE HLA+RFN+PD  IVDH TY I+GDGC MEG+++EA SLA 
Sbjct  189   TTGPLGQGIANAVGLALAERHLAARFNQPDNEIVDHYTYVILGDGCQMEGISHEACSLAG  248

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL  LYDDNH +IDG TD+  +E +  RFEALGW+ I V N     + +  A+  
Sbjct  249   HWGLGKLIALYDDNHISIDGDTDIAFTESVDQRFEALGWHVIWVKNGNTGYDEIHAAIKE  308

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A T   KPT I+V T IG  S  +  S + HG+   E +V   ++ L W     PFHV  
Sbjct  309   AKTVKDKPTLIKVTTTIGFGSPNKANSYSVHGSALGEKEVGATRKNLGWP--YEPFHVPD  366

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +         +G  LE +W++K   Y+ KYP EA +  A++ G +  GWE +LP +   
Sbjct  367   DVKSHWSRHTPEGAALEADWNAKFAEYEKKYPDEAAELRAIITGELPSGWEKALPTYTPE  426

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S +CLN LA VVPG +GGSADL SSN   L  +G+F Q ++P  RN+R+GV
Sbjct  427   SPADATRNLSQQCLNALASVVPGFLGGSADLASSNMTLLKTFGNF-QKETPEERNLRFGV  485

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGE
Sbjct  486   REHGMGAICNGIALHSPGLIPYNATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGE  545

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+FRP+DGNETAGAYK+A++ R +PS++ALSRQK+   + 
Sbjct  546   DGPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKIAVSKRKRPSVLALSRQKL-PQLP  604

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KG Y ISDNS    P+ ILIGTG EL +  ++A  LR EG+ VRVVS VCW 
Sbjct  605   GTSVEGVEKGAYTISDNSSGNKPDAILIGTGSELEIAAKAADELRKEGKAVRVVSFVCWE  664

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q   YKE VLPS V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K+
Sbjct  665   LFDEQSDAYKESVLPSDVSARVSIEAGTTFGWEKIVGSKGKAIGIDSFGASAPAGRLYKE  724

Query  199   YGFTEENVSKTAR  161
             +G T + V   A+
Sbjct  725   FGITVDAVVGAAK  737



>gb|EAY99538.1| hypothetical protein OsI_21507 [Oryza sativa Indica Group]
Length=628

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/630 (56%), Positives = 449/630 (71%), Gaps = 5/630 (1%)
 Frame = -3

Query  2047  VGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLG  1868
             +G+ LY  VMR+NP+ P WFNRDRF+LSAGHG +LQY  LHLAG+ +V  +DLK+  + G
Sbjct  1     MGHILYDEVMRYNPKNPYWFNRDRFILSAGHGCMLQYALLHLAGYDAVLEEDLKQFRQWG  60

Query  1867  SRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMG  1688
             S+TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TYCI+G
Sbjct  61    SKTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYCILG  120

Query  1687  DGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTIT  1508
             DGC MEG++NEA SLA HW L KL   YDDNH +IDG T++  +ED+SARFEALGW+TI 
Sbjct  121   DGCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFEALGWHTIW  180

Query  1507  VDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQM  1331
             V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     +V+  
Sbjct  181   VKNGNDGYDEIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGTKEVEAT  240

Query  1330  KQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLN  1151
             ++ L W     PF V   +         QG   E +W++K   Y+ KYP++A    ++++
Sbjct  241   RENLGWP--YEPFFVPEDVKSHWSRHVPQGAAFEADWNAKFAEYEKKYPEDAATLKSIVS  298

Query  1150  GGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYG  971
             G +  GW  +LP++    P +ATR  S +CLN LAKVVPGL+GGSADL SSN   L  +G
Sbjct  299   GELPAGWADALPKYTPESPADATRNLSQQCLNALAKVVPGLLGGSADLASSNMTLLKMFG  358

Query  970   DFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALS  791
             DF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SAL 
Sbjct  359   DF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMRISALC  417

Query  790   HAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRD  611
              AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYK+A+ NR 
Sbjct  418   EAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKIAVLNRK  477

Query  610   KPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGV  431
             +PS++ALSRQK+ A + GTS +GV KGGYI+SDNS    P+ I++ TG EL +  ++A  
Sbjct  478   RPSVLALSRQKL-AQLPGTSIEGVEKGGYIVSDNSTGNKPDFIVMSTGSELEIVAKAADE  536

Query  430   LRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVI  251
             LR EG+ VRVVS VCW LF+ Q  EYKE VLP  V  RVS+EAGS LGW++YVG +G  I
Sbjct  537   LRKEGKTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAI  596

Query  250   GMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             G+D+FGAS P   ++++YG T ENV  TA+
Sbjct  597   GIDKFGASAPAGKIYQEYGITAENVIATAK  626



>emb|CAB82679.1| transketolase-like protein [Arabidopsis thaliana]
Length=754

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/677 (53%), Positives = 468/677 (69%), Gaps = 19/677 (3%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  80    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  139   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT
Sbjct  259   FYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHV-------IPML  1274
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V       +  L
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSCLDDL  376

Query  1273  YREMKLQAE------QGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPR  1112
               ++   +       +G TLE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP 
Sbjct  377   LFDLHFSSHWSRHTPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKALPT  436

Query  1111  WLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNI  932
             +    P +ATR  S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+
Sbjct  437   YTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNL  495

Query  931   RYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSI  752
             R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSI
Sbjct  496   RFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSI  555

Query  751   GLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVA  572
             GLGEDGPTHQP+EH+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+ 
Sbjct  556   GLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-  614

Query  571   ANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSL  392
              ++ GTS +GV KGGY ISD+S    P++ILIGTG EL +  ++A VLR +G+ VRVVS 
Sbjct  615   PHLPGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSF  674

Query  391   VCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTH  212
             VCW LF+ Q  EYKE VLPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   
Sbjct  675   VCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPL  734

Query  211   VFKKYGFTEENVSKTAR  161
             ++K++G T E V   A+
Sbjct  735   LYKEFGITVEAVVDAAK  751



>emb|CAA75777.1| transketolase 1 [Capsicum annuum]
Length=744

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/672 (53%), Positives = 459/672 (68%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K    +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P 
Sbjct  74    ETLEKTDNALVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPIGHILYDEIMRYNPKNPY  133

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  134   WFNRDRFVLSAGHGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPENFETPGVEVT  193

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLAL+E HLA+RFNKP   IVDH TYCI+GDGC MEG++ EAASLA H
Sbjct  194   TGPLGQGIANAVGLALSEKHLAARFNKPGAEIVDHYTYCILGDGCQMEGISQEAASLAGH  253

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +ED+ ARFEALGW+ I V N     + ++ A+  A
Sbjct  254   WGLGKLIAFYDDNHISIDGDTEIAFTEDVGARFEALGWHVIWVKNGNTGYDEIRAAIKEA  313

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
                T KPT I+V T IG  S  +  S + HG+     +V+  +Q L W     PFHV   
Sbjct  314   KAVTDKPTMIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRQNLGWP--YEPFHVPED  371

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +         +G  LE  W++K   Y+ KYP+EA    +++ G +  GWE +LP +    
Sbjct  372   VKSHWSRHVPEGAALEAGWNTKFAEYEKKYPEEAADLKSIITGELPAGWEKALPTYTPES  431

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN LAKV+PG +GGSADL SSN   +  +GDF Q ++P  RN+R+GVR
Sbjct  432   PADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLMKMFGDF-QKNTPEERNLRFGVR  490

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS + VIY+MTHDSIGLGED
Sbjct  491   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSESRVIYVMTHDSIGLGED  550

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVAI     PS++ALSRQK+   + G
Sbjct  551   GPTHQPIEHLASFRAMPNVLMLRPADGNETAGAYKVAILKSKTPSILALSRQKL-PQLAG  609

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +G  KGGY+ SDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLV W L
Sbjct  610   TSIEGTAKGGYVTSDNSSGNNPDVILIGTGSELEIAVKAADELRKEGKAVRVVSLVSWEL  669

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q  EYKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K+Y
Sbjct  670   FDEQSAEYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEY  729

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  730   GITAEAVIAAAK  741



>emb|CDY48374.1| BnaC04g22010D [Brassica napus]
Length=735

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 457/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  77    KSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFVLSAG  136

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +L Y  LHLAG+ SV  +DLK   + GS+TPGHPEN  T GIEVTTGPLGQGVANAV
Sbjct  137   HGCMLLYALLHLAGYDSVLEEDLKSFRQWGSKTPGHPENFETPGIEVTTGPLGQGVANAV  196

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEAASLA HW L KL   YDD
Sbjct  197   GLALAEKHLAARFNKPDAEVVDHYTYVILGDGCQMEGISNEAASLAGHWGLGKLIAFYDD  256

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A T T KPT I+V
Sbjct  257   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPTLIKV  316

Query  1417  KTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG    E +V+  +  L W     PF V   +         +G
Sbjct  317   TTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDEVKSHWSRHTPEG  374

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
             + LE +W++   +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  S +C
Sbjct  375   KALESDWNATFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNLSQQC  434

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I NGIA
Sbjct  435   LNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAICNGIA  493

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SALS  GVIY+MTHDSIGLGEDGPTHQP+EH+A 
Sbjct  494   LHSPGLIPYCATFFVFTDYMRGAMRISALSETGVIYVMTHDSIGLGEDGPTHQPIEHIAS  553

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  554   FRAMPNTLMFRPADGNETAGAYKIAVNKRKTPSILALSRQKL-PQLPGTSMEGVAKGGYT  612

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISD+S    P++ILIGTG EL +  ++A V+R EG+ VRVVS VCW LF+ Q  EYKE V
Sbjct  613   ISDDSSGNKPDVILIGTGSELEIAAQAAEVIRKEGKTVRVVSFVCWELFDEQTDEYKESV  672

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V   A+
Sbjct  673   LPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAVVDAAK  732



>ref|XP_002511690.1| transketolase, putative [Ricinus communis]
 gb|EEF50359.1| transketolase, putative [Ricinus communis]
Length=752

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/660 (54%), Positives = 455/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +M++NP+ P WFNRDRFVLSAG
Sbjct  94    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMKYNPKNPYWFNRDRFVLSAG  153

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  154   HGCMLQYALLHLAGYDSVKEEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAV  213

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  214   GLALAEKHLAARFNKPDNEIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  273

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFEALGW+ I V N     + ++ A+  A   T KPT I+V
Sbjct  274   NHISIDGDTEIAFTESVDKRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPTMIKV  333

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   +          G
Sbjct  334   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--FEPFHVPEDVKNHWSRHIPGG  391

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KY +EA +  +++ G +  GWE +LP +    P +ATR  S   
Sbjct  392   AAFEAEWNAKFAEYEKKYKEEAAELKSIIKGELPAGWEKALPTYTPESPADATRNLSQAN  451

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  452   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  510

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  511   LHSPGLIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  570

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+FRP+DGNETAGAY++A+ NR +PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  571   FRAMPNILMFRPADGNETAGAYRIAVLNRKRPSVLALSRQKL-PQLPGTSIEGVEKGGYT  629

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE V
Sbjct  630   ISDNSSGNKPDVILIGTGSELEIAAKAAEELRREGKAVRVVSFVSWELFDEQSDAYKESV  689

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K+YG T E V   A+
Sbjct  690   LPAAVTARVSIEAGSTFGWQKIVGGKGKAIGIDRFGASAPAGKIYKEYGITAEAVIAAAK  749



>gb|KFK30590.1| hypothetical protein AALP_AA6G001400 [Arabis alpina]
Length=718

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/665 (54%), Positives = 460/665 (69%), Gaps = 6/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             E+VD+  V+ +R L +D V+ AK+GH G+ +G A +G+ L+  V+++NP+ P WFNRDRF
Sbjct  56    ELVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMGHILFDEVIKYNPKNPYWFNRDRF  114

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHG +L Y  LHLAG+ SV+ +DL    +  SRTPGHPEN  T G+EVTTGPLGQG
Sbjct  115   ILSAGHGCMLHYALLHLAGYDSVREEDLNNFRQWESRTPGHPENFETPGVEVTTGPLGQG  174

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL 
Sbjct  175   IANAVGLALAEKHLAARFNKPDYEIVDHYTYAILGDGCQMEGIANEACSLAGHWGLGKLI  234

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG T++  +E++  RFE LGW+ I V N     + ++ A+  A     KP
Sbjct  235   AFYDDNHISIDGDTEIAFTENVETRFEGLGWHVIWVKNGNTGYDDIRAAIKEAKAVKDKP  294

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I++ T IG  S  +  S + HG+   E +V   ++ L W    GPFHV   +      
Sbjct  295   TLIKITTTIGFGSPNKANSYSVHGSALGEKEVDATRKNLGWP--YGPFHVPEDVKSHWSR  352

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                QG   E EW++K   Y+ KYPQEA +  +++   +  GWE SLP +    P +ATR 
Sbjct  353   HIPQGAAFESEWNAKFADYEKKYPQEAAELKSIVTVNLPNGWEKSLPTYTPESPADATRN  412

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S +CLN LAKV+PG +GGSADL SSN   L  +GDF Q ++P  RN+R+GVREH+M  I
Sbjct  413   LSQQCLNALAKVLPGFLGGSADLASSNMTLLKMFGDF-QKNAPEERNLRFGVREHSMGAI  471

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGI  H  GLIP+ ATF VF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQP+
Sbjct  472   CNGITCHSPGLIPYCATFFVFTDYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPI  531

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A  RA+P +L+ RP+DG ETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV 
Sbjct  532   EHIASFRAMPNILMLRPADGTETAGAYKVAVENRKRPSILALSRQKL-PHLPGTSIEGVE  590

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY+ISDNS    P++IL+GTG EL +  ++   LR EGR VRVVSLV W LF+ Q +E
Sbjct  591   KGGYVISDNSRGNKPDVILMGTGSELEIAAKAGEKLREEGRAVRVVSLVSWELFDEQSQE  650

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++KK+G T + V
Sbjct  651   YKESVLPSEVSARVSIEAGSTFGWEKMVGSKGKAIGVDSFGASAPADVLYKKFGLTVDAV  710

Query  175   SKTAR  161
                A+
Sbjct  711   VAAAK  715



>ref|XP_003536788.1| PREDICTED: transketolase, chloroplastic-like [Glycine max]
Length=742

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/660 (54%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAG
Sbjct  84    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPAWFNRDRFVLSAG  143

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +VQ  DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  144   HGCMLQYALLHLAGYDTVQEQDLKEFRQWGSRTPGHPENFETLGVEVTTGPLGQGIANAV  203

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL  LYDD
Sbjct  204   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIALYDD  263

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  264   NHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  323

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   + +       +G
Sbjct  324   TTTIGFGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPEDVKKHWSRHTPEG  381

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ +Y +EA +  A++ G +  GWE +LP +    P +ATR  S + 
Sbjct  382   AKLEAEWNAKFVEYEKQYSEEAAELKAIITGELPAGWEKALPTYTPESPADATRNLSQQN  441

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PGL+GGSADL SSN   L  YGDF Q ++P  RN+R+GVREH M  I NGIA
Sbjct  442   LNALVKVLPGLLGGSADLASSNMTLLKSYGDF-QKNTPEERNVRFGVREHGMGAICNGIA  500

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  501   LHSPGFIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  560

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P  L+ RP+DGNETAG+YKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  561   FRAMPNTLMLRPADGNETAGSYKVAVVNRKRPSILALSRQKL-TQLPGTSIEGVEKGGYT  619

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +   +A  LR EG+ VRVVS V W LF+ Q  EYKE V
Sbjct  620   ISDNSSGNKPDVILIGTGSELEIAAAAAEDLRKEGKAVRVVSFVSWELFDEQSDEYKESV  679

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP++V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  680   LPASVTARVSIEAGSTFGWHKIVGSKGKAIGIDRFGASAPAGKIYKEFGITKEAVIAAAK  739



>ref|XP_011090550.1| PREDICTED: transketolase, chloroplastic [Sesamum indicum]
Length=735

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/683 (53%), Positives = 468/683 (69%), Gaps = 7/683 (1%)
 Frame = -3

Query  2206  PSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYR  2027
             P +A +A E  E      E+V++  ++ +R L +D V+ A +GH G+ +G A +G+ LY 
Sbjct  56    PVRASAAVETLEKTTD-TELVEK-SINTIRFLSIDAVEKANSGHPGLPMGCAPMGHILYD  113

Query  2026  HVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHP  1847
              VM++NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GSRTPGHP
Sbjct  114   EVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDAVKEEDLKSFRQWGSRTPGHP  173

Query  1846  ENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEG  1667
             EN  T G+EVTTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG
Sbjct  174   ENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARYNKPDNEIVDHYTYVILGDGCQMEG  233

Query  1666  VTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGD  1487
             ++NEA SLA HW L KL   YDDNH +IDG T++  +E +  RFEALGW+ I V N    
Sbjct  234   ISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEALGWHVIWVKNGNTG  293

Query  1486  MEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWD  1310
              + ++ A+  A     KPT I+V T IG  S  +  S + HG+     +V+  ++ L W 
Sbjct  294   YDEIRTAIKEAKAVKDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRKNLGWP  353

Query  1309  NGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGW  1130
                 PFHV   +       A +G   E EW+++   Y+ KYP+EA +  ++  G +  GW
Sbjct  354   --FEPFHVPEDVKNHWSRHASEGAAYEAEWNARFAEYEKKYPEEAAELKSIFTGELPAGW  411

Query  1129  ETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDS  950
             E +LP +    P +ATR  S + LN LAKV+PGL+GGSADL SSN   L  +GDF Q ++
Sbjct  412   EKALPTYTPESPGDATRNLSQQNLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKNT  470

Query  949   PRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYI  770
             P  RN+R+GVREH M  I NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+
Sbjct  471   PEERNVRFGVREHGMGAICNGIALHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYV  530

Query  769   MTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMAL  590
             MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+YKVA+ NR +PS++AL
Sbjct  531   MTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVLNRKRPSVLAL  590

Query  589   SRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRR  410
             SRQK+   + GTS +GV KGGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ 
Sbjct  591   SRQKL-PQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKA  649

Query  409   VRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGA  230
             VRVVS V W LF+ Q  EYKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D FGA
Sbjct  650   VRVVSFVSWELFDEQSDEYKESVLPAAVTARVSIEAGSTFGWEKIVGAKGKAIGIDRFGA  709

Query  229   SGPDTHVFKKYGFTEENVSKTAR  161
             S P   ++K++G T E V   A+
Sbjct  710   SAPAGKIYKEFGITAEAVIAAAK  732



>ref|XP_007220240.1| hypothetical protein PRUPE_ppa001865mg [Prunus persica]
 gb|EMJ21439.1| hypothetical protein PRUPE_ppa001865mg [Prunus persica]
Length=752

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/673 (53%), Positives = 462/673 (69%), Gaps = 5/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P
Sbjct  81    ETLDKTTETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNP  140

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EV
Sbjct  141   YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKGFRQWGSKTPGHPENFETPGVEV  200

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG++NEAASLA 
Sbjct  201   TTGPLGQGIANAVGLALAEKHLAARYNKPDSEIVDHYTYVILGDGCQMEGISNEAASLAG  260

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  
Sbjct  261   HWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKE  320

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A   T +PT I+V T IG  S  +  S + HG      +V   ++ L W     PFHV  
Sbjct  321   AKAVTDRPTLIKVTTTIGFGSPNKANSYSVHGAALGAKEVDATRKNLGWP--YEPFHVPE  378

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +         +G  LE EW++K   Y+ KY +EA +  ++++G +  GWE +LP +   
Sbjct  379   DVKSHWSRHTAEGSALEAEWNAKFAEYEKKYKEEAAELKSIISGELPAGWEKALPTYTPE  438

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
             +P +ATR  S   LN LAKV+PGL+GGSADL SSN   L  +GDF Q ++P  RN+R+GV
Sbjct  439   NPADATRNLSQANLNALAKVLPGLLGGSADLASSNMTLLKSFGDF-QKNTPEERNVRFGV  497

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGE
Sbjct  498   REHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGE  557

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAY+VA+ NR +PS++ALSRQK+  N+ 
Sbjct  558   DGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYRVAVLNRKRPSILALSRQKL-PNLP  616

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGYIISDNS    P++ILI TG EL +  ++   LR EG+ VRVVS V W 
Sbjct  617   GTSIEGVEKGGYIISDNSSGNKPDVILIATGSELEIVFKAGEELRKEGKAVRVVSFVSWE  676

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q   YKE VLP+ V  RVS+EAGS  GW++ VG +G  IG+D FGAS P   ++K+
Sbjct  677   LFDGQSDAYKESVLPAAVTARVSIEAGSTFGWQKLVGSKGKAIGIDHFGASAPAGKIYKE  736

Query  199   YGFTEENVSKTAR  161
             +G T E V   A+
Sbjct  737   FGLTVEAVIAAAK  749



>ref|XP_010513752.1| PREDICTED: transketolase-1, chloroplastic-like [Camelina sativa]
Length=777

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/659 (54%), Positives = 459/659 (70%), Gaps = 6/659 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+++R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  81    IVDK-SVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFNRDRFV  139

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SVQ +DLK+  + GS+TPGHPEN  T GIEVTTGPLGQG+
Sbjct  140   LSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQFGSKTPGHPENFETPGIEVTTGPLGQGI  199

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC MEG++NEA SLA HW L KL  
Sbjct  200   ANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGISNEACSLAGHWGLGKLIA  259

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  260   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPT  319

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  320   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPDDVKSHWSRH  377

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G +LE +W +K  +Y+ KYP+EA +  +++ G +  GWE +LP +    P +ATR  
Sbjct  378   TPEGASLESDWTAKFAAYEKKYPEEAAELKSIITGELPAGWEKALPTYTPESPGDATRNL  437

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN +AKVVPG +GGSADL SSN   L   GDF Q  +P  RN+R+GVREH M  I 
Sbjct  438   SQQCLNAIAKVVPGFLGGSADLASSNMTLLKASGDF-QKATPEERNLRFGVREHGMGAIC  496

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  497   NGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  556

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             H+A  RA+P  L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS +GV K
Sbjct  557   HIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQKL-PQLPGTSIEGVEK  615

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISD+S    P++ILIGTG EL +  ++A VLR EG+ VRVVS VCW LF+ Q  EY
Sbjct  616   GGYTISDDSAGNKPDVILIGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELFDEQSDEY  675

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             KE VLP+ V  RVS+EA S  GW + VG +G  IG++ FGAS P   ++K++G T E V
Sbjct  676   KESVLPADVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFGITVEAV  734



>gb|AAN65341.1| thioredoxin/transketolase fusion protein [synthetic construct]
Length=804

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/661 (54%), Positives = 461/661 (70%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSA
Sbjct  146   EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSA  205

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV+ +DLK+  + GSRTPGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  206   GHGCMLQYALLHLAGYDSVKEEDLKQFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANA  265

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA HW L KL   YD
Sbjct  266   VGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIAFYD  325

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T++  +ED+S RFEALGW+TI V N     + ++ A+  A   T KPT I+
Sbjct  326   DNHISIDGDTEIAFTEDVSTRFEALGWHTIWVKNGNTGYDDIRAAIKEAKAVTDKPTLIK  385

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V+  +Q L W      F V   +         +
Sbjct  386   VTTTIGFGSPNKANSYSVHGSALGAKEVEATRQNLGWP--YDTFFVPEDVKSHWSRHTPE  443

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G  LE +W++K   Y+ KY  +A    +++ G +  GW  +LP++    P +ATR  S +
Sbjct  444   GAALEADWNAKFAEYEKKYADDAATLKSIITGELPTGWVDALPKYTPESPGDATRNLSQQ  503

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LA VVPGLIGGSADL SSN   L  +GDF Q D+   RN+R+GVREH M  I NGI
Sbjct  504   CLNALANVVPGLIGGSADLASSNMTLLKMFGDF-QKDTAEERNVRFGVREHGMGAICNGI  562

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  G +P+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL 
Sbjct  563   ALHSPGFVPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLV  622

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+  ++ GTS +GV KGGY
Sbjct  623   SFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGY  681

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              ISDNS    P++I++GTG EL +  ++A  LR EG+ VRVVS V W LF+ Q  EYKE 
Sbjct  682   TISDNSTGNKPDLIVMGTGSELEIAAKAADELRKEGKTVRVVSFVSWELFDEQSDEYKES  741

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP+ V  R+S+EAGS LGW++YVG +G  IG+D+FGAS P   ++K+YG T E++   A
Sbjct  742   VLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKFGASAPAGTIYKEYGITVESIIAAA  801

Query  163   R  161
             +
Sbjct  802   K  802



>ref|XP_010053906.1| PREDICTED: transketolase, chloroplastic [Eucalyptus grandis]
 gb|KCW78284.1| hypothetical protein EUGRSUZ_D02466 [Eucalyptus grandis]
Length=753

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/691 (52%), Positives = 463/691 (67%), Gaps = 5/691 (1%)
 Frame = -3

Query  2230  LEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLA  2051
             L  L    P +A +A E        +  +  + V+ +R L +D V+ A +GH G+ +G A
Sbjct  64    LRRLAVPRPIRATAAVETLGPSAAAETALVDKSVNTIRFLAIDSVEKANSGHPGLPMGCA  123

Query  2050  EVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKL  1871
              +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + 
Sbjct  124   PIGHVLYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKSFRQW  183

Query  1870  GSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIM  1691
             GS+TPGHPEN  T GIEVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY ++
Sbjct  184   GSKTPGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYAVL  243

Query  1690  GDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTI  1511
             GDGC MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +E++  RFE LGW+ I
Sbjct  244   GDGCQMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGNTEIAFTENVEKRFEGLGWHVI  303

Query  1510  TVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQ  1334
              V N     + ++ A+  A     KPT I+V T IG  S  +  S + HG+     +V  
Sbjct  304   WVKNGNTGYDEIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKSNSYSVHGSALGAKEVDA  363

Query  1333  MKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALL  1154
              +  L W     PFHV   + +        G  +E EW++K   Y+ KY  EA    +++
Sbjct  364   TRNNLGWP--YEPFHVPEDVKKHWSRHTPVGAAVEAEWNAKFAEYEKKYKDEAAVLKSII  421

Query  1153  NGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGY  974
              G +  GWE +LP +    P +ATR  S +CLN L  VVPGL+GGSADL SSN   L  +
Sbjct  422   KGELPAGWEKALPTYTPEIPADATRNLSQQCLNALVDVVPGLLGGSADLASSNMTLLKKF  481

Query  973   GDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSAL  794
             G+F Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SAL
Sbjct  482   GNF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMRISAL  540

Query  793   SHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANR  614
             + +GVIY+MTHDSIGLGEDGPTHQPVEHLA  RA+P +L+ RP+DGNETAGAYKVAI NR
Sbjct  541   AESGVIYVMTHDSIGLGEDGPTHQPVEHLASFRAMPNILMLRPADGNETAGAYKVAIVNR  600

Query  613   DKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAG  434
              +PS++ALSRQK+  N+ GTS +GV KGGY+ISDNS    P++ILIGTG EL +  ++A 
Sbjct  601   KRPSVLALSRQKL-PNLPGTSIEGVEKGGYVISDNSSGNKPDVILIGTGSELEIAAKAAD  659

Query  433   VLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVV  254
              LR EG+ VRV S + W LF+ Q  EYKE VLPS V  RVS+EAGS  GW + VG +G  
Sbjct  660   ELRKEGKTVRVASFISWELFDEQSPEYKESVLPSGVTARVSIEAGSTFGWEKIVGSKGKA  719

Query  253   IGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             IG+D FGAS P   ++K++G T E V   A+
Sbjct  720   IGIDRFGASAPAGKLYKEFGITVEAVIAAAK  750



>dbj|BAJ33959.1| unnamed protein product [Thellungiella halophila]
Length=736

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/670 (53%), Positives = 460/670 (69%), Gaps = 5/670 (1%)
 Frame = -3

Query  2167  DDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWF  1988
             + K +  +  + V+ +R L +D V+ AK+GH G+ +G A + + L+  VMR+NP+ P WF
Sbjct  68    ETKTESSLVEKSVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILFDEVMRYNPKNPYWF  127

Query  1987  NRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTG  1808
             NRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   +  S+TPGHPEN  T G+EVTTG
Sbjct  128   NRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWRSKTPGHPENFETPGVEVTTG  187

Query  1807  PLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWK  1628
             PLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+TNE  SLA HW 
Sbjct  188   PLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYSILGDGCQMEGITNEVCSLAGHWG  247

Query  1627  LNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHT  1448
             L KL   YDDNH +IDG T++ ++E +  RFEALGW+ I V N     + ++ A+  A  
Sbjct  248   LGKLIAFYDDNHISIDGDTEIALTESVDKRFEALGWHVIWVKNGNNGYDDIRAAIKEAKA  307

Query  1447  ETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLY  1271
              T KP+ I++ T IG  S  +  S + HG    E +V+  +Q L W     PF V   + 
Sbjct  308   VTDKPSLIKITTTIGYGSPNKANSYSAHGAALGEKEVEATRQNLGWP--YEPFQVPEDVK  365

Query  1270  REMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPV  1091
                     +G  LE +W++K  +Y+ KY +EA++  ++++G +  GWE +LP +    P 
Sbjct  366   SHWSRHTPKGAALEADWNAKFAAYEKKYAEEARELKSIMSGELPAGWEKALPTYTPDSPG  425

Query  1090  EATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREH  911
             +ATR  S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH
Sbjct  426   DATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDF-QKATPEERNLRFGVREH  484

Query  910   AMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGP  731
              M  I NGIA H  GLIP+ ATF VF+DYM+ ++R++ALS  GVIY+MTHDSIGLGEDGP
Sbjct  485   GMGAICNGIAHHSPGLIPYCATFFVFTDYMRAAMRIAALSEGGVIYVMTHDSIGLGEDGP  544

Query  730   THQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTS  551
             THQPVEHL+  RA+P +L+FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS
Sbjct  545   THQPVEHLSSFRAMPNILMFRPADGNETAGAYKIAVTKRKTPSVLALSRQKL-QQLPGTS  603

Query  550   ADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFE  371
              + V KGGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW LF+
Sbjct  604   IESVEKGGYTISDNSTGNKPDVILIGTGSELEIAAQAAEELRKEGKTVRVVSFVCWELFD  663

Query  370   RQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGF  191
              Q   YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++GF
Sbjct  664   EQSDAYKESVLPSDVSARVSIEAGSTFGWEKIVGGKGKSIGIDSFGASAPAGKLYKEFGF  723

Query  190   TEENVSKTAR  161
             T E V   A+
Sbjct  724   TIEAVVAAAK  733



>ref|WP_015173010.1| transketolase [Geitlerinema sp. PCC 7407]
 ref|YP_007110498.1| transketolase [Geitlerinema sp. PCC 7407]
 gb|AFY67446.1| transketolase [Geitlerinema sp. PCC 7407]
Length=668

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/665 (55%), Positives = 456/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +D  C++ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P WFNRDRF
Sbjct  6     QSLDELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPTWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV +DD+K   + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTLDDIKSFRQWGSRTPGHPENFETLGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA+RFNKPD  IVDH TY I+GDGC+MEG++ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAARFNKPDSTIVDHYTYVILGDGCNMEGISGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+ A++ A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLAAIQKAIEEAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+VK  ++ L W+    PF +   +    + 
Sbjct  246   SMIKVTTTIGYGSPNKADTAGVHGAALGGDEVKATRENLGWN--YEPFSIPDDVLGHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G + E EW   L +Y+ KYP+EAK F  +L G +  GW+ +LP +   D   ATR 
Sbjct  304   AVERGASNEAEWQEALAAYRTKYPEEAKVFDRILTGELPEGWDKTLPTYTSQDKGVATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   LN LA  +  L+GGSADL  SN   L   GDF Q  +   RNI +GVREHAM  I
Sbjct  364   HSEITLNALAPTLTELLGGSADLTHSNLTELKVSGDF-QKGAYENRNIHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALH  GLIP+ ATFLVF+DYM+ +IRLSALS  GVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGLALHTPGLIPYCATFLVFADYMRAAIRLSALSQVGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP LLV RP+DGNET+ AYKVA+ NR +P+L+ALSRQ +  N D TS +GV 
Sbjct  483   ETVASLRVIPNLLVMRPADGNETSAAYKVAVENRKRPTLLALSRQNL-PNYDETSFEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YIISD+ G   P+IILIGTG EL LC E+A  LR EG++VRVVS+ C  LF  Q  E
Sbjct  542   KGAYIISDSEGT--PDIILIGTGSELQLCVEAAKQLRGEGKKVRVVSMPCCELFNEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KRV+VEAGS  GW  Y G EG VIG+D FGAS P     +K+GFT ENV
Sbjct  600   YKESVLPKAVTKRVAVEAGSTFGWCRYTGSEGAVIGIDHFGASAPGNVCLEKFGFTVENV  659

Query  175   SKTAR  161
               TA+
Sbjct  660   LATAK  664



>ref|XP_010506468.1| PREDICTED: transketolase-2, chloroplastic [Camelina sativa]
Length=739

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/682 (52%), Positives = 462/682 (68%), Gaps = 6/682 (1%)
 Frame = -3

Query  2206  PSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYR  2027
             P+  C+A     +      +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY 
Sbjct  59    PTLVCAAAVEAIETTTDSSLVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYD  117

Query  2026  HVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHP  1847
               MR+NP+ P WFNRDRFVLSAGHG +L Y  LHLAG+ SV+ +DLK   + GS+TPGHP
Sbjct  118   EFMRYNPKNPYWFNRDRFVLSAGHGCMLHYALLHLAGYDSVREEDLKSFRQWGSKTPGHP  177

Query  1846  ENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEG  1667
             EN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG
Sbjct  178   ENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYTYSILGDGCQMEG  237

Query  1666  VTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGD  1487
             ++NE  SLA HW L KL   YDDNH +IDG T++  +E +  RFEALGW+ I V N    
Sbjct  238   ISNEVCSLAGHWGLGKLIAFYDDNHISIDGDTNIAFTESVDKRFEALGWHVIWVKNGNNG  297

Query  1486  MEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWD  1310
              + ++ A+  A     KPT I+V T IG  S  +  S + HG    E +V+  +  LRW 
Sbjct  298   YDEIRAAIREAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLRWP  357

Query  1309  NGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGW  1130
                 PF V   +         +G  LE +W +K  +Y+ KYP+EA + I++++G +  GW
Sbjct  358   --YEPFQVPEDVKSHWSRHTTEGAALEADWSAKFAAYEKKYPEEAAELISIISGELPAGW  415

Query  1129  ETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDS  950
             E +LP +    P +ATR  S +CLN LAKV+PG +GGSADL SSN   L  +G+F Q D+
Sbjct  416   ENALPTYTPESPGDATRNLSQQCLNALAKVMPGFLGGSADLASSNMTLLKAFGNF-QKDT  474

Query  949   PRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYI  770
             P+ RN+R+GVREH M  I NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+
Sbjct  475   PKERNLRFGVREHGMGAICNGIALHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYV  534

Query  769   MTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMAL  590
             MTHDSIGLGEDGPTHQP+EHL+  RA+P +++FRP+DGNETAGAYK+A+  R  PS++AL
Sbjct  535   MTHDSIGLGEDGPTHQPIEHLSSFRAMPNIMMFRPADGNETAGAYKIAVTKRKTPSVLAL  594

Query  589   SRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRR  410
             SRQ +   + GTS + V KGGY +S+NS    P++ILIGTG EL +  ++A  LR EG+ 
Sbjct  595   SRQNL-PQLPGTSIESVEKGGYTVSNNSTGNKPDVILIGTGSELEIAAQAAEELRKEGKT  653

Query  409   VRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGA  230
             VRVVS VCW LF+ Q   YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGA
Sbjct  654   VRVVSFVCWELFDEQSNAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTFGA  713

Query  229   SGPDTHVFKKYGFTEENVSKTA  164
             S P   ++K++G T E +   A
Sbjct  714   SAPTGKLYKEFGITVEAMVDAA  735



>ref|XP_006345515.1| PREDICTED: transketolase, chloroplastic-like [Solanum tuberosum]
Length=746

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/672 (53%), Positives = 458/672 (68%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K    +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P 
Sbjct  76    ETLEKTDNALVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPY  135

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  136   WFNRDRFVLSAGHGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPENFETPGVEVT  195

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLAL+E HLA+RFNKPD  IVDH TYCI+GDGC MEG++ EAASLA H
Sbjct  196   TGPLGQGIANAVGLALSEKHLAARFNKPDAEIVDHYTYCIVGDGCQMEGISQEAASLAGH  255

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +ED++AR+EALGW+ I V N     + ++ A+  A
Sbjct  256   WGLGKLIAFYDDNHISIDGDTEIAFTEDVAARYEALGWHVIWVKNGNTGYDEIRAAIKEA  315

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
                T KPT I+V T IG  S  +  S + HG+     +V+  +Q L W     PFHV   
Sbjct  316   KAVTDKPTLIKVTTTIGFGSPNKSNSYSVHGSALGAKEVEATRQNLGWP--YEPFHVPEE  373

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +         +G  LE  W+SK   Y+ KYP+EA    +++ G +   WE +LP +    
Sbjct  374   VKSHWSRHVPEGAALEAGWNSKFAEYEKKYPEEAADLKSIITGELPADWEKALPTYTPES  433

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P +ATR  S + LN LAKV+PG +GGSADL SSN   +  +GDF Q  +P  RNIR+GVR
Sbjct  434   PADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLMKMFGDF-QKSTPEERNIRFGVR  492

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL+ + VIY+MTHDSIGLGED
Sbjct  493   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALAESRVIYVMTHDSIGLGED  552

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAGAY+VAI     PS++ALSRQK+   + G
Sbjct  553   GPTHQPIEHLASFRAMPNVLMLRPADGNETAGAYRVAILKSKTPSILALSRQKL-PQLAG  611

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +G  KGGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W L
Sbjct  612   TSIEGTAKGGYTISDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVSWEL  671

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q  EYKE VLP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++
Sbjct  672   FDEQSAEYKESVLPAAVTARVSIEAGTTFGWAKIVGSKGKAIGIDRFGASAPAGKIYKEF  731

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  732   GITAEAVIAAAK  743



>ref|XP_006293747.1| hypothetical protein CARUB_v10022709mg [Capsella rubella]
 gb|EOA26645.1| hypothetical protein CARUB_v10022709mg [Capsella rubella]
Length=739

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/664 (53%), Positives = 455/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY   MR+NP+ P WFNRDRFV
Sbjct  78    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEFMRYNPKNPYWFNRDRFV  136

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +L Y  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+
Sbjct  137   LSAGHGCMLHYALLHLAGYDSVREEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGI  196

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NE  SLAAHW L KL  
Sbjct  197   ANAVGLALAEKHLAARFNKPDNEIVDHYTYSILGDGCQMEGISNEVCSLAAHWGLGKLIA  256

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG TD+  +E +  RFEALGW+ I V N     + ++ A+  A     KPT
Sbjct  257   FYDDNHISIDGDTDIAFTESVDKRFEALGWHVIWVKNGNNGYDEIRAAIREAKAVKDKPT  316

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  317   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPEDVKSHWSRH  374

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G   E +W++K  +Y+ KYP+EA +  ++++G    GWE +LP +    P +ATR  
Sbjct  375   TSEGAAFEADWNAKFAAYEKKYPEEAAELSSIISGEFPAGWEKALPTYTPECPGDATRNL  434

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAKV+PG +GGSADL SSN   L  +G+F Q  +P GRN+R+GVREH M  I 
Sbjct  435   SQQCLNALAKVIPGFLGGSADLASSNMTLLKAFGNF-QKATPEGRNLRFGVREHGMGAIC  493

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  494   NGIALHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  553

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HL+  RA+P +++FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS + V K
Sbjct  554   HLSSFRAMPNIMMFRPADGNETAGAYKIAVTKRKTPSVLALSRQKL-PQLPGTSIESVEK  612

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS VCW LF+ Q   Y
Sbjct  613   GGYTISDNSTGNKPDVILIGTGSELEIAAQAAEELRKEGKTVRVVSFVCWELFDEQSDAY  672

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V 
Sbjct  673   KESVLPSDVSARVSIEAGSTFGWGKIVGGKGRSIGIDTFGASAPAGKLYKEFGITIEAVV  732

Query  172   KTAR  161
               AR
Sbjct  733   DAAR  736



>ref|NP_566041.2| transketolase [Arabidopsis thaliana]
 sp|F4IW47.1|TKTC2_ARATH RecName: Full=Transketolase-2, chloroplastic; Short=TK; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEC10535.1| transketolase [Arabidopsis thaliana]
Length=741

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/664 (53%), Positives = 458/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VM++NP+ P WFNRDRFV
Sbjct  80    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEVMKYNPKNPYWFNRDRFV  138

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+E TTGPLGQG+
Sbjct  139   LSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSKTPGHPENFETPGVEATTGPLGQGI  198

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NE  SLA HW L KL  
Sbjct  199   ANAVGLALAEKHLAARFNKPDNEIVDHYTYSILGDGCQMEGISNEVCSLAGHWGLGKLIA  258

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG TD+  +E +  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  259   FYDDNHISIDGDTDIAFTESVDKRFEALGWHVIWVKNGNNGYDEIRAAIREAKAVTDKPT  318

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PFHV   +       
Sbjct  319   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFHVPEDVKSHWSRH  376

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE +W++K  +Y+ KYP+EA +  ++++G +  GWE +LP +    P +ATR  
Sbjct  377   TPEGAALEADWNAKFAAYEKKYPEEAAELKSIISGELPVGWEKALPTYTPDSPGDATRNL  436

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAK VPG +GGSADL SSN   L  +G+F Q  +P  RN+R+GVREH M  I 
Sbjct  437   SQQCLNALAKAVPGFLGGSADLASSNMTMLKAFGNF-QKATPEERNLRFGVREHGMGAIC  495

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E
Sbjct  496   NGIALHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIE  555

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HL+  RA+P +++FRP+DGNETAGAYK+A+  R  PS++ALSRQK+   + GTS + V K
Sbjct  556   HLSSFRAMPNIMMFRPADGNETAGAYKIAVTKRKTPSVLALSRQKL-PQLPGTSIESVEK  614

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY ISDNS    P++ILIGTG EL +  ++A  LR +G+ VRVVS VCW LF+ Q   Y
Sbjct  615   GGYTISDNSTGNKPDVILIGTGSELEIAAQAAEKLREQGKSVRVVSFVCWELFDEQSDAY  674

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E + 
Sbjct  675   KESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTFGASAPAGKLYKEFGITIEAMV  734

Query  172   KTAR  161
             + A+
Sbjct  735   EAAK  738



>gb|EMT02862.1| Transketolase, chloroplastic [Aegilops tauschii]
Length=633

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/635 (55%), Positives = 448/635 (71%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK+
Sbjct  1     MGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDAVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSSTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             YCI+GDGC+MEG+  EA SLA HW L KL + YDDNH +IDG T++  +ED+S RFEALG
Sbjct  121   YCIVGDGCNMEGILTEACSLAGHWGLGKLIVFYDDNHISIDGDTEIAFTEDVSGRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEED  1346
             W+T+ V N     + ++ A+  A + T KPT I+V T IG  S  +  S A HG      
Sbjct  181   WHTLWVKNGNDGYDEIRKAIQEAKSVTDKPTMIKVTTTIGFGSPNKANSYAVHGAALGTS  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +  L W     PF V   +         QG  LE +W +K   Y+ KYP++A   
Sbjct  241   EVEATRANLGWP--YEPFFVPEDVKSHWSRHIPQGAALEADWDAKFAQYEQKYPEDAATL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              +++ G +  GW  +LP++    P +ATR  S +CLN LAKVVPGLIGGSADL SSN   
Sbjct  299   KSIITGELPAGWADALPQYTTESPADATRNLSQQCLNALAKVVPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R
Sbjct  359   LKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIALHTPGLIPYCATFFVFTDYMRGAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+FRP+DG ETAGAYK+A
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNMLMFRPADGKETAGAYKLA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS +  P+ I++ TG E+ +  
Sbjct  478   VLNRKRPSILALSRQKL-PHLPGTSIEGVAKGGYTISDNSTDNKPDYIIMSTGSEVEIAV  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  L  EG+ VRVVS VCW LF+ Q  EYKE VLP  V  R+S+EAGS LGW++YVG 
Sbjct  537   KAAEELTKEGKTVRVVSFVCWELFDEQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGS  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D+FGAS P   ++K+YG T ENV   A+
Sbjct  597   KGKTIGIDKFGASAPAPKIYKEYGITAENVIAAAK  631



>ref|XP_010276861.1| PREDICTED: transketolase, chloroplastic [Nelumbo nucifera]
Length=744

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/663 (53%), Positives = 456/663 (69%), Gaps = 5/663 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  DK +  +  + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P 
Sbjct  74    ETLDKTETSLVEKSINTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPY  133

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVT
Sbjct  134   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKTFRQWGSKTPGHPENFETPGVEVT  193

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE +LA+RFNKPD  IVDH TY I+GDGC MEG+ NEA SLA H
Sbjct  194   TGPLGQGIANAVGLALAEKNLAARFNKPDCEIVDHYTYVILGDGCQMEGIANEACSLAGH  253

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A
Sbjct  254   WGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDDIRAAIEEA  313

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
                  KPT I+V T IG  S  +  S + HG+     +V   ++ L W     PFHV   
Sbjct  314   KAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPED  371

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW++K   Y+ KY +E+ +   L++G +  GW+ +LP +    
Sbjct  372   VKKHWSRHVPEGAALEAEWNAKFAEYEKKYKEESAELKTLISGELPTGWDKALPTYTPES  431

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
               +ATR  S +CLN LAKV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVR
Sbjct  432   AADATRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVR  490

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGED
Sbjct  491   EHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGED  550

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + G
Sbjct  551   GPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPG  609

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYIISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W L
Sbjct  610   TSIEGVEKGGYIISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSFVSWEL  669

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++
Sbjct  670   FDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGRIYKEF  729

Query  196   GFT  188
             G T
Sbjct  730   GIT  732



>tpg|DAA38385.1| TPA: hypothetical protein ZEAMMB73_245271 [Zea mays]
Length=633

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/634 (56%), Positives = 447/634 (71%), Gaps = 5/634 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ L+   +RFNP+ P WF+RDRFVLSAGHG ++QY  LHLAG+  V++DDLK 
Sbjct  1     MGCAPLGHVLFDEFLRFNPKNPAWFDRDRFVLSAGHGCMIQYALLHLAGYNGVKMDDLKT  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               +  SRTPGHPEN  T G+EVTTGPLGQG ANAVGLALAE HLASRFNK D+ +VDH T
Sbjct  61    FRQWRSRTPGHPENFETPGVEVTTGPLGQGFANAVGLALAEKHLASRFNKTDMKVVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEGV+NEAASLA HW L KL   YDDNH +IDG TD+  +ED+ AR+EALG
Sbjct  121   YVILGDGCQMEGVSNEAASLAGHWGLGKLIAFYDDNHISIDGNTDIAFTEDVLARYEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLS-KKEGTSKAHHGTFEED  1346
             W+TI V N     + ++ A+N A     KPT I+V T IG  S  K  T   H       
Sbjct  181   WHTIWVKNGNTGYDDIRTAINEAKGVKDKPTLIKVTTTIGFGSPNKANTYSVHGNALGSK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +  L W +   PFHV   + R      ++G +LE EW+++   Y+ KY QEA + 
Sbjct  241   EVEATRSNLGWFH--EPFHVPDEVKRHWSRHIDEGASLEAEWNARFVEYEKKYNQEAAEL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              ++++G +  GWE +L  +      +ATR  S +CLN LAKV+PG +GGS+DL +SN   
Sbjct  299   KSIISGELASGWENALRNYTPEMSPDATRNLSQQCLNALAKVIPGFLGGSSDLATSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+P  RNIR+GVREHAM  ISNGIA+H  GLIP+ ATF VF+DYM+ SIR
Sbjct  359   LKKFGDF-QRDTPEERNIRFGVREHAMGAISNGIAVHSPGLIPYCATFFVFTDYMRASIR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             LSALS +GVI++MTHDS+GLGEDGPTHQPVEHL  LRA+P +L+ RP+DGNET+GAYK+A
Sbjct  418   LSALSESGVIFVMTHDSVGLGEDGPTHQPVEHLFSLRAMPNILMLRPADGNETSGAYKIA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+   + GTS D V KGGYI+SD+S    P+ ILIGTG EL + E
Sbjct  478   VLNRKRPSVIALSRQKL-PQLRGTSVDAVSKGGYIVSDDSSGNKPDFILIGTGSELEIAE  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
              +AG LR +GR VRVVSLVCW LFE QP EYKE VLPS V  R+S+EAG   GW +Y+G 
Sbjct  537   NAAGELRKKGRTVRVVSLVCWELFEEQPEEYKESVLPSEVTSRISIEAGVTFGWEKYIGQ  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             +G  IG+D FGAS P   ++K+ G T E+V   A
Sbjct  597   KGKAIGIDRFGASAPAGKIYKELGLTVEHVIAAA  630



>ref|XP_004240048.1| PREDICTED: transketolase, chloroplastic-like [Solanum lycopersicum]
Length=746

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/660 (53%), Positives = 454/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAG
Sbjct  88    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAG  147

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +V+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  148   HGCMLQYALLHLAGYDAVREEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAV  207

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLAL+E HLA+RFNKPD  IVDH TYCI+GDGC MEG++ EAASLA HW L KL   YDD
Sbjct  208   GLALSEKHLAARFNKPDAEIVDHYTYCILGDGCQMEGISQEAASLAGHWGLGKLIAFYDD  267

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +ED++AR+EALGW+ I V N     + ++ A+  A   T KPT I+V
Sbjct  268   NHISIDGDTEIAFTEDVAARYEALGWHVIWVKNGNTGYDEIRAAIKEAKAVTDKPTLIKV  327

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  +Q L W     PFHV   +         +G
Sbjct  328   TTTIGFGSPNKSNSYSVHGSALGAKEVEATRQNLGWP--YEPFHVPEEVKSHWSRHVPEG  385

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE  W++K   Y+ KYP+EA    +++ G +   WE +LP +    P +ATR  S + 
Sbjct  386   AALEAGWNTKFAEYEKKYPEEAADLKSIITGELPADWEKALPTYTPESPADATRNLSQQN  445

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PG +GGSADL SSN   +  +GDF Q  +P  RNIR+GVREH M  I NGIA
Sbjct  446   LNALAKVLPGFLGGSADLASSNMTLMKMFGDF-QKSTPEERNIRFGVREHGMGAICNGIA  504

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SAL+ + VIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  505   LHSPGLIPYCATFFVFTDYMRAAIRISALAESRVIYVMTHDSIGLGEDGPTHQPIEHLAS  564

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAY+VAI     PS++ALSRQK+   + GTS +G  KGGY 
Sbjct  565   FRAMPNVLMLRPADGNETAGAYRVAILKNKTPSILALSRQKL-PQLAGTSIEGTAKGGYT  623

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q  EYKE V
Sbjct  624   ISDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVSWELFDEQSAEYKESV  683

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  684   LPAAVTARVSIEAGTTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVIAAAK  743



>ref|WP_022607863.1| transketolase [Rubidibacter lacunae]
 gb|ERN40928.1| transketolase [Rubidibacter lacunae KORDI 51-2]
Length=668

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ +R L +D V+ AK+GH G+ +G A + + L+   +RFNP+ PKWF+RDRF
Sbjct  6     QSLEELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFLRFNPKNPKWFDRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ +V ++D+K+  +  S+TPGHPEN ITEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDTVSLEDIKQFRQWESQTPGHPENFITEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + NAVGLA+AE HLA+RFNKP+  IVDH TY I+GDGC+MEG++ EA SLA H  L KL 
Sbjct  126   ICNAVGLAMAEAHLAARFNKPNCKIVDHYTYAILGDGCNMEGISGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL  +ED+  RFEA GW  + V+N   D+ A++ A+ +A  E  KP
Sbjct  186   ALYDDNHISIDGSTDLAFTEDVGKRFEAYGWQVLHVENGNTDLPAIEQAIATAKAENDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  S   HG     D+V+  ++ L W +   PF +   +    + 
Sbjct  246   TLIKVTTTIGYGSPNKANSHDVHGAALGADEVQATRENLGWSH--PPFEIPEDVLSHFRE  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G + E EW      YQ++Y ++A     ++ G +  GW+ +LP +   D  +ATR 
Sbjct  304   AVDRGASAETEWSQLWVRYQSEYAEDAAVLGGMMQGKLPEGWDKALPTYTPDDKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN +A V+PGLIGGSADL  SN+  L G+GDF Q      RN+R+GVREH M  I
Sbjct  364   QSGATLNAIAGVLPGLIGGSADLAPSNKTLLKGFGDF-QKGQYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG  LIP+ ATFLVF+DYM+ +IRLSALSHAGVI++MTHDS+GLGEDGPTHQPV
Sbjct  423   CNGIALHGPELIPYGATFLVFTDYMRGAIRLSALSHAGVIWVMTHDSVGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LR IP+L V RP+DGNET+ AYKVA+ NR  P+L+ALSRQK+  N+ G+S +   
Sbjct  483   EHVASLRVIPQLTVMRPADGNETSAAYKVAVENRKVPTLLALSRQKL-PNLAGSSIEKAV  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY++SD+ G   PE+ILIGTG E+ LC E+A  LR  G +VRVVSL  W LF+ Q   
Sbjct  542   KGGYVLSDSDGT--PELILIGTGSEVSLCVEAAEQLRASGIQVRVVSLPSWELFDAQDEA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLP  V KRV+VEAGS  GW  YVG EG VIG+DEFGAS P   V +KYGFT E V
Sbjct  600   YRESVLPKAVTKRVAVEAGSSFGWYRYVGAEGAVIGVDEFGASAPGDLVMEKYGFTVERV  659

Query  175   SKTAR  161
              KTA+
Sbjct  660   LKTAK  664



>ref|XP_010053907.1| PREDICTED: transketolase, chloroplastic-like [Eucalyptus grandis]
 gb|KCW78285.1| hypothetical protein EUGRSUZ_D02467 [Eucalyptus grandis]
Length=748

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/664 (54%), Positives = 453/664 (68%), Gaps = 5/664 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP++P
Sbjct  77    ETLDTATEASLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKSP  136

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  +HLAG+ SVQ +DLK   + GS+TPGHPEN  T GIEV
Sbjct  137   YWFNRDRFVLSAGHGCMLQYALMHLAGYDSVQEEDLKGFRQWGSKTPGHPENFETTGIEV  196

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLAL E HLA+RFNKPD  IVDH TY I+GDGC MEG++NEA SLA 
Sbjct  197   TTGPLGQGIANAVGLALVEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGISNEACSLAG  256

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  
Sbjct  257   HWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKE  316

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A     KPT I+V T IG  S  +  S + HG+     +V   ++ L W     PFHV  
Sbjct  317   AKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPE  374

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +          G  +E EW++K   Y+ KY +EA +  ++  G +  GWE +LP +   
Sbjct  375   DVKAHWSRHVPAGAAIEAEWNAKFAEYEKKYKEEAAELKSIFKGELPAGWEKALPTYTPE  434

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
              P +ATR  S +CLN LAKV+PGL+GGSADL SSN   L  +GDF Q  +P  RN+R+GV
Sbjct  435   SPADATRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKGTPEERNVRFGV  493

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGE
Sbjct  494   REHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGE  553

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + 
Sbjct  554   DGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSVLALSRQKL-PQLS  612

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGYIISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W 
Sbjct  613   GTSIEGVEKGGYIISDNSSGNKPDVILIGTGSELEIAVKAADELRKEGKAVRVVSFVSWE  672

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q  EYKE VLP+ V  RVS+EAGS  GW + VG  G  IG+D FGAS P   ++K+
Sbjct  673   LFDDQSAEYKESVLPAAVSARVSIEAGSTFGWSKIVGSGGKAIGIDRFGASAPAGIIYKE  732

Query  199   YGFT  188
             +G T
Sbjct  733   FGIT  736



>ref|XP_008232640.1| PREDICTED: transketolase, chloroplastic [Prunus mume]
Length=752

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/687 (52%), Positives = 462/687 (67%), Gaps = 5/687 (1%)
 Frame = -3

Query  2218  KRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             +R   ++   A   E  D   +  +  + V+ +R L +D V+ A +GH G+ +G A +G+
Sbjct  67    RRVGANRPVRAAAVETLDKTTETSLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGH  126

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  +MR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+T
Sbjct  127   ILYDEIMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKGFRQWGSKT  186

Query  1858  PGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGC  1679
             PGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC
Sbjct  187   PGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYVILGDGC  246

Query  1678  SMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDN  1499
              MEG++NE ASLA HW L KL   YDDNH +IDG T++  +E +  RFE LGW+ I V N
Sbjct  247   QMEGISNEVASLAGHWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKN  306

Query  1498  TQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQK  1322
                  + ++ A+  A   T +PT I+V T IG  S  +  S + HG      +V   ++ 
Sbjct  307   GNTGYDEIRAAIKEAKAVTDRPTLIKVTTTIGFGSPNKANSYSVHGAALGAKEVDATRKN  366

Query  1321  LRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGI  1142
             L W     PFHV   +         +G  LE EW++K   Y+ KY +EA +  +++ G +
Sbjct  367   LGWP--YEPFHVPEDVKSHWSRHTAEGSALEAEWNAKFAEYEKKYKEEAAELKSIITGEL  424

Query  1141  VPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE  962
               GWE +LP +    P +ATR  S   LN L KV+PGL+GGSADL SSN   L  +GDF 
Sbjct  425   PAGWEKALPTYTPESPADATRNLSQANLNALVKVLPGLLGGSADLASSNMTLLKSFGDF-  483

Query  961   QPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAG  782
             Q ++P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SALS AG
Sbjct  484   QKNTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISALSEAG  543

Query  781   VIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPS  602
             VIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+Y+VA+ NR +PS
Sbjct  544   VIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYRVAVLNRKRPS  603

Query  601   LMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRN  422
             ++ALSRQK+  N+ GTS +GV KGGYIISDNS    P++IL+ TG EL +  ++   LR 
Sbjct  604   ILALSRQKL-PNLPGTSIEGVEKGGYIISDNSSGNKPDVILLATGSELEIAFKAGEELRK  662

Query  421   EGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMD  242
             EG+ VRVVS V W LF+ Q   YKE VLP+ V  RVS+EAGS  GW + +G +G  IG+D
Sbjct  663   EGKAVRVVSFVSWELFDEQSDAYKESVLPAAVTARVSIEAGSTFGWEKLLGSKGKAIGID  722

Query  241   EFGASGPDTHVFKKYGFTEENVSKTAR  161
              FGAS P   ++K++G T E V   A+
Sbjct  723   HFGASAPAGKIYKEFGLTVEAVIAAAK  749



>gb|EMS63024.1| Transketolase, chloroplastic [Triticum urartu]
Length=628

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/630 (55%), Positives = 445/630 (71%), Gaps = 5/630 (1%)
 Frame = -3

Query  2047  VGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLG  1868
             +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ +V+ +DLK+  + G
Sbjct  1     MGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDAVKEEDLKQFRQWG  60

Query  1867  SRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMG  1688
             S TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TYCI+G
Sbjct  61    SSTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYCIVG  120

Query  1687  DGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTIT  1508
             DGC+MEG+  EA SLA HW L KL + YDDNH +IDG T++  +ED+S RFEALGW+T+ 
Sbjct  121   DGCNMEGILTEACSLAGHWGLGKLIVFYDDNHISIDGDTEIAFTEDVSGRFEALGWHTLW  180

Query  1507  VDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQM  1331
             V N     + ++ A+  A + T KPT I+V T IG  S  +  S A HG      +V+  
Sbjct  181   VKNGNDGYDEIRKAIQEAKSVTDKPTMIKVTTTIGFGSPNKANSYAVHGAALGTSEVEAT  240

Query  1330  KQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLN  1151
             +  L W     PF V   +         QG  LE +W +K   Y+ KYP++A    +++ 
Sbjct  241   RANLGWP--YEPFFVPEDVKSHWSRHIPQGAALEADWDAKFAQYEQKYPEDAATLKSIIT  298

Query  1150  GGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYG  971
             G +  GW  +LP++    P +ATR  S +CLN LAKVVPGLIGGSADL SSN   L  +G
Sbjct  299   GELPAGWADALPQYTTESPADATRNLSQQCLNALAKVVPGLIGGSADLASSNMTLLKMFG  358

Query  970   DFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALS  791
             DF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ ++R+SALS
Sbjct  359   DF-QKDTPEERNVRFGVREHGMGAICNGIALHTPGLIPYCATFFVFTDYMRGAMRISALS  417

Query  790   HAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRD  611
              AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+FRP+DG ETAGAYKVA+ NR 
Sbjct  418   EAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNMLMFRPADGKETAGAYKVAVLNRK  477

Query  610   KPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGV  431
             +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS +  P+ I++ TG E+ +  ++A  
Sbjct  478   RPSILALSRQKL-PHLPGTSIEGVAKGGYTISDNSTDNKPDFIIMSTGSEVEIAVKAAEE  536

Query  430   LRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVI  251
             L  EG+ VRVVS VCW LF+ Q  EYKE VLP  V  R+S+EAGS LGW++YVG +G  I
Sbjct  537   LTKEGKTVRVVSFVCWELFDEQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTI  596

Query  250   GMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             G+D+FGAS P   ++K+YG T E+V   A+
Sbjct  597   GIDKFGASAPAPKIYKEYGITAESVIAAAK  626



>ref|XP_011093362.1| PREDICTED: LOW QUALITY PROTEIN: transketolase, chloroplastic 
[Sesamum indicum]
Length=739

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/660 (53%), Positives = 456/660 (69%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  81    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  140

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ +V+ +DL    + GS+TPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  141   HGCMLQYALLHLAGYDAVKEEDLTSFRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAV  200

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+R+NKPD  IVDH TY I+GDGC MEG++NEA SLA HW L KL   YDD
Sbjct  201   GLALAEKHLAARYNKPDSEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIAFYDD  260

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFEALGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  261   NHISIDGDTEIAFTETVDTRFEALGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  320

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V+  ++ L W     PFHV   + +     A +G
Sbjct  321   TTTIGFGSPNKANSYSVHGSALGAKEVEATRKNLGWP--YEPFHVPEDVKKHWSRHAPEG  378

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
                E EW++K   Y+ KYP+EA +  ++  G +  GWE +LP +    P +ATR  S + 
Sbjct  379   AAFEAEWNAKFAEYEKKYPEEAAELKSIATGELPAGWEKALPTYTPESPADATRNLSQQN  438

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q ++P   N+R+GVREH M  I NGIA
Sbjct  439   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKNTPEELNVRFGVREHGMGAICNGIA  497

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ ++R+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  498   LHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  557

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGY 
Sbjct  558   FRAMPNILMLRPADGNETAGAYKVAVLNRKRPSVLALSRQKL-PQLPGTSIEGVEKGGYT  616

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q  EYKE V
Sbjct  617   ISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSFVSWELFDEQSDEYKESV  676

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAG+  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  677   LPAAVTARVSIEAGTTFGWGKIVGAKGKAIGIDRFGASAPAGKIYKEFGITVEAVIAAAK  736



>gb|KHG02686.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=710

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/660 (55%), Positives = 449/660 (68%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAG
Sbjct  52    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAG  111

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SVQ DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  112   HGCMLQYALLHLAGYDSVQEDDLKNFRQWQSRTPGHPENFETPGVEVTTGPLGQGIANAV  171

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEGV NEA SLA HW L KL   YDD
Sbjct  172   GLALAEKHLAARFNKPDNEIVDHYTYAILGDGCQMEGVANEACSLAGHWGLGKLIAFYDD  231

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RF+ LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  232   NHISIDGDTEIAFTENVEERFKGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  291

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W +   PFHV   +        +QG
Sbjct  292   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLVWPH--EPFHVPEDVKGHWSRLVQQG  349

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY  EA +   ++   +  GWE +LP +    P +ATR  S + 
Sbjct  350   AALEAEWNAKFAEYEKKYKDEAAELKLIITAELPAGWEKALPTYTPESPADATRNLSQQN  409

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PG  GGSADL SSN   L  YG+F Q D+P  RN+R+GVREH M  I NGIA
Sbjct  410   LNALVKVLPGFFGGSADLASSNMTLLKMYGNF-QKDTPEERNLRFGVREHGMGAICNGIA  468

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              H  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  469   HHSPGLIPYCATFFVFTDYMRAAIRMSALSQAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  528

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
             LRA+P + + RP+DGNETAGAYKVAI NR+ PS++ALSRQK+   + GTS  GV KGGYI
Sbjct  529   LRAMPNVFMLRPADGNETAGAYKVAILNRNTPSIIALSRQKL-TQLPGTSIKGVEKGGYI  587

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P+IILIGTG EL +  ++A  LR  G+ VRVVSLV W LF+ Q   YKE V
Sbjct  588   ISDNSSGNNPDIILIGTGSELEIAAKAADELRKAGKAVRVVSLVSWELFDNQSDAYKESV  647

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  648   LPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGRLYKEFGLTPEAVVAAAK  707



>ref|XP_001764998.1| predicted protein [Physcomitrella patens]
 gb|EDQ70214.1| predicted protein [Physcomitrella patens]
Length=636

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/635 (55%), Positives = 451/635 (71%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  VM++NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV  +DLK+
Sbjct  1     MGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVTTEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS+TPGHPEN  T G+EVTTGPLG G+ANAVGLALAE +LA+RFNKPD  IVDH T
Sbjct  61    FRQWGSKTPGHPENFETPGVEVTTGPLGMGIANAVGLALAESNLAARFNKPDAKIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             YCI+GDGC+MEG++NEAASLA HW L KL  LYDDNH +IDG TD+  +E +  RF+ALG
Sbjct  121   YCILGDGCNMEGISNEAASLAGHWGLGKLICLYDDNHISIDGDTDIAFTESVDRRFDALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEED  1346
             W+TI V N   D +A++ A+  A + T KPT I+V T IG  S  +  S A HG      
Sbjct  181   WHTIWVQNGNDDYDAIRAAIEEAKSVTDKPTMIKVTTTIGYGSPNKANSYAVHGAALGTK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V   +Q L+WD+   PF V   +        + G  LE +W + L +Y   YP+EA +F
Sbjct  241   EVDATRQNLKWDH--EPFFVPEEVKSHWSKHIDLGSKLESDWEAALEAYSKSYPEEAAEF  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
               L++  +  GW+TSLP +   D  +ATR  S +CLN LA+ +PGLIGGSADL SSN   
Sbjct  299   KQLISLELPAGWDTSLPAFTPEDAGDATRNLSQRCLNALARTLPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             +  +GD+ Q  +P  RN+R+GVRE AM  I NGI LH  GLIP+ ATF +F+DY+++++R
Sbjct  359   MKMFGDY-QKSTPGERNVRFGVREQAMGAICNGILLHRSGLIPYCATFFIFTDYLRSAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P++L+FRP+DGNET+GAYKVA
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPQMLMFRPADGNETSGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS +ALSRQK+  N+ GTS D V  GGY +S NS +  P++I++ TG EL +  
Sbjct  478   VQNRTRPSTLALSRQKL-PNLAGTSIDNVALGGYKLSCNSTDNKPDLIILATGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A ++R EG+ VRVVS VCW L+E Q  EYKE VLP  V  RVS+EAGS  GW  YVG 
Sbjct  537   KAADIIRGEGKTVRVVSFVCWELYEEQSAEYKESVLPKAVTARVSIEAGSTFGWERYVGL  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D FGAS P   ++K++GFT EN+   A+
Sbjct  597   KGKSIGIDRFGASAPAGTLYKEFGFTVENLLAKAK  631



>ref|WP_011243295.1| transketolase [Synechococcus elongatus]
 ref|YP_171693.1| transketolase [Synechococcus elongatus PCC 6301]
 ref|YP_399557.1| transketolase [Synechococcus elongatus PCC 7942]
 dbj|BAD79173.1| transketolase [Synechococcus elongatus PCC 6301]
 gb|ABB56570.1| transketolase [Synechococcus elongatus PCC 7942]
 gb|AJD56388.1| transketolase [Synechococcus sp. UTEX 2973]
Length=668

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/665 (54%), Positives = 464/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +D  C++++R L +D V+ AK+GH G+ +G A + Y L+   +RFNP+ P WFNRDRF
Sbjct  6     QSLDELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDRFLRFNPKNPAWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL+G+ SV I+D+K   + GS TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLSGYDSVSIEDIKNFRQWGSPTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC+MEG++ EAASLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAARFNKPDAKLVDHYTYVILGDGCNMEGISGEAASLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+ A++ A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLAAIEKAIADAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H     + ++K  ++ L WD    PF V        + 
Sbjct  246   TLIKVTTTIGYGSPNKANTAGVHGAALGDAEIKLTRENLGWD--YEPFVVPEDALAHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE  W+  L  Y+  YP EA +F  +L+G +  GW  +LP +  +D   ATR 
Sbjct  304   AIERGAALESSWNETLAQYKANYPAEAAEFERMLSGQLPTGWADALPSYTPADKAVATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   LH  GDF Q  +   RN+ +GVREHAMA I
Sbjct  364   HSEICLNALAPVLPELIGGSADLTHSNLTELHVSGDF-QKGAYENRNVHFGVREHAMAAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
             +NGIALH  GLIP+AATFLVF+DYM+ ++RLSALS  GVIY++THDSIGLGEDGPTHQPV
Sbjct  423   ANGIALHNSGLIPYAATFLVFADYMRGAMRLSALSEVGVIYVLTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP +LVFRP+DGNE +GAYKVA+ NR +PS++A+SRQ +  N++G+S D V 
Sbjct  483   ETIASLRIIPNMLVFRPADGNEASGAYKVAVENRKRPSVLAMSRQNL-PNLEGSSIDIVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++IL+ TG E+ LC E+A  LR EG++VR+VS+ CW LF+ Q  E
Sbjct  542   KGAYVLSDDEGT--PDLILLATGSEVSLCVEAAKQLRAEGKKVRIVSMPCWELFDEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V  R++VEAGS  GW  YVGD G  I  D FGAS P   +F+K+GFT +NV
Sbjct  600   YKESVLPKAVTARLAVEAGSSFGWHRYVGDAGATISTDTFGASAPGNVMFEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>gb|KHG17602.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=731

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/660 (55%), Positives = 449/660 (68%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAG
Sbjct  73    KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAG  132

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SVQ DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  133   HGCMLQYALLHLAGYDSVQEDDLKNFRQWQSRTPGHPENFETPGVEVTTGPLGQGIANAV  192

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEGV NEA SLA HW L KL   YDD
Sbjct  193   GLALAEKHLAARFNKPDNEIVDHYTYAILGDGCQMEGVANEACSLAGHWGLGKLIAFYDD  252

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RF+ LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  253   NHISIDGDTEIAFTENVEERFKGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  312

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W +   PFHV   +        +QG
Sbjct  313   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLVWPH--EPFHVPEDVKGHWSRLVQQG  370

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY  EA +   ++   +  GWE +LP +    P +ATR  S + 
Sbjct  371   AALEAEWNAKFAEYEKKYKDEAAELKLIITAELPAGWEKALPTYTPESPADATRNLSQQN  430

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PG  GGSADL SSN   L  YG+F Q D+P  RN+R+GVREH M  I NGIA
Sbjct  431   LNALVKVLPGFFGGSADLASSNMTLLKMYGNF-QKDTPEERNLRFGVREHGMGAICNGIA  489

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
              H  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  490   HHSPGLIPYCATFFVFTDYMRAAIRMSALSQAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  549

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
             LRA+P + + RP+DGNETAGAYKVAI NR+ PS++ALSRQK+   + GTS  GV KGGYI
Sbjct  550   LRAMPNVFMLRPADGNETAGAYKVAILNRNTPSIIALSRQKL-TQLPGTSIKGVEKGGYI  608

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P+IILIGTG EL +  ++A  LR  G+ VRVVSLV W LF+ Q   YKE V
Sbjct  609   ISDNSSGNNPDIILIGTGSELEIAAKAADELRKAGKAVRVVSLVSWELFDNQSDAYKESV  668

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  669   LPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGRLYKEFGLTPEAVVAAAK  728



>gb|KHG01555.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG27093.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=743

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/660 (54%), Positives = 449/660 (68%), Gaps = 7/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM +NP+ P WFNRDRF+LSAG
Sbjct  87    KSVNTIRFLSIDAVEKANSGHPGLPMGCAPMGHILYDEVMSYNPKNPYWFNRDRFILSAG  146

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ S +  DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  147   HGCMLQYALLHLAGYDSEE--DLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  204

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG++NE  SLA HW L KL   YDD
Sbjct  205   GLALAEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEVCSLAGHWGLGKLIAFYDD  264

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E++  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  265   NHISIDGDTEIAFTENVETRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  324

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   +         QG
Sbjct  325   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPEDVKAHWSRHTPQG  382

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +  A++ G +  GWE +LP +    P +ATR  S + 
Sbjct  383   AALEGEWNAKFAEYEQKYKEEAAELKAIITGELPAGWEKALPTYTPESPADATRNLSQQN  442

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PGL+GGSADL SSN   L  YGDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  443   LNALVKVLPGLLGGSADLASSNMTLLKMYGDF-QKDTPEERNVRFGVREHGMGAICNGIA  501

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  G IP+ ATF VF+DYM+ +IR+SAL  AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  502   LHSPGFIPYCATFFVFTDYMRAAIRISALCEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  561

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS +GV KGGYI
Sbjct  562   FRAMPNVLMLRPADGNETAGAYKVAVLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGYI  620

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P +ILIGTG EL +  ++A  LR EG+ VRVVS V W LF+ Q   YKE V
Sbjct  621   ISDNSSGNNPNVILIGTGSELEIAAKAADELRKEGKTVRVVSFVSWELFDEQSDAYKESV  680

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  681   LPSAVSARVSIEAGSTFGWAKIVGSKGKAIGIDRFGASAPAGKIYKEFGLTPEAVVAAAK  740



>gb|KHG30158.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=823

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/660 (54%), Positives = 451/660 (68%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAG
Sbjct  165   KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAG  224

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ DDLK   +  SRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  225   HGCMLQYALLHLAGYDSVREDDLKNFRQWESRTPGHPENFETPGVEVTTGPLGQGIANAV  284

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HLA+RFNKPD  I+DH TY I+GDGC MEG+ NEA SLA HW L KL   YDD
Sbjct  285   GLALAEKHLAARFNKPDNEIIDHYTYVILGDGCQMEGIANEACSLAGHWGLGKLIAFYDD  344

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  345   NHISIDGDTEIAFTESVDKRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  404

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W     PFHV   +         QG
Sbjct  405   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWP--YEPFHVPEDVKGHWSRHVPQG  462

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K  +Y+ KY +EA +  +++ G +  GWE +LP +    P +ATR  S + 
Sbjct  463   AALEAEWNAKFSAYEKKYKEEAAELKSIITGELPAGWEKALPTYTPESPADATRNLSQQN  522

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L KV+PGL+GGSADL SSN   L  +GDF Q D+P  RN+R+GVREH M  I NGIA
Sbjct  523   LNALVKVLPGLLGGSADLASSNMTLLKMFGDF-QKDTPEERNVRFGVREHGMGAICNGIA  581

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SALS A VIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  582   LHSPGLIPYCATFFVFTDYMRAAIRISALSQARVIYVMTHDSIGLGEDGPTHQPIEHLAS  641

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+  R  PS++ALSRQK+   + GTS +GV KGGYI
Sbjct  642   FRAMPNVLMLRPADGNETAGAYKVAVLKRKTPSILALSRQKL-PQLAGTSIEGVEKGGYI  700

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLV W LF+ Q   YKE V
Sbjct  701   ISDNSSGNNPDVILIGTGSELEIAVKAADELRKEGKAVRVVSLVSWELFDEQSDAYKESV  760

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              PS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  761   FPSAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRFGASAPAGRIYKEFGLTPEAVIAAAK  820



>sp|Q42675.1|TKTA_CRAPL RecName: Full=Transketolase 10; Short=TK [Craterostigma plantagineum]
 emb|CAA86608.1| transketolase [Craterostigma plantagineum]
Length=679

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/661 (53%), Positives = 462/661 (70%), Gaps = 6/661 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V++ K+GH GM +G A +G+ L+   M+FNP+ P WFNRDRFVLSAG
Sbjct  20    KSVNTIRFLAIDAVENVKSGHPGMPMGCAPMGHVLFDEFMKFNPKNPYWFNRDRFVLSAG  79

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG++L Y  LHLAG+ SV+++DLK L + GS+TP HPEN  T G+EVTTGPLGQGV +AV
Sbjct  80    HGAMLLYGLLHLAGYDSVKVEDLKGLRQWGSKTPAHPENFETPGVEVTTGPLGQGVGSAV  139

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLALAE HL +R+NKPD  +VDH TY I+GDGC MEG++NEA+SLAAHW L KL  LYDD
Sbjct  140   GLALAEKHLGARYNKPDFEMVDHYTYMILGDGCQMEGISNEASSLAAHWGLGKLIALYDD  199

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH TIDG TDL  +ED+  RFEALGW+ +TV N     + ++ A+  A + T KPT I+V
Sbjct  200   NHITIDGDTDLAFTEDVGKRFEALGWHVLTVANGNDGYDEIREAIKVAKSVTDKPTLIKV  259

Query  1417  KTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  +   HG      + +  +Q L W      FHV   + +       +G
Sbjct  260   ATTIGFGSPNKANTYGVHGNALGPKEAEATRQNLGWP--YETFHVPDDVKKHWSRHISEG  317

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE  W++K   Y+ KYP+EA +  +++ G +  GWE +LP +    P   TR  S + 
Sbjct  318   AELESAWNAKFAEYEKKYPKEAAELKSIITGELPLGWEKALPTYTPESPGNPTRTLSHQN  377

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN +A V+PGLIGGSADL +SN A+L   GDF Q ++P GRN+++G REH M  I NG+A
Sbjct  378   LNAVAAVLPGLIGGSADLTASNMAFLKSSGDF-QKETPTGRNLKFGAREHGMGAICNGVA  436

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GL+PF+AT+ VF+DYM+ +IR++ALS A V+YIMTHDSIGLGEDGPTHQPVEHLA 
Sbjct  437   LHSPGLVPFSATYFVFTDYMRAAIRIAALSKARVVYIMTHDSIGLGEDGPTHQPVEHLAS  496

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +LV RP+DGNETAGAYKVA+ N  +PS+++LSRQK+   + GTS +GVG+GGY+
Sbjct  497   FRAMPNILVLRPADGNETAGAYKVAVENAGRPSILSLSRQKL-PQLPGTSVEGVGRGGYV  555

Query  520   ISDNSGE-ELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             ISDNS + E PE+IL+GTG EL +   +   LR EG++VRVVSLV W LF  Q +EYKE+
Sbjct  556   ISDNSKDGEKPEVILMGTGSELEIAARAGEELRKEGKKVRVVSLVSWELFGEQSKEYKEM  615

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLPS V  RVSVEAGS  GW  +VG +G  +G+D FGAS     ++K++G T E V   A
Sbjct  616   VLPSEVTARVSVEAGSTFGWERFVGLKGRAVGIDRFGASASAERLYKEFGITVEAVVAAA  675

Query  163   R  161
             +
Sbjct  676   K  676



>ref|XP_002266494.2| PREDICTED: transketolase, chloroplastic [Vitis vinifera]
Length=729

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/660 (53%), Positives = 451/660 (68%), Gaps = 5/660 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + ++ +R L +D V+ A +GH G+ +G A +G+ LY  VMR+NP  P WFNRDRFVLSAG
Sbjct  71    KSINTIRFLSIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPSNPYWFNRDRFVLSAG  130

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHLAG+ SV+ +DLK   + GSRTPGHPEN  T G+EVTTGPLGQG+ANAV
Sbjct  131   HGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAV  190

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLA  E HLA+RFNKPD  IVDH TY I+GDGC MEG++NE  SLA HW L KL   YDD
Sbjct  191   GLAAVEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEVCSLAGHWGLGKLIAFYDD  250

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH +IDG T++  +E +  RFE LGW+ I V N     + ++ A+  A     KPT I+V
Sbjct  251   NHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKV  310

Query  1417  KTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG  S  +  S + HG+     +V   ++ L W +   PFHV   + +        G
Sbjct  311   TTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWPH--EPFHVPEDVKKHWSRHIPDG  368

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE EW++K   Y+ KY +EA +  +++ G +  GW+ +LP +      +ATR  S +C
Sbjct  369   AALEAEWNAKFAEYEKKYKEEAAELKSIITGELPAGWDKALPTYTPESAADATRNLSQQC  428

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LAKV+PGL+GGSADL SSN   L  +GDF Q  +P  RN+R+GVREH M  I NGIA
Sbjct  429   LNALAKVLPGLLGGSADLASSNMTLLKMFGDF-QKGTPEERNVRFGVREHGMGAICNGIA  487

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GLIP+ ATF VF+DYM+ +IR+SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA 
Sbjct  488   LHSLGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLAS  547

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L+ RP+DGNETAGAYKVA+ NR +PS++ALSRQK+   + GTS  GV KGGY 
Sbjct  548   FRAMPNILMLRPADGNETAGAYKVAVVNRKRPSILALSRQKL-PQLPGTSIAGVEKGGYA  606

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             ISDNS    P++ILIGTG EL +  ++   LR EG+ VRVVSLV W LF+ Q   YKE V
Sbjct  607   ISDNSSGNKPDVILIGTGSELEIAAKAGDELRKEGKTVRVVSLVSWELFDDQSDAYKESV  666

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             LP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V + A+
Sbjct  667   LPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITVEAVIEAAK  726



>gb|KFK37327.1| hypothetical protein AALP_AA4G242300 [Arabis alpina]
Length=734

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/671 (52%), Positives = 460/671 (69%), Gaps = 6/671 (1%)
 Frame = -3

Query  2170  DDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKW  1991
             D      +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  +MR+NP+ P W
Sbjct  66    DTTTDSSLVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEIMRYNPKNPYW  124

Query  1990  FNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTT  1811
             FNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DL    + GS+TPGHPEN  T G+EVTT
Sbjct  125   FNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLMSFRQWGSKTPGHPENFETPGVEVTT  184

Query  1810  GPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHW  1631
             GPLGQG+ANAVGLALAE HLA+RFNKP   IVDH TY I+GDGC MEG+++E  SLA HW
Sbjct  185   GPLGQGIANAVGLALAEKHLAARFNKPGNEIVDHYTYSILGDGCQMEGLSHEVCSLAGHW  244

Query  1630  KLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAH  1451
              L KL   YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A 
Sbjct  245   GLGKLIAFYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNTGYDEIRAAIREAK  304

Query  1450  TETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPML  1274
               T KPT I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +
Sbjct  305   AVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRSNLGWP--YAPFQVPEDV  362

Query  1273  YREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDP  1094
                      +G   E +W++K  +Y+  YP+EA +  ++++G +  GWE +LP +    P
Sbjct  363   KSHWSRHTPEGAAHEADWNAKFTAYEKMYPEEAAELKSIISGELPAGWEKALPTYTPESP  422

Query  1093  VEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVRE  914
              +ATR  S +CLN LAKVVPG +GGSADL SSN   L  +GDF Q  +P  RN+R+GVRE
Sbjct  423   GDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKSFGDF-QKATPEERNLRFGVRE  481

Query  913   HAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDG  734
             H M  I NGIALH  G IP+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDG
Sbjct  482   HGMGAICNGIALHSPGFIPYCATFFVFTDYMRAAMRISALSEAGVIYVMTHDSIGLGEDG  541

Query  733   PTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGT  554
             PTHQPVEH++  RA+P +++FRP+DGNETAGAYK+A+  R+ PS++ALSRQK+  ++ GT
Sbjct  542   PTHQPVEHISSFRAMPNIMMFRPADGNETAGAYKIAVTKRNTPSVLALSRQKL-PHLPGT  600

Query  553   SADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLF  374
             S + V KGGY ISDNS    P++ILIGTG EL +  ++A VLR EG+ VRVVS VCW LF
Sbjct  601   SIENVEKGGYTISDNSTGNKPDVILIGTGSELEIAAQAAEVLRKEGKTVRVVSFVCWELF  660

Query  373   ERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYG  194
             + Q   YKE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G
Sbjct  661   DEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDSFGASAPAGKLYKEFG  720

Query  193   FTEENVSKTAR  161
              T E + + A+
Sbjct  721   ITIEAMVEAAK  731



>ref|WP_026788829.1| MULTISPECIES: transketolase [Planktothrix]
Length=668

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/665 (53%), Positives = 460/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKW+NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWYNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GSRTPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSRTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE H A+ FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHDAATFNKPDAALVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+++ +ED+S RFEA GW+ + V+N   D+E++ +A+  A   T KP
Sbjct  186   ALYDDNHISIDGNTEISFTEDVSKRFEAYGWHVLHVENGNTDLESIADAIAQAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             TFI+V T IG  S  ++ T+  H      D+V   ++ L W+    PF +        + 
Sbjct  246   TFIKVTTIIGYGSPNRQNTAGVHGAALGADEVAATRKNLGWN--YEPFEIPEDALAHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW+     Y+ KYPQEA +F    +G +  GWE SLP +   +  +ATR 
Sbjct  304   AVERGANLETEWNKTWADYKAKYPQEAAEFERRTSGILPEGWEKSLPTFTPDEKGKATRQ  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA  +P LIGGSADL  SN   + G+G+F Q    + RN+R+GVREHAM  I
Sbjct  364   YSEGCLNALAPAIPELIGGSADLTHSNLTEIKGFGNF-QKGQYQNRNLRFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGI LHG GLIP+ ATFLVF+DYM+ +IRLSALS  GVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIGLHGSGLIPYCATFLVFADYMRAAIRLSALSEVGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP LLV RP+DGNET+GAYK+A+ NR +P+L+AL+RQ +  N++G+S D VG
Sbjct  483   ETIASLRVIPNLLVMRPADGNETSGAYKIAVENRHRPTLIALTRQAL-PNLNGSSIDVVG  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++ILIGTG E+ LC E A  L   G++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVLSDSEGT--PDLILIGTGSEVSLCVEVAEKLTQVGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KR++VEAG   GW+ Y G EG  I +D FGAS P   + +K+G+T +NV
Sbjct  600   YKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTFGASAPGGVLMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|XP_002439367.1| hypothetical protein SORBIDRAFT_09g005230 [Sorghum bicolor]
 gb|EES17797.1| hypothetical protein SORBIDRAFT_09g005230 [Sorghum bicolor]
Length=633

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/635 (55%), Positives = 443/635 (70%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A VG+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+
Sbjct  1     MGCAPVGHVLYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS TPGHPEN  T G+EVTTGPLGQGVANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSSTPGHPENFETPGVEVTTGPLGQGVANAVGLALAEKHLAARFNKPDSEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEGV NEA SLA HW L KL   YDDNH +IDG T++  +ED+S RFEALG
Sbjct  121   YVILGDGCQMEGVANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSTRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V +     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKSGNTGYDDIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +Q L W     PF V   +         QG  LE +W++K   Y+ KY ++A   
Sbjct  241   EVEATRQNLGWP--YEPFFVPEDVKSHWSRHTPQGAALEADWNAKFAEYEKKYAEDAATL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              +L+ G    GW  +LP++    P +ATR  S +CLN L  VVPGLIGGSADL SSN   
Sbjct  299   KSLITGEFPTGWADALPKYTPESPADATRNLSQQCLNALTNVVPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+P  RN+R+GVREH M  I+NGIALH  G +P+ ATF VF+DYM+ ++R
Sbjct  359   LKMFGDF-QKDTPEERNVRFGVREHGMGAIANGIALHSPGFVPYCATFFVFTDYMRGAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYKVA
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS    P++I++ TG EL +  
Sbjct  478   VLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGYTISDNSTGNKPDLIVLSTGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR EG+ +RVVS V W LFE Q  EYKE VLP  V  R+S+EAGS LGW++Y+G 
Sbjct  537   KAADELRKEGKTIRVVSFVSWELFEEQSDEYKESVLPEAVTARISIEAGSTLGWQKYIGA  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D+FGAS P   ++K+YG T E V   A+
Sbjct  597   QGKAIGIDKFGASAPAGKIYKEYGITVEGVIAAAK  631



>ref|XP_002437762.1| hypothetical protein SORBIDRAFT_10g002220 [Sorghum bicolor]
 gb|EER89129.1| hypothetical protein SORBIDRAFT_10g002220 [Sorghum bicolor]
Length=633

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/635 (55%), Positives = 446/635 (70%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+
Sbjct  1     MGCAPMGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS+TPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSKTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +ED+S RFEALG
Sbjct  121   YVILGDGCQMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSTRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKNGNNGYDDIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +Q L W     PF V   +         +G  LE +W++K   Y+ KY  +A   
Sbjct  241   EVEATRQNLGWP--YEPFFVPEDVKSHWSRHTPEGAALEADWNAKFAEYEKKYADDAATL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              +++ G    GW  +LP++    P +ATR  S +CLN LA VVPGLIGGSADL SSN   
Sbjct  299   KSIITGEFPTGWADALPKYTPESPGDATRNLSQQCLNALANVVPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+   RN+R+GVREH M  I NGIALH  G +P+ ATF VF+DYM+ ++R
Sbjct  359   LKMFGDF-QKDTAEERNVRFGVREHGMGAICNGIALHSPGFVPYCATFFVFTDYMRGAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYKVA
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS    P++I++GTG EL + E
Sbjct  478   VLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGYTISDNSTGNKPDLIVLGTGSELEIAE  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR EG+ VRVVS V W LF+ Q  EYKE VLP+ V  R+S+EAGS LGW++YVG 
Sbjct  537   KAADELRKEGKTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGA  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D+FGAS P   ++K+YG T E+V   A+
Sbjct  597   QGKAIGIDKFGASAPAGTIYKEYGITVESVIAAAK  631



>ref|XP_002280760.1| PREDICTED: transketolase, chloroplastic [Vitis vinifera]
Length=745

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/672 (53%), Positives = 460/672 (68%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K +  +  + V+ +R L VD V+ A +GH G+ +G A +G+ LY   M+FNP+ P 
Sbjct  75    ETLEKTETTLIEKSVNTIRFLAVDSVEKANSGHPGLPMGCAPMGHVLYDEFMKFNPKNPY  134

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS TPGHPEN  T G+EVT
Sbjct  135   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSTTPGHPENFETPGVEVT  194

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEGV +EA SLA H
Sbjct  195   TGPLGQGIANAVGLALAERHLAARFNKPDNEIVDHYTYVILGDGCQMEGVAHEACSLAGH  254

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL  LYDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A
Sbjct  255   WGLGKLIALYDDNHISIDGDTEIAFTENVDLRFEALGWHVIWVKNGNTGYDEIRAAIKEA  314

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              T   KPT I+V T IG  S  +  S + HG+     ++   ++ LRW     PFHV   
Sbjct  315   KTVKDKPTLIKVTTTIGYGSPNKSNSYSVHGSALGPKELDATRKNLRWP--YEPFHVPED  372

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW+++   Y+ KY +EA    +L+NG +  GWE +LP +    
Sbjct  373   VKKHWSRHVPEGAALEAEWNAQFAEYERKYKEEAAVLKSLINGELPAGWEKALPTYTPES  432

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P EATR  S +CLN LA V+PGL+GGSADL SSN + +  +G+F Q  +P  RN+R+GVR
Sbjct  433   PAEATRNSSQQCLNALANVLPGLLGGSADLASSNLSVMKQFGNF-QKGTPEERNVRFGVR  491

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGI LH  GLIP+ ATF VF+DY++ ++R+SAL  AGVIY+MTHDSIGLGED
Sbjct  492   EHGMGAICNGIVLHCPGLIPYCATFFVFTDYLRPAMRISALCEAGVIYVMTHDSIGLGED  551

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DG ETA AYK+A+ NR +PS++AL R+ V + + G
Sbjct  552   GPTHQPIEHLASFRAMPNILMLRPADGTETAAAYKIAVLNRKRPSVLALGRRDV-SQLRG  610

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYI++DNS    P++ILIGTG EL +  ++A  LR EG+ VRVVSLVCW L
Sbjct  611   TSIEGVEKGGYIVTDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSLVCWAL  670

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YKE VLP+ V  RVSVEA S  GW ++VG +G  IG+D FGAS P   ++K+ 
Sbjct  671   FDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRFGASAPALKLYKEL  730

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  731   GVTAEAVIAAAK  742



>ref|XP_001769997.1| predicted protein [Physcomitrella patens]
 gb|EDQ65173.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/672 (53%), Positives = 466/672 (69%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E   K    +  + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P 
Sbjct  44    ETAQKTDNALVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPY  103

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ +DLK+  + GSRTPGHPEN  T GIEVT
Sbjct  104   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEEDLKQFRQWGSRTPGHPENFETPGIEVT  163

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TYCI+GDGC+MEG++NEAASLA H
Sbjct  164   TGPLGQGIANAVGLALAEAHLAARFNKPDAKIVDHYTYCILGDGCNMEGISNEAASLAGH  223

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL  LYDDNH +IDG T++  +E++ ARFEALGW+TI V N     + ++ A+  A
Sbjct  224   WGLGKLICLYDDNHISIDGDTEIAFTENVDARFEALGWHTIWVKNGNTGYDEIRAAIEEA  283

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              + T KPT I+V T IG  S  +  S A HG      +V+  +Q L W     PFHV   
Sbjct  284   KSVTDKPTMIKVTTTIGFGSPNKANSYAVHGAALGGKEVEATRQNLGWP--YEPFHVPDE  341

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             +        + G   + EW + +  Y  KYP+E  +F  L++G +  GW+ +LP +   D
Sbjct  342   VKSHWSKHTDLGTKYQSEWEAAVEEYAQKYPEEGAEFKQLISGELPEGWDKALPSFTPED  401

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
               +ATR  S +CLN LA+ +PGLIGGSADL SSN   +  +GDF Q  +P  RN+R+GVR
Sbjct  402   AGDATRNLSQRCLNALARTLPGLIGGSADLASSNMTLMKMFGDF-QKSTPAERNVRFGVR  460

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EHAM  I NG+  H  GLIP+ ATF +F+DY++ ++R+SAL+ AGVIY+MTHDSIGLGED
Sbjct  461   EHAMGAICNGMLQHLSGLIPYCATFFIFTDYLRAAMRISALAEAGVIYVMTHDSIGLGED  520

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DGNET+GAYKVA+ NR +PS +ALSRQK+  N+ G
Sbjct  521   GPTHQPIEHLASFRAMPNMLMLRPADGNETSGAYKVAVLNRKRPSTLALSRQKL-PNLPG  579

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS D V  G Y ISD+S +  P++IL+ +G EL +  ++A V+R EG+ VRV+S VCW L
Sbjct  580   TSIDNVQLGAYAISDDSKDNKPDLILMASGSELEIAAKAADVIRGEGKTVRVISFVCWEL  639

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             FE Q  EYKE +LPS V  RVSVEAG+  GW  +VG EG  IG+D FGAS P   ++K++
Sbjct  640   FEEQSAEYKESLLPSDVTARVSVEAGATFGWERFVGLEGRAIGVDHFGASAPANILYKEF  699

Query  196   GFTEENVSKTAR  161
             G T +NV   A+
Sbjct  700   GITVDNVVAKAK  711



>emb|CDY68196.1| BnaAnng26460D [Brassica napus]
Length=736

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/664 (53%), Positives = 462/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  75    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEVMRYNPKNPYWFNRDRFV  133

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+
Sbjct  134   LSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGI  193

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+TNE  SLAAHW L KL  
Sbjct  194   ANAVGLALAEKHLAARFNKPDSEIVDHYTYSIIGDGCQMEGITNEVCSLAAHWGLGKLIA  253

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A   T KPT
Sbjct  254   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNNGYDEIRAAIKEAKAVTNKPT  313

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  314   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWP--YEPFQVPEDVKSHWSRH  371

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE +W++K  +Y+ KYP+EA++  ++++G +  GWE +LP +    P +ATR  
Sbjct  372   TPEGAALEADWNAKFTAYEKKYPEEAEELKSIISGDLPAGWEKALPTYTPESPGDATRNL  431

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAK +PG +GGSADL SSN   L  +GDF Q  +P GRN+R+GVREH M  I 
Sbjct  432   SQQCLNALAKTLPGFLGGSADLASSNMTLLKAFGDF-QNATPEGRNLRFGVREHGMGAIC  490

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NG+ALH  G IP+ ATF VF+DYM+ ++R++ALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  491   NGVALHSPGFIPYCATFFVFTDYMRAAMRIAALSEAGVIYVMTHDSIGLGEDGPTHQPVE  550

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HL+  RA+P +++FRP+DGNETAGAYK+A+  R+ PS++ALSRQK+   + GTS + V +
Sbjct  551   HLSSFRAMPNIMMFRPADGNETAGAYKIAVTRRNTPSVLALSRQKL-PQLPGTSIENVER  609

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGY +SDNS    P++IL+GTG EL +  ++   LR EG+ VRVVS VCW LF+ QP  Y
Sbjct  610   GGYTVSDNSTGNKPDVILVGTGSELEIAAKAGEELRKEGKNVRVVSFVCWELFDEQPDAY  669

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   +++++G T E V 
Sbjct  670   KESVLPSDVSARVSIEAGSTFGWGKVVGGKGKSIGIDSFGASAPAGKLYEEFGITVEAVV  729

Query  172   KTAR  161
               A+
Sbjct  730   AAAK  733



>sp|O20250.1|TKTC_SPIOL RecName: Full=Transketolase, chloroplastic; Short=TK; Flags: 
Precursor [Spinacia oleracea]
 gb|AAD10219.1| transketolase [Spinacia oleracea]
Length=741

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/661 (53%), Positives = 451/661 (68%), Gaps = 5/661 (1%)
 Frame = -3

Query  2140  RRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSA  1961
              + V+ +R L +D V+ A +GH G+ +G A +G+ LY  +MR+NP+ P WFNRDRFVLSA
Sbjct  82    EKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSA  141

Query  1960  GHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANA  1781
             GHG +LQY  LHLAG+ SV  +DLK   + GSR PGHPEN  T G+EVTTGPLGQG+ANA
Sbjct  142   GHGCMLQYALLHLAGYDSVLEEDLKTFRQWGSRIPGHPENFETPGVEVTTGPLGQGIANA  201

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+  EA SLA HW L KL   YD
Sbjct  202   VGLALAEKHLAARFNKPDAEIVDHYTYVILGDGCQMEGIAQEACSLAGHWGLGKLIAFYD  261

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH +IDG T +  +E +  RFEALGW+ I V N     + ++ A+  A T T KPT I+
Sbjct  262   DNHISIDGDTAIAFTESVDLRFEALGWHVIWVKNGNTGYDEIRAAIKEAKTVTDKPTLIK  321

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S + HG+     +V+  +Q L W     PFHV   + +       +
Sbjct  322   VTTTIGFGSPNKSNSYSVHGSALGSKEVEATRQNLGWP--YEPFHVPEEVKKHWSRHTPE  379

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G +LE EW++K   Y+ KYP++A +F ++  G    GWE +LP +    P +ATR  S +
Sbjct  380   GASLEAEWNTKFAEYEKKYPEDATEFKSITTGEFPAGWEKALPTYTPETPGDATRNLSQQ  439

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LAKV+PGL+GGSADL SSN   L  +GDF +    +    R+GVREH M  I NGI
Sbjct  440   CLNALAKVIPGLLGGSADLASSNMTLLKMFGDFRRTHRKK-ETFRFGVREHGMGAICNGI  498

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
              LH  G +P+ ATF VF+DYM+ ++R+SALS AGVIY+MTHDSIGLGEDGPTHQP+E L+
Sbjct  499   CLHSPGFVPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEALS  558

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
                A+P +L+ RP+DGNETAG+YKVA+ NR  PS++ALSR+K+  N+ GTS +GV KGGY
Sbjct  559   KFPAMPNILMLRPADGNETAGSYKVAVENRKTPSILALSRKKL-PNLPGTSIEGVEKGGY  617

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              I+DNS    P++ILIGTG EL +  ++   LR EG+ VRVVS V W LFE+Q  EYKE 
Sbjct  618   TITDNSSGNKPDVILIGTGSELEIAAKAGDELRKEGKAVRVVSFVSWELFEKQSDEYKES  677

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLPS V  RVS+EAGS  GW + VG +G  IG+D+FGAS P   ++++YG T E V + A
Sbjct  678   VLPSDVTARVSIEAGSTFGWHKIVGSKGKAIGIDKFGASAPAGKIYQEYGITVEAVVEAA  737

Query  163   R  161
             +
Sbjct  738   K  738



>emb|CDX74726.1| BnaA05g04720D [Brassica napus]
Length=736

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/664 (53%), Positives = 462/664 (70%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  75    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEVMRYNPKNPYWFNRDRFV  133

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+
Sbjct  134   LSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGI  193

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+TNE  SLAAHW L KL  
Sbjct  194   ANAVGLALAEKHLAARFNKPDNEIVDHYTYSIIGDGCQMEGITNEVCSLAAHWGLGKLIA  253

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT
Sbjct  254   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNNGYDEIRAAIKEAKAVKDKPT  313

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  314   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGW--AYEPFQVPEDVKSHWSRH  371

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE +W++K  +Y+ KYP+EA++  ++++G +  GWE +LP +    P +ATR  
Sbjct  372   TPEGAALEADWNAKFSAYEKKYPEEAEELKSIISGDLPAGWEKALPTYTPESPGDATRNL  431

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAK +PG +GGSADL SSN   L  +GDF Q  +P GRN+R+GVREH M  I 
Sbjct  432   SQQCLNALAKSLPGFLGGSADLASSNMTLLKAFGDF-QNATPEGRNLRFGVREHGMGAIC  490

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NG+ALH  G IP+ ATF VF+DYM+ ++R++ALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  491   NGVALHSPGFIPYCATFFVFTDYMRAAMRIAALSEAGVIYVMTHDSIGLGEDGPTHQPVE  550

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HL+  RA+P +++FRP+DGNETAGAYK+A+A R+ PS++ALSRQK+   + GTS + V +
Sbjct  551   HLSSFRAMPNIMMFRPADGNETAGAYKIAVARRNTPSVLALSRQKL-PQLRGTSIENVER  609

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGYII+DNS    P++IL+GTG EL +  ++   LR EG+ VRVVS VCW LF+ Q   Y
Sbjct  610   GGYIITDNSNGNKPDVILVGTGSELEIAAKAGEELRKEGKSVRVVSFVCWELFDEQTDAY  669

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS V  RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V 
Sbjct  670   KESVLPSEVSARVSIEAGSTFGWGKVVGGKGKSIGIDSFGASAPAGKLYKEFGITVEAVV  729

Query  172   KTAR  161
               A+
Sbjct  730   AAAK  733



>ref|XP_001769987.1| predicted protein [Physcomitrella patens]
 gb|EDQ65163.1| predicted protein [Physcomitrella patens]
Length=692

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/673 (53%), Positives = 468/673 (70%), Gaps = 9/673 (1%)
 Frame = -3

Query  2176  EEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTP  1997
             ++ DD   E    + V+ +R L +D V+ A +GH G+ +G A +G+ LY  VM++NP+ P
Sbjct  24    QKTDDALVE----KSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNP  79

Query  1996  KWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEV  1817
              WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+  + GSRTPGHPEN  T GIEV
Sbjct  80    YWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKQEDLKQFRQWGSRTPGHPENFETPGIEV  139

Query  1816  TTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAA  1637
             TTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TYCI+GDGC+MEG++NEAASLA 
Sbjct  140   TTGPLGQGIANAVGLALAEAHLAARFNKPDAKIVDHYTYCIVGDGCNMEGISNEAASLAG  199

Query  1636  HWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNS  1457
             HW L KL  LYDDNH +IDG T++  +E++ ARFEALGW+TI V N     + ++ A+  
Sbjct  200   HWGLGKLICLYDDNHISIDGDTEIAFTENVDARFEALGWHTIWVKNGNTGYDEIRAAIEE  259

Query  1456  AHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP  1280
             A + T KPT I+V T IG  S  +  S A HG      +V+  +Q L W     PFHV  
Sbjct  260   AKSVTDKPTMIKVTTTIGFGSPNKANSYAVHGAALGGKEVEATRQNLGWP--YEPFHVPD  317

Query  1279  MLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMS  1100
              +        + G   + EW + +  Y  KYP+E  +F  L++G +  GW+ +LP +   
Sbjct  318   EVKSHWSKHTDLGTKYQSEWEAAVEEYAQKYPEEGAEFKQLISGELPDGWDKALPSFTPE  377

Query  1099  DPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGV  920
             D  +ATR  S +CLN LA+ +PGLIGGSADL SSN   +  +GDF Q  +P  RN+R+GV
Sbjct  378   DAGDATRNLSQRCLNALARTLPGLIGGSADLASSNMTLMKMFGDF-QKSTPAERNVRFGV  436

Query  919   REHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGE  740
             REHAM  I NG+  H  GLIP+ ATF +F+DY++ ++R+SAL+ AGVIY+MTHDSIGLGE
Sbjct  437   REHAMGAICNGMLQHLSGLIPYCATFFIFTDYLRAAMRISALAEAGVIYVMTHDSIGLGE  496

Query  739   DGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMD  560
             DGPTHQP+EHLA  RA+P +L+ RP+DGNET+GAYKVA+ NR +PS +ALSRQK+  N+ 
Sbjct  497   DGPTHQPIEHLASFRAMPNMLMLRPADGNETSGAYKVAVLNRKRPSTLALSRQKL-PNLP  555

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS D V  G Y ISD+S +  P++IL+ +G EL +  ++A V+R EG+ VRV+S VCW 
Sbjct  556   GTSIDNVQLGAYAISDDSKDNKPDLILMASGSELEIAAKAADVIRGEGKTVRVISFVCWE  615

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LFE Q  EYKE +LPS V  RVSVEAG+  GW  +VG EG  IG+D FGAS P   ++K+
Sbjct  616   LFEEQSAEYKESLLPSDVTARVSVEAGATFGWERFVGLEGRAIGVDHFGASAPANILYKE  675

Query  199   YGFTEENVSKTAR  161
             +G T +NV   A+
Sbjct  676   FGITVDNVVAKAK  688



>gb|KHN35634.1| Transketolase, chloroplastic [Glycine soja]
Length=634

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/635 (55%), Positives = 440/635 (69%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY   M++NP+ P WFNRDRFVLSAGHG +LQY  LHLAGF SV+ +DL+ 
Sbjct  1     MGCAPMGHVLYDETMKYNPKNPFWFNRDRFVLSAGHGCMLQYALLHLAGFDSVKEEDLRE  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GSRTPGHPEN  T GIEVTTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH T
Sbjct  61    FRQWGSRTPGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARYNKPDNEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +E + +RFE LG
Sbjct  121   YAILGDGCQMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGNTEIAFTESVDSRFEGLG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+ I V N     + ++ A+  A     KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHVIWVKNGNNGYDDIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V   +Q L W +   PFHV   + +       +G  LE EW++K   Y+ KY +EA + 
Sbjct  241   EVDATRQNLGWSH--EPFHVPEDVKKHWSRHTPEGAALEAEWNAKFAEYEKKYKEEAAEL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              +++NG    GWE +LP +    P +ATR  S   LN LAKV+PGL+GGSADL SSN   
Sbjct  299   KSIINGEFPAGWEKALPTYTPESPADATRNLSQTNLNALAKVLPGLLGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR
Sbjct  359   LKMFGDF-QKDTPAERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAIR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             LSALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA
Sbjct  418   LSALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+   + GTS +GV KGGY ISDNS    P++ILIGTG EL +  
Sbjct  478   VLNRKRPSILALSRQKL-PQLPGTSIEGVEKGGYTISDNSTGNKPDVILIGTGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR EG+ VRVVSLV W LF+ Q   YKE V P+ V  RVS+EAGS  GW + VG 
Sbjct  537   KAADDLRKEGKAVRVVSLVSWELFDEQSEAYKESVFPAAVSARVSIEAGSTFGWEKIVGA  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D FGAS P   ++K++G T+E V   A+
Sbjct  597   KGKAIGIDRFGASAPAGRIYKEFGITKEAVVAAAK  631



>emb|CAN72939.1| hypothetical protein VITISV_026323 [Vitis vinifera]
Length=745

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/672 (53%), Positives = 459/672 (68%), Gaps = 5/672 (1%)
 Frame = -3

Query  2173  EDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPK  1994
             E  +K +  +  + V+ +R L VD V+ A +GH G+ +G A +G+ LY   M+FNP+ P 
Sbjct  75    ETLEKTETTLIEKSVNTIRFLAVDSVEKANSGHPGLPMGCAPMGHVLYDEFMKFNPKNPY  134

Query  1993  WFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVT  1814
             WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK   + GS TPGHPEN  T G+EVT
Sbjct  135   WFNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSTTPGHPENFETPGVEVT  194

Query  1813  TGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAH  1634
             TGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEGV +EA SLA H
Sbjct  195   TGPLGQGIANAVGLALAERHLAARFNKPDNEIVDHYTYVILGDGCQMEGVAHEACSLAGH  254

Query  1633  WKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSA  1454
             W L KL  LYDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A
Sbjct  255   WGLGKLIALYDDNHISIDGDTEIAFTENVDLRFEALGWHVIWVKNGNTGYDEIRAAIKEA  314

Query  1453  HTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPM  1277
              T   KPT I+V T IG  S  +  S + HG+     ++   ++ LRW     PFHV   
Sbjct  315   KTVKDKPTLIKVTTTIGYGSPNKSNSYSVHGSALGPKELDATRKNLRWP--YEPFHVPED  372

Query  1276  LYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSD  1097
             + +       +G  LE EW+++   Y+ KY +EA    +L+NG +  GWE +LP +    
Sbjct  373   VKKHWSRHVPEGAALEAEWNAQFAEYERKYKEEAAVLKSLINGELPAGWEKALPTYTPES  432

Query  1096  PVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVR  917
             P EATR  S +CLN LA V+PGL+GGSADL SSN + +  +G+F Q  +P  RN+R+GVR
Sbjct  433   PAEATRNSSQQCLNALANVLPGLLGGSADLASSNLSVMKQFGNF-QKGTPEERNVRFGVR  491

Query  916   EHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGED  737
             EH M  I NGI LH  GLIP+ ATF VF+DY++ ++R+SAL  AGVIY+MTHDSIGLGED
Sbjct  492   EHGMGAICNGIVLHCPGLIPYCATFFVFTDYLRPAMRISALCEAGVIYVMTHDSIGLGED  551

Query  736   GPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDG  557
             GPTHQP+EHLA  RA+P +L+ RP+DG ETA AYK+A+ NR +PS++AL R+ V + + G
Sbjct  552   GPTHQPIEHLASFRAMPNILMLRPADGTETAAAYKIAVLNRKRPSVLALGRRDV-SQLRG  610

Query  556   TSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRL  377
             TS +GV KGGYI++DNS    P+IILIGTG EL +  ++A  LR EG+ VRVVSLV W L
Sbjct  611   TSIEGVEKGGYIVTDNSSGNKPDIILIGTGSELEIAAKAADELRKEGKAVRVVSLVSWAL  670

Query  376   FERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKY  197
             F+ Q   YKE VLP+ V  RVSVEA S  GW ++VG +G  IG+D FGAS P   ++K+ 
Sbjct  671   FDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRFGASAPALKLYKEL  730

Query  196   GFTEENVSKTAR  161
             G T E V   A+
Sbjct  731   GVTAEAVIAAAK  742



>gb|KEI66557.1| Tkt [Planktothrix agardhii NIVA-CYA 126/8]
Length=668

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/665 (52%), Positives = 459/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKW+NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWYNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GSRTPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSRTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE H A+ FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHDAATFNKPDAALVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+++ +ED+S RFEA GW+ + V+N   D+E++ +A+  A   T KP
Sbjct  186   ALYDDNHISIDGNTEISFTEDVSKRFEAYGWHVLHVENGNTDLESIADAIAQAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             TFI+V T IG  S  ++ T+  H      D+V   ++ L W+    PF +        + 
Sbjct  246   TFIKVTTIIGYGSPNRQNTAGVHGAALGADEVAATRKNLGWN--YEPFEIPEDALAHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW+     Y+ KYPQEA +F    +G +  GWE SLP +   +  +ATR 
Sbjct  304   AVERGANLETEWNKTWADYKAKYPQEAAEFERRTSGILPEGWEKSLPTFTPDEKGKATRQ  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA  +P LIGGSADL  SN   + G+G+F Q    + RN+R+GVREH M  I
Sbjct  364   YSEGCLNALAPAIPELIGGSADLTHSNLTEIKGFGNF-QKGQYQNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGI LHG GL+P+ ATFLVF+DYM+ +IRL+ALS  GVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIGLHGSGLVPYCATFLVFADYMRAAIRLAALSEIGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP LLV RP+DGNET+GAYK+A+ NR +P+L+AL+RQ +  N++G+S D VG
Sbjct  483   ETIASLRVIPNLLVMRPADGNETSGAYKIAVENRHRPTLIALTRQAL-PNLNGSSIDVVG  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++ILIGTG E+ LC E A  L   G++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVLSDSEGT--PDLILIGTGSEVSLCVEVAEKLTQVGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KR++VEAG   GW+ Y G EG  I +D FGAS P   + +K+G+T +NV
Sbjct  600   YKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTFGASAPGGVLMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|XP_004964450.1| PREDICTED: transketolase, chloroplastic-like isoform X3 [Setaria 
italica]
Length=774

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/721 (50%), Positives = 476/721 (66%), Gaps = 44/721 (6%)
 Frame = -3

Query  2206  PSQACSAH----EWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             PS  C+ H    E  E +    +++++ CV+ +R L +D V++AK+GH GM +G A +G+
Sbjct  57    PSTKCAVHAIAIETLERNAASGQLLEK-CVNTIRFLAIDAVENAKSGHAGMPMGCAALGH  115

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  L+LAG+ S+   +LK+L + GSRT
Sbjct  116   ILYDEVMRYNPKNPYWFNRDRFVLSAGHGCVLQYALLYLAGYDSISEHELKQLGQWGSRT  175

Query  1858  PGHPENVITEGIEVTTG----------------------------------PLGQGVANA  1781
             PGHPE+ +T G+EVTTG                                  PLGQG+ANA
Sbjct  176   PGHPESFLTAGVEVTTGLFIIQSAHSNICNLACCYSYQTERFASPFGCSAGPLGQGIANA  235

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKP   IVDH TY I+GDGC MEG++NEA SLA HW L KL   YD
Sbjct  236   VGLALAEKHLAARFNKPGSEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIAFYD  295

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH ++DG T +  +ED+SARFEALGW+TI V N     + ++ A+  A   T +PT I+
Sbjct  296   DNHISVDGDTGIAFTEDVSARFEALGWHTIWVKNGNTGYDDIREAIKQAKAVTDRPTLIK  355

Query  1420  VKTCIGKLSKKEGTS-KAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S  AH G     +V+  +  L W     PF V   +         Q
Sbjct  356   VTTTIGFGSPNKANSYSAHGGPLGTKEVEATRHNLGWP--YEPFFVPEDVKSHWSHHVPQ  413

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G+ LE +W++K   Y+ KYP++A     +++G +   W   LP++  + P +ATR  S +
Sbjct  414   GDALEADWNAKFAEYEKKYPEDAATLKIIISGELPADWVDVLPKYTQASPADATRNLSQQ  473

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LAKV+PGL+GGSADL  SN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  474   CLNALAKVLPGLLGGSADLAPSNMTLLKMFGDF-QRDTPEERNVRFGVREHGMGAICNGI  532

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GL+P+ AT+  FSDYM+ ++R+SALS AGVI+IMTHDSIG+G++GPTHQP+EHL 
Sbjct  533   ALHSPGLVPYCATYFAFSDYMRAAMRVSALSEAGVIHIMTHDSIGVGKNGPTHQPIEHLM  592

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               R +P +LV RP+DGNETAGAYKVA+ NR +PS++ALS QK+  ++ GTS +GV KGGY
Sbjct  593   SFRTMPNILVLRPADGNETAGAYKVAVLNRKRPSVLALSMQKL-PHLPGTSVEGVEKGGY  651

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             IISDNS    P++I++ TG EL +  ++A  LR EG+ VRVVSLVCW LFE Q  EYKE 
Sbjct  652   IISDNSTGNKPDLIMLSTGSELQIAVKAADELRKEGKAVRVVSLVCWELFEEQSDEYKES  711

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP +V  R+SVEAG  LGW++YVG +G +IG+D FGAS P   +F++YG T  +V   A
Sbjct  712   VLPESVTARISVEAGCTLGWQKYVGTKGKIIGIDRFGASAPGEKIFEEYGITVGSVITAA  771

Query  163   R  161
             R
Sbjct  772   R  772



>ref|WP_015125605.1| transketolase [Synechococcus sp. PCC 6312]
 ref|YP_007062606.1| transketolase [Synechococcus sp. PCC 6312]
 gb|AFY62063.1| transketolase [Synechococcus sp. PCC 6312]
Length=671

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/662 (54%), Positives = 453/662 (68%), Gaps = 9/662 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A +G+ LY   MRFNP+ PKWFNRDRF
Sbjct  7     QSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMGFVLYDQFMRFNPKNPKWFNRDRF  66

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+L G+ SV IDD+K   +  S+TPGHPEN  T G+EVTTGPLGQG
Sbjct  67    VLSAGHGSMLQYALLYLTGYDSVTIDDIKSFRQWKSKTPGHPENFETAGVEVTTGPLGQG  126

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA+ +NKPD  +VDH TY I+GDGC+MEG++ EAAS+A HW L KL 
Sbjct  127   IANAVGLAVAEAHLAATYNKPDCTLVDHYTYVILGDGCNMEGISGEAASIAGHWGLGKLI  186

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+ A+  A+ +A + T KP
Sbjct  187   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHILHVENGNTDIAAIAKAIETAKSVTDKP  246

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+VK M++ L W+    PF V       M+ 
Sbjct  247   TMIKVTTTIGYGSPNKANTAGVHGAALGGDEVKLMRENLGWE--FAPFDVPADALAHMRK  304

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G + E EW S    Y+ KYP EA  F   ++G +   W++ LP +  +D    TR 
Sbjct  305   AIERGASYEAEWQSTYAQYKTKYPTEAAAFERQISGQLPANWDSVLPTYTAADKALPTRK  364

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S  CLN LA V+P LIGGSADL  SN   L GYGDF Q    + RNI +GVREHAM  I
Sbjct  365   NSETCLNKLAPVLPELIGGSADLTHSNLTELKGYGDF-QKGQYQNRNIHFGVREHAMGAI  423

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFL+F+DYM+ +IRLSALS AGVI++MTHDSIG GEDGPTHQP+
Sbjct  424   CNGIALHGSGLIPYGATFLIFTDYMRAAIRLSALSEAGVIWVMTHDSIGQGEDGPTHQPI  483

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DG E +GAY VAI  A   KP+L+A SRQ +  N+D TS +G
Sbjct  484   ETLASLRAIPNLTVIRPADGTEASGAYYVAITQAKEHKPTLLAFSRQNL-PNLDTTSIEG  542

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y+++D  G   PE+ILIGTG EL LC  +A  L   G++VRVVS+  + LFE Q 
Sbjct  543   VTKGAYVVADCEGT--PELILIGTGSELNLCITAAEKLTAAGKKVRVVSMPSFDLFEAQD  600

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR+SVEA S  GW +Y+G EG  + +D FGAS P   V +K+GF+ +
Sbjct  601   AAYKESVLPKAVTKRLSVEAASSFGWHKYIGTEGDTVSIDRFGASAPGGVVMEKFGFSVD  660

Query  181   NV  176
             NV
Sbjct  661   NV  662



>ref|XP_002991248.1| hypothetical protein SELMODRAFT_161534 [Selaginella moellendorffii]
 gb|EFJ07676.1| hypothetical protein SELMODRAFT_161534 [Selaginella moellendorffii]
Length=634

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/635 (56%), Positives = 448/635 (71%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A + + L+  VMRFNP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+
Sbjct  1     MGCAPMSHILFDEVMRFNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GSRTPGHPEN  T G+EVTTGPLGQGV NAVGLALAE +LA+RFNKPD  IVDH T
Sbjct  61    FRQWGSRTPGHPENFETPGVEVTTGPLGQGVGNAVGLALAEANLAARFNKPDATIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC+MEG++NEAASLA HW LNKL   YDDNH +IDG+TD+  +ED+  RFEALG
Sbjct  121   YVILGDGCNMEGISNEAASLAGHWGLNKLICFYDDNHISIDGSTDIAFTEDVVKRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V N     + ++ A+  A T   KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKNGNTGYDEIRAAIAEAKTIKDKPTMIKVTTTIGYGSPNKANSYSVHGSALGSK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V   ++ L W     PF V   +        + G  LE +W + L +Y+ KYP EA +F
Sbjct  241   EVDATRKNLGWP--YEPFVVPEEVKSHWSKHTKLGADLEAQWEASLAAYEKKYPTEAAEF  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
               L++G +  GW+ +LP +    P +ATR  S   LN L KV+PGLIGGSADL SSN   
Sbjct  299   KQLISGELPDGWDKALPVYTPESPGDATRNLSQTNLNALVKVLPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  YGDF Q  +P  RN+R+GVREH M  ISNGIALHG GLIP+ ATF VF+DYM+ +IR
Sbjct  359   LKAYGDF-QKSTPEERNVRFGVREHGMGAISNGIALHGSGLIPYCATFFVFTDYMRGAIR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             LSAL+ AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P + +FRP+DGNETAG+YKVA
Sbjct  418   LSALAEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNIFMFRPADGNETAGSYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + +R  PS++ALSRQK+   + G+S D V KG YI+SDNS    P++ILIGTG E+ +  
Sbjct  478   VLSRKTPSILALSRQKL-PQLAGSSIDAVSKGAYILSDNSSGNKPDLILIGTGSEVEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A V+R EG+ VRVVS  CW LFE+Q  EYKE V PS V  RVSVEAGS  GW +YVG 
Sbjct  537   KAADVIRKEGKSVRVVSFPCWELFEKQSDEYKESVFPSEVTARVSVEAGSTFGWGKYVGS  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              GV IG+D FGAS P   ++K++GFT +NV   A+
Sbjct  597   RGVAIGLDRFGASAPAGTLYKEFGFTVDNVVAKAK  631



>ref|XP_002953691.1| hypothetical protein VOLCADRAFT_75893 [Volvox carteri f. nagariensis]
 gb|EFJ45315.1| hypothetical protein VOLCADRAFT_75893 [Volvox carteri f. nagariensis]
Length=715

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/667 (52%), Positives = 460/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2155  QEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDR  1976
             +++VD+ C++ +R L +D V  +K+GH GM +G A +GY L+  VM++NP+ P WFNRDR
Sbjct  52    RDLVDK-CINAIRFLAIDAVNKSKSGHPGMPMGCAPMGYLLWNEVMKYNPKNPDWFNRDR  110

Query  1975  FVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQ  1796
             FVLSAGHGS+ QY  LHL G+ SV ++++K+  + GS TPGHPEN +T G+EVTTGPLGQ
Sbjct  111   FVLSAGHGSMFQYAMLHLTGYDSVPLNEVKQFRQWGSLTPGHPENFVTPGVEVTTGPLGQ  170

Query  1795  GVANAVGLALAEVHLASRFNKPDI-PIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNK  1619
             G+ NAVGLA+AE HLA+RFNKPD  PIVDH TYCI+GDGC MEG++NEA SLA HW L K
Sbjct  171   GICNAVGLAVAEAHLAARFNKPDCKPIVDHYTYCILGDGCMMEGISNEACSLAGHWGLGK  230

Query  1618  LTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQ  1439
             L  LYDDN  +IDG TD++ +ED++ R+EALGW+ I V N   D++ L+ A+  A     
Sbjct  231   LIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVINGNTDIDGLRAAITQAKAVKD  290

Query  1438  KPTFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREM  1262
             KPT I+V T IG  S  K  T   H      ++    ++ L W+     F V   +Y   
Sbjct  291   KPTLIKVSTLIGYGSPNKADTHDVHGAPLGPEETAATRKNLGWEYPE--FEVPQDVYDVF  348

Query  1261  KLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEAT  1082
             +   ++GE  E+EW      Y+ KYP E  +F +L +G +   W  +LP +   D   AT
Sbjct  349   RAAIQRGEASEKEWKQTCEEYKAKYPTEWAEFESLTSGKLPENWANALPTFKPEDKQLAT  408

Query  1081  RGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMA  902
             R +S   +N LA V+PGLIGGSADL  SN   +   GDF Q  S   RN+R+GVREHAM 
Sbjct  409   RQHSQTMINALAPVLPGLIGGSADLAPSNLTLMKISGDF-QKGSYAERNVRFGVREHAMG  467

Query  901   GISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQ  722
              I NGIALH  GLIP+ ATF +F+DYM+N++R+SALS AGVIY+MTHDSIGLGEDGPTHQ
Sbjct  468   AICNGIALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVIYVMTHDSIGLGEDGPTHQ  527

Query  721   PVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADG  542
             PVEHLA  RA+P +++ RP+ GNETAGAYKVA+ NR +P+ +ALSRQ +  N+ GTS +G
Sbjct  528   PVEHLASFRAMPSMMMMRPAGGNETAGAYKVAVENRKRPTTIALSRQNM-PNLPGTSVEG  586

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y+I D +G   P++IL+GTG EL LC E+A +L  EG++VR+VS  CW LFE Q 
Sbjct  587   VAKGAYVIRDAAG--TPDVILMGTGSELQLCAEAADILEKEGKKVRIVSFPCWELFEEQS  644

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
              EYKE VLP +V  RVSVEA +  GW +Y+G +G  +G+D+FGAS P   +++KYG T  
Sbjct  645   AEYKESVLPRSVEARVSVEAATSFGWAKYLGFKGKHVGIDDFGASAPAPVLYEKYGITTP  704

Query  181   NVSKTAR  161
              V + A+
Sbjct  705   KVVEAAK  711



>ref|XP_004964448.1| PREDICTED: transketolase, chloroplastic-like isoform X1 [Setaria 
italica]
Length=818

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/721 (50%), Positives = 476/721 (66%), Gaps = 44/721 (6%)
 Frame = -3

Query  2206  PSQACSAH----EWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGY  2039
             PS  C+ H    E  E +    +++++ CV+ +R L +D V++AK+GH GM +G A +G+
Sbjct  101   PSTKCAVHAIAIETLERNAASGQLLEK-CVNTIRFLAIDAVENAKSGHAGMPMGCAALGH  159

Query  2038  FLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRT  1859
              LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  L+LAG+ S+   +LK+L + GSRT
Sbjct  160   ILYDEVMRYNPKNPYWFNRDRFVLSAGHGCVLQYALLYLAGYDSISEHELKQLGQWGSRT  219

Query  1858  PGHPENVITEGIEVTTG----------------------------------PLGQGVANA  1781
             PGHPE+ +T G+EVTTG                                  PLGQG+ANA
Sbjct  220   PGHPESFLTAGVEVTTGLFIIQSAHSNICNLACCYSYQTERFASPFGCSAGPLGQGIANA  279

Query  1780  VGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             VGLALAE HLA+RFNKP   IVDH TY I+GDGC MEG++NEA SLA HW L KL   YD
Sbjct  280   VGLALAEKHLAARFNKPGSEIVDHYTYVILGDGCQMEGISNEACSLAGHWGLGKLIAFYD  339

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DNH ++DG T +  +ED+SARFEALGW+TI V N     + ++ A+  A   T +PT I+
Sbjct  340   DNHISVDGDTGIAFTEDVSARFEALGWHTIWVKNGNTGYDDIREAIKQAKAVTDRPTLIK  399

Query  1420  VKTCIGKLSKKEGTS-KAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S  AH G     +V+  +  L W     PF V   +         Q
Sbjct  400   VTTTIGFGSPNKANSYSAHGGPLGTKEVEATRHNLGWP--YEPFFVPEDVKSHWSHHVPQ  457

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G+ LE +W++K   Y+ KYP++A     +++G +   W   LP++  + P +ATR  S +
Sbjct  458   GDALEADWNAKFAEYEKKYPEDAATLKIIISGELPADWVDVLPKYTQASPADATRNLSQQ  517

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
             CLN LAKV+PGL+GGSADL  SN   L  +GDF Q D+P  RN+R+GVREH M  I NGI
Sbjct  518   CLNALAKVLPGLLGGSADLAPSNMTLLKMFGDF-QRDTPEERNVRFGVREHGMGAICNGI  576

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GL+P+ AT+  FSDYM+ ++R+SALS AGVI+IMTHDSIG+G++GPTHQP+EHL 
Sbjct  577   ALHSPGLVPYCATYFAFSDYMRAAMRVSALSEAGVIHIMTHDSIGVGKNGPTHQPIEHLM  636

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               R +P +LV RP+DGNETAGAYKVA+ NR +PS++ALS QK+  ++ GTS +GV KGGY
Sbjct  637   SFRTMPNILVLRPADGNETAGAYKVAVLNRKRPSVLALSMQKL-PHLPGTSVEGVEKGGY  695

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
             IISDNS    P++I++ TG EL +  ++A  LR EG+ VRVVSLVCW LFE Q  EYKE 
Sbjct  696   IISDNSTGNKPDLIMLSTGSELQIAVKAADELRKEGKAVRVVSLVCWELFEEQSDEYKES  755

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP +V  R+SVEAG  LGW++YVG +G +IG+D FGAS P   +F++YG T  +V   A
Sbjct  756   VLPESVTARISVEAGCTLGWQKYVGTKGKIIGIDRFGASAPGEKIFEEYGITVGSVITAA  815

Query  163   R  161
             R
Sbjct  816   R  816



>ref|XP_008658482.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW85983.1| transketolase isoform 1 [Zea mays]
 gb|AFW85984.1| transketolase isoform 2 [Zea mays]
Length=633

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/635 (55%), Positives = 445/635 (70%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+
Sbjct  1     MGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GSRTPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSRTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +ED+S RFEALG
Sbjct  121   YVILGDGCQMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSTRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKNGNTGYDDIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +Q L W      F V   +         +G  LE +W++K   Y+ KY  +A   
Sbjct  241   EVEATRQNLGWP--YDTFFVPEDVKSHWSRHTPEGAALEADWNAKFAEYEKKYADDAATL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              +++ G +  GW  +LP++    P +ATR  S +CLN LA VVPGLIGGSADL SSN   
Sbjct  299   KSIITGELPTGWVDALPKYTPESPGDATRNLSQQCLNALANVVPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +GDF Q D+   RN+R+GVREH M  I NGIALH  G +P+ ATF VF+DYM+ ++R
Sbjct  359   LKMFGDF-QKDTAEERNVRFGVREHGMGAICNGIALHSPGFVPYCATFFVFTDYMRGAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYKVA
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + NR +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS    P+II++GTG EL +  
Sbjct  478   VLNRKRPSILALSRQKL-PHLPGTSIEGVEKGGYTISDNSTGNKPDIIVMGTGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR EG+ VRVVS V W LF+ Q  EYKE VLP+ V  R+S+EAGS LGW++YVG 
Sbjct  537   KAADELRKEGKTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGA  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D+FGAS P   ++K+YG T E++   A+
Sbjct  597   QGKAIGIDKFGASAPAGTIYKEYGITVESIIAAAK  631



>ref|WP_004268410.1| transketolase [Microcystis aeruginosa]
 emb|CCI36467.1| Transketolase (TK) [Microcystis aeruginosa PCC 9701]
Length=668

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLASRFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLASRFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y I+D+ G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYTITDSEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|XP_009143123.1| PREDICTED: transketolase-2, chloroplastic [Brassica rapa]
Length=736

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/664 (53%), Positives = 461/664 (69%), Gaps = 6/664 (1%)
 Frame = -3

Query  2149  MVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFV  1970
             +VD+  V+ +R L +D V+ AK+GH G+ +G A + + LY  VMR+NP+ P WFNRDRFV
Sbjct  75    LVDK-SVNTIRFLAIDAVEKAKSGHPGLPMGCAPMSHILYDEVMRYNPKNPYWFNRDRFV  133

Query  1969  LSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGV  1790
             LSAGHG +LQY  LHLAG+ SV+ +DLK   + GS+TPGHPEN  T G+EVTTGPLGQG+
Sbjct  134   LSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSKTPGHPENFETPGVEVTTGPLGQGI  193

Query  1789  ANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTL  1610
             ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+TNE  SLAAHW L KL  
Sbjct  194   ANAVGLALAEKHLAARFNKPDNEIVDHYTYSIIGDGCQMEGITNEVCSLAAHWGLGKLIA  253

Query  1609  LYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPT  1430
              YDDNH +IDG T++  +E++  RFEALGW+ I V N     + ++ A+  A     KPT
Sbjct  254   FYDDNHISIDGDTEIAFTENVDKRFEALGWHVIWVKNGNNGYDEIRAAIKEAKAVKDKPT  313

Query  1429  FIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQ  1253
              I+V T IG  S  +  S + HG    E +V+  +  L W     PF V   +       
Sbjct  314   LIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGW--AYEPFQVPEDVKSHWSRH  371

Query  1252  AEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGY  1073
               +G  LE +W++K  +Y+ KYP+EA++  ++++G +  GWE +LP +    P +ATR  
Sbjct  372   TPEGAALEADWNAKFSAYEKKYPEEAEELKSIISGDLPAGWEKALPTYTPESPGDATRNL  431

Query  1072  SGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGIS  893
             S +CLN LAK +PG +GGSADL SSN   L  +GDF Q  +P GRN+R+GVREH M  I 
Sbjct  432   SQQCLNALAKSLPGFLGGSADLASSNMTLLKAFGDF-QNATPEGRNLRFGVREHGMGAIC  490

Query  892   NGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVE  713
             NG+ALH  G IP+ ATF VF+DYM+ ++R++ALS AGVIY+MTHDSIGLGEDGPTHQPVE
Sbjct  491   NGVALHSPGFIPYCATFFVFTDYMRAAMRIAALSEAGVIYVMTHDSIGLGEDGPTHQPVE  550

Query  712   HLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGK  533
             HL+  RA+P +++FRP+DGNETAGAYK+A+A R+ PS++ALSRQK+   + GTS + V +
Sbjct  551   HLSSFRAMPNIMMFRPADGNETAGAYKIAVARRNTPSVLALSRQKL-PQLRGTSIENVER  609

Query  532   GGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREY  353
             GGYII+DNS    P++IL+GTG EL +  ++   LR EG+ VRVVS VCW LF+ Q   Y
Sbjct  610   GGYIITDNSNGNKPDVILVGTGSELEIAAKAGEELRKEGKSVRVVSFVCWELFDEQTDAY  669

Query  352   KEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVS  173
             KE VLPS    RVS+EAGS  GW + VG +G  IG+D FGAS P   ++K++G T E V 
Sbjct  670   KESVLPSEGSARVSIEAGSTFGWGKVVGGKGKSIGIDSFGASAPAGKLYKEFGITVEAVV  729

Query  172   KTAR  161
               A+
Sbjct  730   AAAK  733



>ref|XP_002991185.1| hypothetical protein SELMODRAFT_161485 [Selaginella moellendorffii]
 gb|EFJ07729.1| hypothetical protein SELMODRAFT_161485 [Selaginella moellendorffii]
Length=634

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/635 (56%), Positives = 447/635 (70%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A + + L+  VMRFNP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+
Sbjct  1     MGCAPMSHILFDEVMRFNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQ  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               +  SRTPGHPEN  T G+EVTTGPLGQGV NAVGLALAE +LA+RFNKPD  IVDH T
Sbjct  61    FRQWSSRTPGHPENFETPGVEVTTGPLGQGVGNAVGLALAEANLAARFNKPDATIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC+MEG++NEAASLA HW LNKL   YDDNH +IDG+TD+  +ED+  RFEALG
Sbjct  121   YVILGDGCNMEGISNEAASLAGHWGLNKLICFYDDNHISIDGSTDIAFTEDVEKRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+TI V N     + ++ A+  A T   KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHTIWVKNGNTGYDEIRAAIAEAKTIKDKPTMIKVTTTIGYGSPNKANSYSVHGSALGSK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V   ++ L W     PF V   +        + G  LE +W + L +Y+ KYP EA +F
Sbjct  241   EVDATRKNLGWP--YEPFVVPEEVKSHWSKHTKLGADLEAQWEASLAAYEKKYPTEAAEF  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
               L++G +  GW+ +LP +    P +ATR  S   LN L KV+PGLIGGSADL SSN   
Sbjct  299   KQLISGELPDGWDKALPVYTPESPGDATRNLSQTNLNALVKVLPGLIGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  YGDF Q  +P  RN+R+GVREH M  ISNGIALHG GLIP+ ATF VF+DYM+ +IR
Sbjct  359   LKAYGDF-QKSTPEERNVRFGVREHGMGAISNGIALHGSGLIPYCATFFVFTDYMRGAIR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             LSAL+ AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P + +FRP+DGNETAG+YKVA
Sbjct  418   LSALAEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNIFMFRPADGNETAGSYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             + +R  PS++ALSRQK+   + G+S D V KG YI+SDNS    P++ILIGTG E+ +  
Sbjct  478   VLSRKTPSILALSRQKL-PQLAGSSIDAVSKGAYILSDNSSGNKPDLILIGTGSEVEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A V+R EG+ VRVVS  CW LFE+Q  EYKE V PS V  RVSVEAGS  GW +YVG 
Sbjct  537   KAADVIRKEGKSVRVVSFPCWELFEKQSDEYKESVFPSEVTARVSVEAGSTFGWGKYVGS  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
              GV IG+D FGAS P   ++K++GFT +NV   A+
Sbjct  597   RGVAIGLDRFGASAPAGTLYKEFGFTVDNVVAKAK  631



>gb|KDO85800.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=719

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/691 (52%), Positives = 455/691 (66%), Gaps = 37/691 (5%)
 Frame = -3

Query  2230  LEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLA  2051
             L   + + P +A +    E   D     +  + V+ +R L VD V+ A +GH G+ +G A
Sbjct  62    LSTSQASLPIRAAAVETLETSTDA---ALVEKSVNTIRFLAVDAVEKANSGHPGLPMGCA  118

Query  2050  EVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKL  1871
              +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ DDLK   + 
Sbjct  119   PMGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEDDLKNFRQW  178

Query  1870  GSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIM  1691
             GS+TPGHPEN  T GIEVTTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+
Sbjct  179   GSKTPGHPENFETPGIEVTTGPLGQGMANAVGLALAEKHLAARYNKPDNEIVDHYTYVIL  238

Query  1690  GDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTI  1511
             GDGC MEG+ NEA+SLA H  L KL   YDDNH +IDG T++  +E++  RFE LGW+ I
Sbjct  239   GDGCQMEGIANEASSLAGHLGLGKLIAFYDDNHISIDGDTEIAFTENVDKRFEGLGWHVI  298

Query  1510  TVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQ  1334
                                           V T IG  S  +  S + HG+     +V  
Sbjct  299   -----------------------------WVTTTIGFGSPNKANSYSVHGSALGAKEVDA  329

Query  1333  MKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALL  1154
              ++ L W     PFHV   + +       +G TLE EW++K   Y+ KYP+EA +F ++ 
Sbjct  330   TRKNLGWP--YEPFHVPEDVKKHWSRHVAEGATLEAEWNAKFAEYEKKYPEEAAEFKSIS  387

Query  1153  NGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGY  974
             +G +  GWE +LP +    P EATR  S  CLN LAK +PGL+GGSADL SSN   L  +
Sbjct  388   SGQLPAGWEKALPTYTPESPAEATRNLSQTCLNALAKTLPGLLGGSADLASSNMTLLKMF  447

Query  973   GDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSAL  794
             GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL
Sbjct  448   GDF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISAL  506

Query  793   SHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANR  614
               AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ANR
Sbjct  507   CEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVANR  566

Query  613   DKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAG  434
              +PS++ALSRQK+  ++ GTS DGV KG YIISDNS    P++ILIGTG EL +  ++A 
Sbjct  567   KRPSILALSRQKL-PHLAGTSIDGVEKGAYIISDNSSGNKPDVILIGTGSELEIAAKAAE  625

Query  433   VLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVV  254
              LR  G+ VRVVS V W LF+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  
Sbjct  626   ELRKGGKAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKA  685

Query  253   IGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             IG+D FGAS P   ++K++G T E V   A+
Sbjct  686   IGIDRFGASAPAGKIYKEFGITAEAVITAAK  716



>ref|WP_023071196.1| transketolase [Leptolyngbya sp. Heron Island J]
 gb|ESA38068.1| transketolase [Leptolyngbya sp. Heron Island J]
Length=665

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/665 (52%), Positives = 455/665 (68%), Gaps = 8/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++ +C++ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLETQCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDQFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV+++D+K   + G+ TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVKLEDIKNFRQWGATTPGHPENFETLGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + N VGLA+AE HLA+RFNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   ICNGVGLAMAEAHLAARFNKPDCTLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+ A+  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVLHVEDGNTDLSAIAKAIEEAKQVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H     +D++   +Q L W+    PF +   +    + 
Sbjct  246   TMIKVTTTIGYGSPNKADTAGVHGAALGDDEITLTRQNLGWN--YAPFEIPEDVLTRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G + E EW   L +Y+ KY  EA  F  +++G +  GWE +LP +       ATR 
Sbjct  304   AIDKGASAEAEWTQTLATYRTKYADEAALFERMISGKLPEGWEAALPTYSPEGKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA  VP L+GGSADL  SN   +   GDF Q  +   RN+R+GVREH M  I
Sbjct  364   TSEATLNALAPAVPELVGGSADLAKSNNTLMTISGDF-QKGAYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGV+Y+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALSEAGVLYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L V RP+DGNET+GAYKVAIA+R  P+LMA SRQ +   +DG+S DGV 
Sbjct  483   ETIASLRAIPNLYVIRPADGNETSGAYKVAIASRKTPTLMAFSRQNL-PQLDGSSIDGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y+ISD++G +L   ILIGTG E+ LC E+A  LR +G++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVISDDAGADL---ILIGTGSEVSLCVEAAEQLRADGQKVRVVSMPCWELFEAQDAA  598

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KR++VEAG  +GW +Y G EG +I +D FGAS P   + +++G+T ENV
Sbjct  599   YKESVLPKAVTKRLAVEAGISMGWGKYYGAEGDIISVDRFGASAPGGRIMQEFGYTVENV  658

Query  175   SKTAR  161
                A+
Sbjct  659   VARAK  663



>ref|WP_017292875.1| transketolase [Geminocystis herdmanii]
Length=670

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/665 (54%), Positives = 459/665 (69%), Gaps = 5/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +   CV+ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P+W NRDRF
Sbjct  6     QSIQELCVNAIRFLSIDGVEKAKSGHPGLPMGAAPMSFVLWDQFMRFNPKNPQWINRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  LHL G+ SV IDDLK+  +  S+TPGHPEN +T GIEVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYSLLHLFGYDSVTIDDLKQFRQWKSKTPGHPENFVTAGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HL +++NKPD  ++DH TY I+GDGC+MEG++ EAASLA HW L KL 
Sbjct  126   IANGVGLALAEAHLGAKYNKPDATLIDHYTYVILGDGCNMEGISGEAASLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D++A+  A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVLHVENGNTDLDAIAAAIAEAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S KK  T+  H      D+V+  ++ L W+    PF V    Y     
Sbjct  246   TMIKVTTTIGYGSPKKANTAGVHGAALGGDEVEATRKNLGWN--YEPFVVPQEAYDYFNK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G +LE EW+  L +Y+ KYP EAK+F  + +G +   W   LP +   D   A+R 
Sbjct  304   AIERGASLEAEWNQTLATYKTKYPTEAKEFETITSGVLPENWADCLPSYTPEDAPLASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN ++KV+P LIGGSADL  SN   L   GDF Q  +   RN+ +GVREHAM  I
Sbjct  364   HSENCLNAISKVLPQLIGGSADLTHSNLTQLKISGDF-QKGAYENRNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              N I+LH  GLIP+ ATFLVFSDYM+NSIRLSALS A VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNAISLHNTGLIPYGATFLVFSDYMRNSIRLSALSEAQVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LR IP LLVFRP+DGNET+GAYKVAI  + K SLMAL+RQ +  N+ G+S D V 
Sbjct  483   EHVASLRLIPDLLVFRPADGNETSGAYKVAIETKKKSSLMALTRQNL-PNLAGSSIDAVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY+ +        ++ILIGTG E+ LC ++A  L+ EG +VRVVS+ C  LF+ Q  E
Sbjct  542   KGGYVAACGFAPNELDLILIGTGSEVGLCIDAAEKLKAEGLKVRVVSMPCVELFDLQSDE  601

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  ++KRVSVEAG   GW  +VGDEG  IG++ +GAS P   V +K+GFT +NV
Sbjct  602   YKESVLPKAIKKRVSVEAGVTFGWERFVGDEGACIGINTYGASAPGNVVMEKFGFTVDNV  661

Query  175   SKTAR  161
               TA+
Sbjct  662   VATAK  666



>ref|WP_012629867.1| transketolase [Cyanothece sp. PCC 7425]
 ref|YP_002485182.1| transketolase [Cyanothece sp. PCC 7425]
 gb|ACL46821.1| transketolase [Cyanothece sp. PCC 7425]
Length=669

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 459/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  7     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDQFMRFNPKNPKWFNRDRF  66

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV ++D+K   + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  67    VLSAGHGCMLQYALLYLTGYDSVGLEDIKNFRQWGSRTPGHPENFETPGVEVTTGPLGQG  126

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  127   IANAVGLAIAEAHLAAKFNKPDSTLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  186

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+  RFEA GW+   V+N   D+  +  A+ +A   T +P
Sbjct  187   ALYDDNHISIDGSTDIAFTEDVGKRFEAYGWHVQHVENGNTDLAGIAQAIAAAKAVTDRP  246

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+V+  +  L W+    PF V     +  + 
Sbjct  247   SLIKVTTTIGFGSPNKANTADVHGAALGADEVQATRTNLGWE--YDPFVVPEDALKRFRQ  304

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G  LE EW     +YQ KYP+ A +F  + +G +  GW+  LP +   D  +A+R 
Sbjct  305   AVDRGANLESEWQQTWQTYQTKYPEAAAEFARITSGQLPEGWDKVLPVYTPEDKAQASRK  364

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LAKV+P LIGGSADL  SN   L G+GDF Q  S   RN+R+GVREH M  I
Sbjct  365   HSEICLNALAKVLPELIGGSADLTHSNYTLLKGFGDF-QKGSFANRNLRFGVREHGMGAI  423

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGVI++MTHDS+ LGEDGPTHQPV
Sbjct  424   CNGIALHSSGLIPYGATFLVFTDYMRGAIRLSALSEAGVIWVMTHDSVALGEDGPTHQPV  483

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP LLV RP+DG ET+GAYKVAIANR +P+L+ALSRQ +  N+ G++ D V 
Sbjct  484   ETVASLRAIPNLLVIRPADGTETSGAYKVAIANRHRPTLLALSRQNL-PNLAGSTIDNVA  542

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD  G   P++ILIGTG E+ LC ++A  L  EG +VRVVS+ CW LF+ Q   
Sbjct  543   KGAYILSDCEGT--PDLILIGTGSEVNLCLQAAKELSAEGTKVRVVSMPCWELFDEQDGA  600

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLP+ V+KR++VEAGS  GW +Y G EG V+G+D FGAS P     +K+GFT  NV
Sbjct  601   YRESVLPAAVKKRLAVEAGSSFGWCKYTGTEGDVVGIDSFGASAPGGVCLEKFGFTLANV  660

Query  175   SKTAR  161
                A+
Sbjct  661   VAKAK  665



>gb|ACF88120.1| unknown [Zea mays]
Length=628

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/630 (55%), Positives = 442/630 (70%), Gaps = 5/630 (1%)
 Frame = -3

Query  2047  VGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLG  1868
             +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+  + G
Sbjct  1     MGHVLYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQFRQWG  60

Query  1867  SRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMG  1688
             SRTPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+G
Sbjct  61    SRTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYVILG  120

Query  1687  DGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTIT  1508
             DGC MEG+ NEA SLA HW L KL   YDDNH +IDG T++  +ED+S RFEALGW+TI 
Sbjct  121   DGCQMEGIANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSTRFEALGWHTIW  180

Query  1507  VDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQM  1331
             V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG+     +V+  
Sbjct  181   VKNGNTGYDDIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAKEVEAT  240

Query  1330  KQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLN  1151
             +Q L W      F V   +         +G  LE +W++K   Y+ KY  +A    +++ 
Sbjct  241   RQNLGWP--YDTFFVPEDVKSHWSRHTPEGAALEADWNAKFAEYEKKYADDAATLKSIIT  298

Query  1150  GGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYG  971
             G +  GW  +LP++    P +ATR  S +CLN LA VVPGLIGGSADL SSN   L  +G
Sbjct  299   GELPTGWVDALPKYTPESPGDATRNLSQQCLNALANVVPGLIGGSADLASSNMTLLKMFG  358

Query  970   DFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALS  791
             DF Q D+   RN+R+GVREH M  I NGIALH  G +P+ ATF VF+DYM+ ++R+SALS
Sbjct  359   DF-QKDTAEERNVRFGVREHGMGAICNGIALHSPGFVPYCATFFVFTDYMRGAMRISALS  417

Query  790   HAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRD  611
              AGVIY+MTHDSIGLGEDGPTHQP+EHL   RA+P +L+ RP+DGNETAGAYKVA+ NR 
Sbjct  418   EAGVIYVMTHDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVAVLNRK  477

Query  610   KPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGV  431
             +PS++ALSRQK+  ++ GTS +GV KGGY ISDNS    P+II++GTG EL +  ++A  
Sbjct  478   RPSILALSRQKL-PHLPGTSIEGVEKGGYTISDNSTGNKPDIIVMGTGSELEIAAKAADE  536

Query  430   LRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVI  251
             LR EG+ VRVVS V W LF+ Q  EYKE VLP+ V  R+S+EAGS LGW++YVG +G  I
Sbjct  537   LRKEGKTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAI  596

Query  250   GMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             G+D+FGAS P   ++K+YG T E++   A+
Sbjct  597   GIDKFGASAPAGTIYKEYGITVESIIAAAK  626



>ref|WP_016868432.1| transketolase [Fischerella muscicola]
Length=670

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/667 (53%), Positives = 460/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+  RFEA GW+   V +   ++EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVGKRFEAYGWHVQAVSDGDTNLEAIHKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W++   PF +     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVAATRNNLGWEH--EPFVIPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   E +W+     Y+ KYPQEA +F   ++G +  GWE +LP +       ATR 
Sbjct  304   AVDRGAEYESQWNKTFADYKAKYPQEAAEFERQISGKLPEGWEKALPTYEPGSKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P LIGGSADL  SN   L G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPELIGGSADLTHSNLTELKGAGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSEAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S +G
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIENANQHRPTLLALSRQNL-PQLEGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P+IILIGTG E+ LC ++A  LR EG++VRVVS+  W LF  Q 
Sbjct  542   VTKGAYILSDSEGT--PDIILIGTGSEVPLCVDAAAKLRAEGKKVRVVSMPSWELFNAQS  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V+KR++VEA S  GW  Y+GDEG +I +D FG S P   + +K+G+T +
Sbjct  600   ESYRESVLPKAVKKRLAVEAASSFGWCRYLGDEGAMISVDRFGVSAPGGVIMEKFGYTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVTKAK  666



>ref|WP_002798627.1| transketolase [Microcystis aeruginosa]
 emb|CCI28024.1| Transketolase (TK) [Microcystis aeruginosa PCC 9809]
Length=668

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/665 (53%), Positives = 464/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ SA   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIASAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS DGV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLDGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_006619819.1| transketolase [Arthrospira platensis]
 ref|YP_005068570.1| transketolase [Arthrospira platensis NIES-39]
 dbj|BAI90032.1| transketolase [Arthrospira platensis NIES-39]
 gb|KDR58955.1| transketolase [Arthrospira platensis str. Paraca]
Length=669

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/666 (54%), Positives = 463/666 (70%), Gaps = 8/666 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHLAG+ SV IDD+K+  + GS+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLHYALLHLAGYDSVSIDDIKQFRQWGSKTPGHPENHVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAARFNKPDCTVVDHYTYAILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD++ +ED+  RFEA GW+   V +   D+EA+  A+  A   T KP
Sbjct  186   AFYDDNHISIDGSTDISFTEDVCKRFEAYGWHVQHVADGNTDLEAIATAIEKAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP-MLYREMK  1259
             + I+V T IG  S  +  S   HG    + +V+  +  L W     P  VIP    +  +
Sbjct  246   SLIKVTTTIGFGSPNKANSHDVHGAALGKAEVQATRDHLGWSY---PEFVIPDDAIKHFR  302

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                E+G   E EW +   +Y++KYP+EA     LL+G +  GWE SLP +      +ATR
Sbjct  303   KAVERGANYEDEWKAAFETYKSKYPEEAATLERLLSGKLPQGWEKSLPTYTPETKADATR  362

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               SG  LN +A V+P L+GGSADL  SN+  L G GDF Q    + RN+R+GVREHAM  
Sbjct  363   NQSGATLNAIAGVLPELVGGSADLAPSNKTLLKGLGDF-QKGQYQNRNLRFGVREHAMGA  421

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A V+++MTHDSI LGEDGPTHQP
Sbjct  422   ICNGIALHRSGLIPYGATFLVFTDYMRNSIRLSALSEAPVLWVMTHDSIALGEDGPTHQP  481

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             VEH+A LR IP L V RP+DGNET+GAYKVAI NR  P+LMA SRQ +  N++G+S D V
Sbjct  482   VEHIASLRLIPDLTVIRPADGNETSGAYKVAIENRHYPTLMAFSRQNL-PNLEGSSIDNV  540

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KG YI+SDNS +  P+IILIGTG E  LC ++A  LR EG++VRVVS+  W LFE+Q  
Sbjct  541   AKGAYILSDNS-DGTPDIILIGTGGETYLCVDAAVKLREEGKKVRVVSMPSWELFEKQDA  599

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
              YKE V P++V+KR++VEAG   GW  YV DEG  I +D FGAS P   V +K+GFT +N
Sbjct  600   AYKESVFPASVKKRLAVEAGVSFGWCRYVTDEGATISIDTFGASAPGGVVLEKFGFTVDN  659

Query  178   VSKTAR  161
             V   A+
Sbjct  660   VVAKAK  665



>ref|WP_015187816.1| transketolase [Gloeocapsa sp. PCC 7428]
 ref|YP_007127100.1| transketolase [Gloeocapsa sp. PCC 7428]
 gb|AFZ29940.1| transketolase [Gloeocapsa sp. PCC 7428]
Length=677

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/673 (52%), Positives = 467/673 (69%), Gaps = 15/673 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P W+NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPTWYNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHGS+L Y  L+L G++ + ++DLK+  +  S+TPGHPEN +  G+E+TTGPLGQG
Sbjct  66    LLSAGHGSMLLYALLYLTGYEDLTLEDLKQFRQWESKTPGHPENFMNPGVEITTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VG+A+AE HLA++FNKPD PIVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGIAMAEAHLAAKFNKPDFPIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL  +ED+  RFEA GW+   V++   D++A+  A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDLAFTEDVGKRFEAYGWHVQVVEDGNTDLDAIHKAIEVAQSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S KK  T  AH      D+VK  ++ L W++   PF V        + 
Sbjct  246   SLIKVRTTIGYGSPKKANTRHAHGEALGADEVKATREHLGWNH--EPFEVPEDALNHWRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G  LEQEW+     Y+ +YP+EA+    +    +  GW++ LP +   D   ATR 
Sbjct  304   AIDRGAKLEQEWNQLFERYKEQYPEEARLLKRMHEAELPEGWDSVLPTYSPEDKGIATRV  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +SG CLN +A+V+P LIGGSADL  SN   L   GDF Q      R IR+GVREH M  I
Sbjct  364   HSGNCLNAIAEVLPELIGGSADLAPSNNTLLKSSGDF-QKGQYENRYIRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+AL G GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSI LGEDGPTHQP+
Sbjct  423   CNGLALDGSGLIPYCATFLVFTDYMRAAIRLSALSEAGVIYVMTHDSIALGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--------ANRDKPSLMALSRQKVAANMD  560
             EH+A LRAIP L V RP+DGNET+GAYKVAI         N+ +PS++AL+RQ V  N+ 
Sbjct  483   EHVASLRAIPDLYVIRPADGNETSGAYKVAIKAARGKRYGNKTRPSVLALTRQAV-PNLA  541

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             G+S +GV KG Y++SD+ G   P++I+IGTG E  LC ++A  LR+EG++VRVVS+ CW 
Sbjct  542   GSSIEGVTKGAYVLSDSDG--TPDLIMIGTGSETQLCVQAAEQLRSEGKKVRVVSMPCWE  599

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             +FE Q  EY+E VLP  V+KRVSVEAGS  GW  YVGDEG+ IG+D++G+S P +   +K
Sbjct  600   VFEEQDAEYRESVLPKAVKKRVSVEAGSTFGWCRYVGDEGIAIGIDQYGSSAPGSVCMEK  659

Query  199   YGFTEENVSKTAR  161
             +GFT +NV   A+
Sbjct  660   FGFTVDNVVAKAK  672



>ref|WP_039725552.1| transketolase [Lyngbya confervoides]
 gb|KIF13881.1| transketolase [Aphanocapsa montana BDHKU210001]
 gb|KIF38823.1| transketolase [Lyngbya confervoides BDU141951]
Length=666

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/658 (54%), Positives = 448/658 (68%), Gaps = 7/658 (1%)
 Frame = -3

Query  2134  CVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGH  1955
             CV+++R L +D VQ A +GH G+ +G A + Y L+  VMRFNP+ P+WFNRDRFVLSAGH
Sbjct  12    CVNSIRFLAIDAVQKANSGHPGLPMGAAPMAYVLWDKVMRFNPKNPQWFNRDRFVLSAGH  71

Query  1954  GSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVG  1775
             G +LQY  L+L G+ SV +DD+K+  + GS TPGHPEN  T GIEVTTGPLGQG+ N VG
Sbjct  72    GCMLQYALLYLTGYDSVSLDDIKQFRQWGSTTPGHPENFETPGIEVTTGPLGQGICNGVG  131

Query  1774  LALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDN  1595
             LA+AE HLASRFNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL  LYDDN
Sbjct  132   LAMAEAHLASRFNKPDAEIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLIALYDDN  191

Query  1594  HNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVK  1415
             H +IDG+TD+  +ED+S RFEA GW+ + V+N   D++A+  A+  A   T KPT I+V 
Sbjct  192   HISIDGSTDIAFTEDVSKRFEAYGWHVLHVENGNTDLDAIGKAIAEAKAVTDKPTMIKVT  251

Query  1414  TCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGE  1238
             T IG  S     +   HG     D+++  ++ L W+     F V       M+   E+G 
Sbjct  252   TTIGYGSPNMADTAGVHGAPLGPDEIRLTREALGWN--YDSFEVPEDALSHMRKAVERGA  309

Query  1237  TLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCL  1058
             +L+ EW   L +Y+ KYP+EA  F  +L+G +   W  +LP +   D   ATR  S   L
Sbjct  310   SLQAEWEETLATYRTKYPEEAALFERMLSGKLPENWADALPTYTTDDKAIATRKTSEATL  369

Query  1057  NHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIAL  878
             N LA VVP LIGGSADL  SN  ++   GDF Q  +   RNIR+GVREH M  I NGIAL
Sbjct  370   NALAPVVPELIGGSADLTKSNNTFMKVSGDF-QKGAYENRNIRFGVREHGMGAICNGIAL  428

Query  877   HGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGL  698
             H  GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY++THDSIGLGEDGPTHQPVE +A L
Sbjct  429   HNSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVLTHDSIGLGEDGPTHQPVETIASL  488

Query  697   RAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYII  518
             RAIP L V RP+DG ET+GAYKVAI +R  P+LMA+SRQ +   + GTS +GV KG Y I
Sbjct  489   RAIPNLTVIRPADGTETSGAYKVAIESRKAPTLMAMSRQNL-PQIAGTSIEGVAKGAYTI  547

Query  517   SDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVL  338
             SD+ G   P++ILIGTG EL LC  +A  L   G++VRVVS+  W LF+ Q   Y+E V 
Sbjct  548   SDSDGT--PDLILIGTGSELELCVRAAEQLTAAGKKVRVVSMPSWELFDAQDAAYQESVF  605

Query  337   PSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             P  V KR++VEAG  +GW +YVG EG VI ++ FGAS P   VF+K+G+T ENV   A
Sbjct  606   PKAVTKRLAVEAGIGMGWCKYVGAEGDVISVERFGASAPGNTVFEKFGYTVENVVAKA  663



>ref|WP_017656050.1| transketolase [Microchaete sp. PCC 7126]
Length=670

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/667 (53%), Positives = 459/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   M+FNP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMKFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+LAG+ SV I+D+K+  +  S+TPGHPEN IT G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLAGYDSVTIEDIKQFRQWESKTPGHPENFITAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA+++NKPD  IVDH TY I+GDGC+MEGV+ EAAS A H  L KL 
Sbjct  126   IANGVGLAIAEAHLAAKYNKPDAAIVDHYTYVILGDGCNMEGVSGEAASFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLEAIHKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K+ T+  H      D+V   +++L+W++   PF +   +    + 
Sbjct  246   TMIKVTTTIGYGSPNKQNTAGIHGAALGTDEVALTRKELKWEH--EPFVIPQDVLDHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E +W+     Y+ KYPQEA +F   ++G +  GW+  LP +   D    TR 
Sbjct  304   AVERGAGYEADWNKTYADYKAKYPQEAAEFERYISGKLPDGWDQVLPTYTPEDKALPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G GDF Q    +  NI YGVREH M  I
Sbjct  364   HSETCLNKLAAVLPELIGGSADLTHSNLTEIKGKGDF-QKGQYQNPNIHYGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   VNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSLAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L VFRP+DG ET+GAYKVAI  A ++ PSL+A +RQ V  N+ GTS +G
Sbjct  483   ETLASLRAIPNLTVFRPADGTETSGAYKVAIERAKQNAPSLLAFTRQNV-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGY++ D+ G   P+IILIGTG EL LC  +A  L  EG++VRVVSL  W LFE Q 
Sbjct  542   VSKGGYVVVDSEGT--PDIILIGTGSELSLCVTAAEKLTAEGKKVRVVSLPAWDLFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR+SVEA +  GW +YVG EG  + +D FGAS P     +K+GF+ +
Sbjct  600   AAYKESVLPKAVTKRLSVEAAASFGWHKYVGTEGDTVSIDRFGASAPGGVCLEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_017286695.1| transketolase [Leptolyngbya boryana]
Length=669

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDGVEKAKSGHPGLPMGAAPMSFVLWDKFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+LAG+ SV IDD+K+  +LGSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLAGYDSVTIDDIKQFRQLGSRTPGHPENFETAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + N VGLA+AE HLA++FNKPD  IVDH TY IMGDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   ICNGVGLAIAEAHLAAKFNKPDATIVDHYTYVIMGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+++ +ED+  R+EA GW  +TV +   +  A++ A+  A  ET KP
Sbjct  186   ALYDDNHISIDGDTEVSFTEDVGKRYEAYGWQVLTVPDGDTNTAAIEAAIAEAKKETTKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+++T IG  S  K+GT+  H      D+V   +++L WD    PF V        + 
Sbjct  246   TLIKIRTTIGFGSPNKQGTAGVHGAALGGDEVAATRKQLGWD--YEPFVVPEDALNHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE +W++    Y+ KYP++A  F  LL+G +  GWE  LP +   D   ATR 
Sbjct  304   AIERGAKLESDWNAAFADYKAKYPEDAATFERLLSGKLPDGWEKCLPVYTPEDKGLATRQ  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S K LN +A VVP LIGGSADL  SN   L G+GDF Q  S + RN+R+GVREHAM  I
Sbjct  364   TSEKTLNAIAPVVPELIGGSADLTHSNLTLLKGFGDF-QKGSYQNRNLRFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF DYM+ +IRLSALS AGVIY+MTHDS+ LGEDGPTHQP+
Sbjct  423   CNGIALHNSGLIPYCATFLVFVDYMRAAIRLSALSEAGVIYVMTHDSVALGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E LA LRAIP LLVFRP+DGNET+GAYK+A+  R +PSL+A++RQ +  N+DG+S D V 
Sbjct  483   ETLASLRAIPNLLVFRPADGNETSGAYKIAMERRKQPSLLAMTRQAL-PNLDGSSIDAVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             +G YI+S +  ++LP+IIL+GTG E+ LC  +A  LR EG +VRVVS+ CW LFE Q   
Sbjct  542   RGAYILSGS--DDLPDIILVGTGSEVSLCVTAAEKLRAEGHKVRVVSMPCWELFEEQDEA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YK  + P   +KR+ VEA S  GW++Y+G EG +I ++ FG S P     +K+G+T +NV
Sbjct  600   YKNTIFPKADQKRLVVEAASSFGWQKYMGSEGDIISIERFGISAPGNVAMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VARAK  664



>ref|WP_015192175.1| transketolase [Stanieria cyanosphaera]
 ref|YP_007131468.1| transketolase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34502.1| transketolase [Stanieria cyanosphaera PCC 7437]
Length=668

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/665 (53%), Positives = 460/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   M+ NP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMKHNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  ++L G   V +D++K   + GS+ PGHPEN ITEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLLYALMYLTGSDVVTLDEIKNFRQWGSKAPGHPENHITEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA+++NK D  +VDH TY I+GDGC+MEG++ EA SLA H  L KL 
Sbjct  126   IANAVGLAIAEAHLAAKYNKEDCKLVDHYTYVILGDGCNMEGISGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+S RFEA GW+ + V +   D++ +  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVSFTEDVSKRFEAYGWHVLHVKDGNSDLDEIAKAIEDAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+VK  ++ L W++   PF V        + 
Sbjct  246   SMIKVTTTIGYGSPNKANTAGVHGAALGGDEVKATRENLGWNH--EPFVVPDDALAHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G + E EW   L  Y+ KYPQEA +F  +++  +  GW+  LP +   D   ATR 
Sbjct  304   AVERGASYEAEWQETLAHYKTKYPQEAAEFERIISSTLPEGWDKVLPSYTPEDKALATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   LN LA V+P LIGGSADL  SN  YL   G F Q  + + RN+R+GVREHAM  I
Sbjct  364   HSEITLNALAPVLPELIGGSADLTHSNLTYLEVSGSF-QKGAYQNRNLRFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A VI++MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHSHGLIPYGATFLVFTDYMRNSIRLSALSEARVIWVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP L V+RP+DGNET+ AYKVA+ N   P+L+ALSRQ +  N+ G+S +   
Sbjct  483   EHVASLRAIPNLTVYRPADGNETSAAYKVAVENTHGPTLLALSRQGL-PNLAGSSIEAAA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGYI+SD+ G   P+IILIGTG E+ LC ++A  L +EG++VRVVSL  W  FE Q  E
Sbjct  542   KGGYILSDSDGT--PDIILIGTGSEVALCVQAAEKLTSEGKKVRVVSLPSWERFEAQGAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAG  +GW  YVGDEG VIG+D FGAS P   VF+KYGFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGCTMGWCRYVGDEGGVIGVDTFGASAPANIVFEKYGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_015229323.1| transketolase [Dactylococcopsis salina]
 ref|YP_007171683.1| transketolase [Dactylococcopsis salina PCC 8305]
 gb|AFZ50326.1| transketolase [Dactylococcopsis salina PCC 8305]
Length=672

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/669 (52%), Positives = 460/669 (69%), Gaps = 11/669 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   +RFNP+ P WFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKASSGHPGLPMGAAPMAFVLWDKFLRFNPKNPHWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVSLDDIKQFRQWESKTPGHPENFMTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             ++NAVGLA+AE HLA+RFNKPD  +VDH TY I  DG  MEGV+NEA SLA H  L KL 
Sbjct  126   ISNAVGLAVAEAHLAARFNKPDCNLVDHYTYAIASDGDLMEGVSNEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
             +LYDDNH +IDG T+L  +ED   R+EALGW+T  +++   D+E L+ A+ +A   T KP
Sbjct  186   VLYDDNHISIDGETELAFTEDRMKRYEALGWHTQFIEDGNTDLEGLEKAIANAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I V+T IG  S  +  S   HG    +D+V   +Q+L W+ G   F V        + 
Sbjct  246   SIIGVRTIIGFGSPNKANSHDVHGAALGKDEVSATRQELGWEYGE--FEVPEDALNHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   EQEW+     Y++KYP++A  F  L++G +  GWE +LP++   D  +ATR 
Sbjct  304   AVDRGAQSEQEWNQVFEQYKSKYPEDANNFQQLISGQLPAGWEDALPKYTPDDKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN L+ V+PGL+GGSADL  SN+ Y+   GDF Q  +   RN R+GVREH M  +
Sbjct  364   QSGAVLNALSPVLPGLLGGSADLAPSNKTYVKSSGDF-QKGAYENRNFRFGVREHGMGAV  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              N IALH  GLIP+ ATFL+F+DYM+ ++RLSALS AGVI++MTHDSI LGEDGPTHQP+
Sbjct  423   CNAIALHNSGLIPYGATFLIFTDYMRGALRLSALSRAGVIWVMTHDSIALGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIA----NRDKPSLMALSRQKVAANMDGTSA  548
             E +A LRAIP L VFRP+DGNET+GAYKVA+     N   P+L+ LSRQK+  N+ G+S 
Sbjct  483   EQVASLRAIPNLAVFRPADGNETSGAYKVAVERAANNPGAPTLLCLSRQKL-PNLAGSSI  541

Query  547   DGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFER  368
             +   KGGY++SD+ G   PE+ILIGTG E+ LC  +A  LR EG++VRVVSL  W LFE 
Sbjct  542   ENAAKGGYVLSDSEG--TPELILIGTGGEVELCVNAAEQLRQEGKKVRVVSLPSWELFEA  599

Query  367   QPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFT  188
             Q   YKE VLP  V KRV+VEAG+  GW  YVG EG VIG+D FGAS P     K +GFT
Sbjct  600   QDEAYKESVLPKAVTKRVAVEAGTTFGWCRYVGSEGAVIGIDRFGASSPGGVALKNFGFT  659

Query  187   EENVSKTAR  161
              ENV  TA+
Sbjct  660   TENVLATAK  668



>ref|WP_024968611.1| transketolase [Microcystis aeruginosa]
Length=668

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/665 (53%), Positives = 462/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAETHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDDVLSRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L    +  GW+ +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQTKYPAEAALFEQLTTSQLPEGWDKALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_015202769.1| transketolase [Crinalium epipsammum]
 ref|YP_007142161.1| transketolase [Crinalium epipsammum PCC 9333]
 gb|AFZ12651.1| transketolase [Crinalium epipsammum PCC 9333]
Length=670

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/667 (53%), Positives = 460/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A + + L+ H +R NP+ P WFNRDRF
Sbjct  6     QSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWNHFLRVNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+LAGF SV +DD+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLAGFDSVTMDDIKQFRQWESKTPGHPENFMTPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             ++NAVGLA+AE HLA++FNKPD  +VDH TY IMGDGC MEGV+ EA SLA H KL KL 
Sbjct  126   ISNAVGLAIAEAHLAAKFNKPDHTLVDHYTYVIMGDGCHMEGVSGEACSLAGHLKLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL  +ED+  RFEA GW+ + V++   D++A++ A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDLAFTEDVGKRFEAYGWHVVVVEDGNTDLDAIQKAIEEAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +++L W+    PF +        + 
Sbjct  246   SMIKVRTTIGYGSPTKANTAGVHGAALGGDEVTATRKQLGWE--YEPFEIPEDALNYWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E+EW+    +Y+  Y  EA++F  LL+  +  GWE SLP +   D  +ATR 
Sbjct  304   AVERGAKYEEEWNLNWENYKAHYSAEAEEFARLLSRKLTEGWEKSLPTFTPEDKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YSGKCLN LA V+P +IGGSADL  S    +   GDF QP      NIR+GVREH M  I
Sbjct  364   YSGKCLNALAGVLPEIIGGSADLAHSCMTLIKSSGDF-QPGHYENTNIRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IR+SALS+AG I++MTHDSI LGEDGPTHQP+
Sbjct  423   CNGIALHNSGLIPYGATFLVFADYMRAAIRISALSNAGSIWVMTHDSIQLGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LRAIP+L V RP+DGNET+G+YKVAI  AN ++P+L+ALSR     N+ GTS +G
Sbjct  483   ETIASLRAIPKLTVLRPADGNETSGSYKVAIEAANENRPTLLALSRL-AQPNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
               KGGYIIS   GEE P+IILIGTG EL LC  +A  LR EG++VRVVS+  W LF+ Q 
Sbjct  542   TAKGGYIIS--GGEETPDIILIGTGSELQLCAGAADKLRAEGKKVRVVSMPSWELFDAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V KR++VEA S  GW  YVG EG +I +D FG S P     +K+GF  +
Sbjct  600   AGYRESVLPKAVTKRLAVEAASSFGWCRYVGTEGDMISIDRFGVSAPGPVALEKFGFNVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLARAK  666



>ref|WP_026794557.1| MULTISPECIES: transketolase [Planktothrix]
Length=668

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/665 (53%), Positives = 459/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKW+NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWYNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GSRTPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSRTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE H A+ FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHDAATFNKPDAALVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+++ +ED+S RFEA GW+ + V+N   D++ + +A+  A   T KP
Sbjct  186   ALYDDNHISIDGNTEISFTEDVSKRFEAYGWHVLHVENGNTDLDGIADAIAKAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             TFI+V T IG  S  ++ T+  H      D+V   ++ L W+    PF +        + 
Sbjct  246   TFIKVTTIIGYGSPNRQNTAGVHGAALGADEVAATRKNLGWN--YEPFEIPEDALAHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW+     Y+ KYPQEA +F    +G +  GWE SLP +   +  +ATR 
Sbjct  304   AVERGANLETEWNKTWADYKAKYPQEAAEFERRTSGILPEGWEKSLPTFTPDEKGKATRQ  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA  +P LIGGSADL  SN   + G+G+F Q    + RN+R+GVREHAM  I
Sbjct  364   YSEGCLNALAPAIPELIGGSADLTHSNLTEIKGFGNF-QKGQYQNRNLRFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGI LHG GLIP+ ATFLVF+DYM+ +IRLSALS  GVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIGLHGSGLIPYCATFLVFADYMRAAIRLSALSEVGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP LLV RP+DGNET+GAYK+A+ NR +P+L+AL+RQ +  N++G+S D VG
Sbjct  483   ETIASLRVIPNLLVMRPADGNETSGAYKIAVENRHRPTLIALTRQAL-PNLNGSSIDVVG  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++ILIGTG E+ LC E A  L   G++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVLSDSEGT--PDLILIGTGSEVSLCVEVAEKLTQVGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KR++VEAG   GW+ Y G EG  I +D FGAS P   + +K+G+T +NV
Sbjct  600   YKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTFGASAPGGVLMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|WP_008057402.1| transketolase [Arthrospira sp. PCC 8005]
 emb|CCE20790.1| transketolase 1, thiamin-binding [Arthrospira sp. PCC 8005]
 emb|CDM93332.1| transketolase 1, thiamin-binding [Arthrospira sp. PCC 8005]
Length=669

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/666 (54%), Positives = 464/666 (70%), Gaps = 8/666 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHL G+ SV IDD+K+  + GS+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLHYALLHLTGYDSVGIDDIKQFRQWGSKTPGHPENHVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAARFNKPDCTVVDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD++ +ED++ RFEA GW+   V +   D+EA+  A+  A   T KP
Sbjct  186   AFYDDNHISIDGSTDISFTEDVAKRFEAYGWHVQHVADGNTDLEAIATAIEKAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP-MLYREMK  1259
             + I+V T IG  S  +  S   HG    + +V+  +  L W     P  VIP    +  +
Sbjct  246   SLIKVTTTIGFGSPNKANSHDVHGAALGKAEVQATRDHLGWSY---PEFVIPDDAIKHFR  302

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                E+G   E EW + L +Y++KYP+EA     LL+G +  GWE SLP +      +ATR
Sbjct  303   KAVERGANYEDEWKAALETYKSKYPEEAATLERLLSGKLPEGWEKSLPTYTPETKADATR  362

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               SG  LN +A V+P L+GGSADL  SN+  L G GDF Q    + RN+R+GVREHAM  
Sbjct  363   NQSGVTLNAIAGVLPELVGGSADLAPSNKTLLKGLGDF-QKGQYQNRNLRFGVREHAMGA  421

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A V+++MTHDSI LGEDGPTHQP
Sbjct  422   ICNGIALHRSGLIPYGATFLVFTDYMRNSIRLSALSEAPVLWVMTHDSIALGEDGPTHQP  481

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             VEH+A LR IP L V RP+DGNET+GAYKVAI NR  P+LMA SRQ +  N++G+S D V
Sbjct  482   VEHIASLRLIPDLTVIRPADGNETSGAYKVAIENRHYPTLMAFSRQNL-PNLEGSSIDNV  540

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KG Y++SDNS +  P+IILIGTG E  LC ++A  LR EG++VRVVS+  W LFE+Q  
Sbjct  541   AKGAYVLSDNS-DGTPDIILIGTGGETYLCVDAAVKLREEGKKVRVVSMPSWELFEKQDA  599

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
              YKE V P++V+KR++VEAG   GW  YV DEG  I +D FGAS P   V +K+GFT +N
Sbjct  600   AYKESVFPASVKKRLAVEAGVSFGWCRYVTDEGATISIDTFGASAPGGVVLEKFGFTVDN  659

Query  178   VSKTAR  161
             V   A+
Sbjct  660   VVAKAK  665



>ref|WP_017316342.1| transketolase [Mastigocladopsis repens]
Length=670

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/667 (53%), Positives = 458/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MR NP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRSNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+L G+ SV I+D+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLTGYDSVSIEDIKQFRQWESKTPGHPENFMTAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA S A H  L KL 
Sbjct  126   IANGVGLAIAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSYAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V +   D+E +  A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVLHVKDGNTDLEGIAKAIEEAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             TFI+V T IG  S  K  T+  H      D+VK  ++ L W++   PF V     +  + 
Sbjct  246   TFIKVTTTIGYGSPNKANTAGVHGAALGGDEVKLTRENLGWEH--EPFVVPEDALKHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW++   +Y+ KY QEA +F   +NG +  GW+  LP +   D   ATR 
Sbjct  304   AVERGANYEAEWNNTFDTYKGKYAQEAAEFERYINGTLPDGWDKVLPTYKPEDKAVATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G+GDF Q    + RNI +GVREH M  I
Sbjct  364   HSETCLNKLASVLPELIGGSADLTHSNLTEIKGFGDF-QKGQYQNRNIHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+ +IRLSALS AGVI++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGIALHQSGLIPYGATFLIFTDYMRAAIRLSALSQAGVIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP+L V RP+DGNE +GAYKVAI  A ++ P+L+A +RQ V  N+ GTS +G
Sbjct  483   ETLASLRAIPKLTVIRPADGNECSGAYKVAIEKAKQNAPTLLAFTRQNV-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGY + D+ G   P++ILIGTG EL LC  +A  L +EG++VRVVSL  W LFE Q 
Sbjct  542   VTKGGYTVVDSEG--TPDLILIGTGSELSLCVTAAEKLTSEGKKVRVVSLPSWELFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE +LP  V KR+SVEAG+  GW +YVG EG  + +D FGAS P     +K+GF+ +
Sbjct  600   AAYKESILPKAVTKRLSVEAGASFGWHKYVGTEGDTVSIDRFGASAPGGVCLEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_006621372.1| transketolase [Arthrospira platensis]
 gb|EKD10696.1| transketolase [Arthrospira platensis C1]
Length=669

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/666 (54%), Positives = 464/666 (70%), Gaps = 8/666 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHL G+ SV IDD+K+  + GS+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLHYALLHLTGYDSVGIDDIKQFRQWGSKTPGHPENHVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAARFNKPDCTVVDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD++ +ED++ RFEA GW+   V +   D+EA+  A+  A   T +P
Sbjct  186   AFYDDNHISIDGSTDISFTEDVAKRFEAYGWHVQHVADGNTDLEAIATAIEKAKAVTDQP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP-MLYREMK  1259
             + I+V T IG  S  +  S   HG    + +V+  +  L W     P  VIP    +  +
Sbjct  246   SLIKVTTTIGFGSPNKANSHDVHGAALGKAEVQATRDHLGWSY---PEFVIPDDAIKHFR  302

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                E+G   E EW + L +Y++KYP+EA     LL+G +  GWE SLP +      +ATR
Sbjct  303   KAVERGANYEDEWKAALETYKSKYPEEAATLERLLSGKLPEGWEKSLPTYTPETKADATR  362

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               SG  LN +A V+P L+GGSADL  SN+  L G GDF Q    + RN+R+GVREHAM  
Sbjct  363   NQSGVTLNAIAGVLPELVGGSADLAPSNKTLLKGLGDF-QKGQYQNRNLRFGVREHAMGA  421

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A V+++MTHDSI LGEDGPTHQP
Sbjct  422   ICNGIALHRSGLIPYGATFLVFTDYMRNSIRLSALSEAPVLWVMTHDSIALGEDGPTHQP  481

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             VEH+A LR IP L V RP+DGNET+GAYKVAI NR  P+LMA SRQ +  N++G+S D V
Sbjct  482   VEHIASLRLIPDLTVIRPADGNETSGAYKVAIENRHYPTLMAFSRQNL-PNLEGSSIDNV  540

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KG Y++SDNS +  P+IILIGTG E  LC ++A  LR EG++VRVVS+  W LFE+Q  
Sbjct  541   AKGAYVLSDNS-DGTPDIILIGTGGETYLCVDAAVKLREEGKKVRVVSMPSWELFEKQDA  599

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
              YKE V P++V+KR++VEAG   GW  YV DEG  I +D FGAS P   V +K+GFT +N
Sbjct  600   AYKESVFPASVKKRLAVEAGVSFGWCRYVTDEGATISIDTFGASAPGGVVLEKFGFTVDN  659

Query  178   VSKTAR  161
             V   A+
Sbjct  660   VVAKAK  665



>ref|WP_006670091.1| transketolase [Arthrospira maxima]
 gb|EDZ93138.1| transketolase [Arthrospira maxima CS-328]
Length=669

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/666 (54%), Positives = 464/666 (70%), Gaps = 8/666 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHL G+ SV IDD+K+  + GS+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLHYALLHLTGYDSVGIDDIKQFRQWGSKTPGHPENHVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+RFNKPD  +VDH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAARFNKPDCTVVDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD++ +ED++ RFEA GW+   V +   D+EA+  A+  A   T +P
Sbjct  186   AFYDDNHISIDGSTDISFTEDVAKRFEAYGWHVQHVADGNTDLEAIATAIEKAKAVTDQP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIP-MLYREMK  1259
             + I+V T IG  S  +  S   HG    + +V+  +  L W     P  VIP    +  +
Sbjct  246   SLIKVTTTIGFGSPNKANSHDVHGAALGKAEVQATRDHLGWSY---PEFVIPDDAIKHFR  302

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                E+G   E EW + L +Y++KYP+EA     LL+G +  GWE SLP +      +ATR
Sbjct  303   KAVERGANYEDEWKATLETYKSKYPEEAATLERLLSGKLPEGWEKSLPTYTPETKADATR  362

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               SG  LN +A V+P L+GGSADL  SN+  L G GDF Q    + RN+R+GVREHAM  
Sbjct  363   NQSGVTLNAIAGVLPELVGGSADLAPSNKTLLKGLGDF-QKGQYQNRNLRFGVREHAMGA  421

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A V+++MTHDSI LGEDGPTHQP
Sbjct  422   ICNGIALHRSGLIPYGATFLVFTDYMRNSIRLSALSEAPVLWVMTHDSIALGEDGPTHQP  481

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGV  539
             VEH+A LR IP L V RP+DGNET+GAYKVAI NR  P+LMA SRQ +  N++G+S D V
Sbjct  482   VEHIASLRLIPDLTVIRPADGNETSGAYKVAIENRHYPTLMAFSRQNL-PNLEGSSIDNV  540

Query  538   GKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPR  359
              KG Y++SDNS +  P+IILIGTG E  LC ++A  LR EG++VRVVS+  W LFE+Q  
Sbjct  541   AKGAYVLSDNS-DGTPDIILIGTGGETYLCVDAAVKLREEGKKVRVVSMPSWELFEKQDA  599

Query  358   EYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEEN  179
              YKE V P++V+KR++VEAG   GW  YV DEG  I +D FGAS P   V +K+GFT +N
Sbjct  600   AYKESVFPASVKKRLAVEAGVSFGWCRYVTDEGATISIDTFGASAPGGVVLEKFGFTVDN  659

Query  178   VSKTAR  161
             V   A+
Sbjct  660   VVAKAK  665



>ref|WP_015221841.1| transketolase [Cyanobacterium stanieri]
 ref|YP_007164172.1| transketolase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46523.1| transketolase [Cyanobacterium stanieri PCC 7202]
Length=670

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 464/665 (70%), Gaps = 5/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +   C++ +R L +D V+ AK+GH G+ +G A + + L+   M+FNP+ P+W NRDRF
Sbjct  6     QSIQELCINAIRFLSIDGVEKAKSGHPGLPMGAAPMAFVLWDQFMKFNPKNPQWINRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  LHL G+ SV IDD+K+  +  S+TPGHPEN +TEGIEVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYSLLHLYGYDSVSIDDIKQFRQWKSKTPGHPENFVTEGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+++NKPD  ++DH TY I+GDGC+MEG++ EAAS+A HW L KL 
Sbjct  126   IANGVGLALAEAHLAAKYNKPDCTLIDHYTYVILGDGCNMEGISGEAASIAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+  RFEA GW+ + V+N   D+EA+  A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVCKRFEAYGWHVLHVENGNTDLEAIARAIEEAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S KK  T+  H      D+V   ++ L W+    PF V    Y   + 
Sbjct  246   SMIKVTTTIGYGSPKKANTAGVHGAALGGDEVDATRKNLGWN--YEPFEVPQDAYNHFQK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                +G  LE +W+  L +Y++KYP EA +F  + +G +   W   LP +   D   A+R 
Sbjct  304   AGAKGADLEAQWNETLATYKSKYPTEAAEFETITSGKLPDNWADCLPTYTPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN ++KV+P L+GGSADL  SN   L   GDF Q  +   RNI +GVREHAM  I
Sbjct  364   HSEICLNAISKVLPQLVGGSADLTHSNLTQLEISGDF-QKGAYENRNIHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+NSIRLSALS A VI++MTHDSI LGEDGPTHQP+
Sbjct  423   CNGIALHNTGLIPYGATFLVFTDYMRNSIRLSALSEAQVIWVMTHDSIALGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LR IP LLVFRP+DGNET+GAYKVAI  +  PSLMAL+RQ +  N+ G+S +GV 
Sbjct  483   EHVASLRLIPDLLVFRPADGNETSGAYKVAIETKKTPSLMALTRQGL-PNLAGSSVEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KGGY+++     E  ++ILIGTG E+ LC ++A  L+ EG +VRVVS+ C  LF++Q  E
Sbjct  542   KGGYVVACGFAPEELDLILIGTGSEVSLCVDAAEKLKAEGLKVRVVSMPCVELFDKQSDE  601

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  ++KRVSVEAG+  GW  +VGDEGV IG++ +GAS P   V +K+GFT +NV
Sbjct  602   YKESVLPKAIKKRVSVEAGTTFGWERFVGDEGVCIGVNTYGASAPGGVVMEKFGFTVDNV  661

Query  175   SKTAR  161
                A+
Sbjct  662   VAKAK  666



>ref|WP_026797090.1| transketolase [Planktothrix prolifica]
Length=668

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/665 (52%), Positives = 458/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKW+NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWYNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GSRTPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSRTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE H A+ FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHDAATFNKPDAALVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+++ +ED+S RFEA GW+ + V+N   D++ + +A+  A   T KP
Sbjct  186   ALYDDNHISIDGNTEISFTEDVSKRFEAYGWHVLHVENGNTDLDGIADAIAKAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             TFI+V T IG  S  ++ T+  H      D+V   ++ L W+    PF +        + 
Sbjct  246   TFIKVTTIIGYGSPNRQNTAGVHGAALGADEVAATRKNLGWN--YEPFEIPEDALAHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW+     Y+ KYPQEA +F    +G +  GWE SLP +   +  +ATR 
Sbjct  304   AVERGANLETEWNKTWADYKAKYPQEAAEFERRTSGILPEGWEKSLPTFTPDEKGKATRQ  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA  +P LIGGSADL  SN   + G+G+F Q    + RN+R+GVREH M  I
Sbjct  364   YSEGCLNALAPAIPELIGGSADLTHSNLTEIKGFGNF-QKGQYQNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGI LHG GL+P+ ATFLVF+DYM+ +IRL+ALS  GVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIGLHGSGLVPYCATFLVFADYMRAAIRLAALSEIGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LR IP LLV RP+DGNET+GAYK+A+ NR +P+L+AL+RQ +  N++G+S D VG
Sbjct  483   ETIASLRVIPNLLVMRPADGNETSGAYKIAVENRHRPTLIALTRQAL-PNLNGSSIDVVG  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++ILIGTG E+ LC E A  L   G++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVLSDSEGT--PDLILIGTGSEVSLCVEVAEKLTQVGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V KR++VEAG   GW+ Y G EG  I +D FGAS P   + +K+G+T +NV
Sbjct  600   YKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTFGASAPGGVLMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|WP_006515947.1| transketolase [Leptolyngbya sp. PCC 7375]
 gb|EKV01552.1| transketolase [Leptolyngbya sp. PCC 7375]
Length=665

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/665 (52%), Positives = 452/665 (68%), Gaps = 8/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++ +C++ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLETQCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDQFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV+I+D+K   + G+ TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVKIEDIKNFRQWGATTPGHPENFETSGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             V N VGLA+AE HLA+RFNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   VCNGVGLAIAEAHLAARFNKPDCTLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+EA+  A+  A   T KP
Sbjct  186   AFYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVLHVEDGNTDLEAIAKAIEKAKQVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  TS  H      +++   ++ L WD+   PF +   +    + 
Sbjct  246   TMIKVTTTIGYGSPNKADTSGVHGAALGGEEIALTRENLGWDH--APFEIPEDVLGRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G + E EW+  L +Y+ KY  EA +F  +L G +   W  +LP +   D   ATR 
Sbjct  304   AVDKGASAEAEWNQTLATYRTKYATEAAEFERMLKGELPANWADALPTYAPGDKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA  VP L+GGSADL  SN   +   GDF Q  +   RN+R+GVREH M  I
Sbjct  364   TSEATLNALAPAVPELVGGSADLAKSNNTLMKISGDF-QKGAYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSAL+ AGV+Y+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALAEAGVLYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L V RP+DGNET+GAYKVAIA+R  P+LMA SRQ +   ++G+S D V 
Sbjct  483   ETVASLRAIPNLYVIRPADGNETSGAYKVAIASRKTPTLMAFSRQNL-PQLEGSSIDSVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G +L   +LIGTG E+ LC E+A  LR+EG++VRVVS+ CW LFE Q   
Sbjct  542   KGAYVLSDDEGADL---LLIGTGSEVSLCLEAAKQLRSEGKKVRVVSMPCWELFEAQDAA  598

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  + KR+ VEAG  +GW +Y G EG +I +D FGAS P   + +++G+T ENV
Sbjct  599   YKESVLPKAITKRLVVEAGIEMGWGKYYGAEGDMISVDRFGASAPGGRIMQEFGYTVENV  658

Query  175   SKTAR  161
                A+
Sbjct  659   IARAK  663



>ref|WP_037216432.1| transketolase [Richelia intracellularis]
 emb|CDN10298.1| Transketolase [Richelia intracellularis]
Length=670

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/667 (52%), Positives = 454/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+  +MRFNP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDKLMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV I+D+K+  + GS+TPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTIEDIKQFRQWGSKTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV  EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVAAEACSLAGHMGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFE+ GW+ + V+N   D++A+  AL +A + T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFESYGWHVLHVENGNSDLDAIAKALETAKSVTDKP  245

Query  1432  TFIRVKTCIG-KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG     K+ T+  H      D+V   +  L W+    PF +       M+ 
Sbjct  246   TMIKVTTTIGYGAPNKQNTAGIHGAALGTDEVAASRSNLGWE--YEPFALPQDAVDHMRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW+    +Y++KYPQEA +F   ++G +  GW+ +LP +   D    TR 
Sbjct  304   AIERGAASEAEWNQTFSTYKSKYPQEAAEFERYVSGKLPDGWDKALPSYTAEDKGLPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA +VP LIGGSADL  SN   + G+GDF Q    + RN+ +GVREH M  I
Sbjct  364   YSEACLNKLAPIVPELIGGSADLTHSNLTEIKGFGDF-QKGQYQNRNVHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSQAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DG E +GAYKVAI  A  + P+L+A SRQ +  N++ TS +G
Sbjct  483   ETLASLRAIPNLTVIRPADGTECSGAYKVAIERAKANAPTLLAFSRQAL-PNLNPTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y I D  G   PE+IL+GTG EL LC  +A  L  EG++VRVVS+  W LFE Q 
Sbjct  542   VTKGAYTIVDCQGT--PELILMGTGSELNLCVTAAEKLAGEGKKVRVVSMPSWELFEEQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR+SVEAG+  GW +YVG EG  + +D FGAS P     +++GF+ +
Sbjct  600   GAYKESVLPKAVTKRLSVEAGASFGWHKYVGTEGDTVSIDRFGASAPGGVCMERFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_008232250.1| Transketolase [Richelia intracellularis]
 emb|CCH66585.1| Transketolase [Richelia intracellularis HH01]
Length=670

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/668 (52%), Positives = 452/668 (68%), Gaps = 11/668 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV I+D+K+  + GS+TPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTIEDIKQFRQWGSKTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             VAN VGLA+AE HLA++FN+PDI IVDH TY I+GDGC+MEGV  EA SLA H  L KL 
Sbjct  126   VANGVGLAMAEAHLAAKFNRPDITIVDHYTYVILGDGCNMEGVAAEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +E++S RFE+ GW+ + V+N   D++A+  A+ SA + T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTENVSGRFESYGWHVLHVENGNADLDAISKAIESAKSVTDKP  245

Query  1432  TFIRVKTCIG-KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG     K+ T+  H      D+V   +  L W+    PFH+       M+ 
Sbjct  246   TMIKVTTTIGYGAPNKQNTAGIHGAALGADEVAATRSNLGWE--YEPFHLPQDAVNHMRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW      Y  +YPQEA +F   ++G +  GWE  L  +   D   ATR 
Sbjct  304   AVERGAVLETEWDKLFADYSKQYPQEAAEFKRYVSGKLPDGWEKVLTSYTAEDKGLATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA ++P LIGGSADL  SN   + G+G+F Q    + RN+ +GVREH M  I
Sbjct  364   YSEACLNKLAPILPELIGGSADLTHSNLTEIKGFGNF-QKGQYQNRNVHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS  G I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSQTGTIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDK---PSLMALSRQKVAANMDGTSAD  545
             E LA LRAIP L V RP+DG E +GAYKVAI NR K   P+L+ALSRQ +  N+  TS +
Sbjct  483   ETLASLRAIPNLTVIRPADGTECSGAYKVAI-NRSKQNSPTLLALSRQAL-PNLTPTSIE  540

Query  544   GVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQ  365
             GV KG Y + D  G  +PE+I IGTG EL LC  +A  L  EG++VRVVS+  W LFE Q
Sbjct  541   GVTKGAYTVVDCQG--VPELIFIGTGSELNLCVAAAEKLLGEGKKVRVVSMPSWELFEEQ  598

Query  364   PREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTE  185
                YKE +LP  V KR+SVEAG+  GW +YVG EG  + +D+FGAS P     +K+GF+ 
Sbjct  599   DGAYKEFILPKVVTKRLSVEAGASFGWHKYVGTEGDTVSIDQFGASAPGVFCMEKFGFSI  658

Query  184   ENVSKTAR  161
             +N+   A+
Sbjct  659   DNILAKAK  666



>ref|WP_006454760.1| transketolase [Synechococcus sp. PCC 7335]
 gb|EDX85016.1| transketolase [Synechococcus sp. PCC 7335]
Length=668

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/659 (53%), Positives = 457/659 (69%), Gaps = 9/659 (1%)
 Frame = -3

Query  2134  CVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGH  1955
             C++++R L +D V  +K+GH G+ +G A + + L+   +R NP+ P+WFNRDRFVLSAGH
Sbjct  12    CINSIRFLAIDAVNKSKSGHPGLPMGAAPMSFVLWDKFIRHNPKNPQWFNRDRFVLSAGH  71

Query  1954  GSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVG  1775
             G +LQY  L+L G+ SV +DD+K+  + GS TPGHPEN  T G+EVTTGPLGQG+ NAVG
Sbjct  72    GCMLQYAMLYLTGYDSVSMDDIKQFRQWGSTTPGHPENFETAGVEVTTGPLGQGICNAVG  131

Query  1774  LALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDN  1595
             LA+AE HLA++FNKPD  +VDH TY IMGDGC+MEGV+ EA SLA H  L KL  LYDDN
Sbjct  132   LAMAEAHLAAKFNKPDCAVVDHYTYTIMGDGCNMEGVSGEACSLAGHLGLGKLIALYDDN  191

Query  1594  HNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVK  1415
             H +IDG+TD+  +ED+S RFEA GW+ + V++   D+++++ A+  A   T KPT I+V 
Sbjct  192   HISIDGSTDIAFTEDVSKRFEAYGWHVLHVEDGNTDLDSIEKAIAKAKEVTDKPTMIKVT  251

Query  1414  TCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA-EQG  1241
             T IG  S  + GT   H     +++    ++ L W   +  F  IP        QA ++G
Sbjct  252   TTIGYGSPNRAGTGGIHGAMLGDEETIATRENLDW---KYDFFEIPEDALSRYRQAIDKG  308

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
              + E EW+  L +Y+ KY +EAK+   +L+G +  GWE +LP +   D   ATR  S   
Sbjct  309   ASAEAEWNETLATYRTKYAEEAKELERMLSGKLPEGWEDALPTYTPEDKALATRKNSEAT  368

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN LA V+P LIGGSADL  SN   L   GD+ Q  +   RNI +GVREH M  I NGIA
Sbjct  369   LNALAPVLPELIGGSADLTHSNLTELKVSGDY-QKGAYENRNIHFGVREHGMGAICNGIA  427

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LHGGGLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPVE +A 
Sbjct  428   LHGGGLIPYCATFLVFTDYMRGAIRLSALSEAGVIYVMTHDSIGLGEDGPTHQPVETVAS  487

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
             LRAIP L V RP+DGNET+GAYK+A+  R  P+LM  SRQ +  N+ G+S D V KG YI
Sbjct  488   LRAIPNLYVIRPADGNETSGAYKIAVNKRQAPTLMCFSRQGL-RNLPGSSIDAVAKGAYI  546

Query  520   ISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVV  341
             +SD+ G   P++ILIGTG E+ LCE++A  LR +G++VRVVS+ CW+L+E Q  EYKE V
Sbjct  547   MSDSDG--TPDLILIGTGSEVQLCEDAAEKLRGDGKKVRVVSMPCWKLYEEQSAEYKESV  604

Query  340   LPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             LP +V+KR+ VEA S  GW +Y GDEG +I +D FGAS P   V +K+G+T +NV   A
Sbjct  605   LPKSVKKRLVVEAMSSFGWAKYFGDEGDMISVDTFGASAPGGVVMEKFGYTVDNVVSRA  663



>ref|WP_009456507.1| MULTISPECIES: transketolase [Fischerella]
 gb|EHC13805.1| transketolase [Fischerella sp. JSC-11]
Length=670

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/667 (53%), Positives = 463/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V +   ++EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQAVGDGDTNLEAIHKAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W++   PF +     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVAATRNNLGWEH--EPFVIPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   E +W+     Y+ KYPQEA +F   ++G +  GWE +LP +       ATR 
Sbjct  304   AIDRGAEYESQWNKTFADYKAKYPQEAAEFERQISGKLPEGWEKALPTYEAGSKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P +IGGSADL  SN   L G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEITLNALAPVLPEMIGGSADLTHSNLTELKGAGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S +G
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIENANQHRPTLLALSRQNL-PQLEGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P+IILIGTG E+ LC ++A  LR EG++VRVVS+  W LF+ Q 
Sbjct  542   VTKGAYILSDSEGT--PDIILIGTGSEVFLCVDAAAKLRAEGKKVRVVSMPSWELFDAQS  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V+KR++VEA S  GW  Y+GDEG +I +D FG S P   + +K+G+T +
Sbjct  600   ESYRESVLPKAVKKRLAVEAASSFGWCRYLGDEGAMISVDRFGVSAPGGVIMEKFGYTVD  659

Query  181   NVSKTAR  161
             NV K A+
Sbjct  660   NVVKKAQ  666



>sp|Q42677.1|TKT7_CRAPL RecName: Full=Transketolase 7; Short=TK [Craterostigma plantagineum]
 emb|CAA86609.1| transketolase [Craterostigma plantagineum]
Length=676

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/662 (52%), Positives = 448/662 (68%), Gaps = 7/662 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             + V+ +R L +D V+ AK+GH GM +G A +G+ LY   MRFNP+ P WFNRDRFVLSAG
Sbjct  16    KSVNTIRFLAIDAVEKAKSGHPGMPMGCAPMGHVLYDEFMRFNPKNPYWFNRDRFVLSAG  75

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HG +LQY  LHL+G+ SV+ +DLK L + GSRTP HPEN  T G+EVTTGPLGQG+A+AV
Sbjct  76    HGCMLQYALLHLSGYDSVKEEDLKSLRQWGSRTPAHPENFETPGVEVTTGPLGQGIASAV  135

Query  1777  GLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDD  1598
             GLA+AE HLA+R+NKP   IVDH TY I+GDGC MEGV+NEA SLAAHW L KL  LYDD
Sbjct  136   GLAVAEKHLAARYNKPGFEIVDHYTYVILGDGCQMEGVSNEACSLAAHWGLGKLIALYDD  195

Query  1597  NHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRV  1418
             NH TIDG TD+  +ED+  RF+ALGW+ I V N     + ++ A+  A +   +PT I+V
Sbjct  196   NHITIDGDTDVAFTEDVDKRFDALGWHVIWVKNGNDGCDEIRAAIEEAKSVKDRPTMIKV  255

Query  1417  KTCIG-KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQG  1241
              T IG     K  T   H       + +  ++ L W     PFHV   + +       +G
Sbjct  256   TTTIGYGAPSKANTYGVHGNALGPKEAEATRKNLGWP--YEPFHVPDDVKKHWSRHIAEG  313

Query  1240  ETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKC  1061
               LE  W++K   +Q K+P+EA    +++ G +   WE+  P +   +P   TR  S + 
Sbjct  314   AALESAWNAKFAEFQKKFPEEAADLKSIITGELPTNWESIFPTYTPENPGLPTRTLSHQI  373

Query  1060  LNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIA  881
             LN L  V+PGL+GGSADL  SN A+L   GDF Q  SP  RN+++G REHAM  I NG+A
Sbjct  374   LNGLGDVLPGLLGGSADLTLSNMAFLKNSGDF-QKKSPGERNVKFGAREHAMGSICNGLA  432

Query  880   LHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAG  701
             LH  GL+P+ AT+ VF+DYM+ ++R+SALS A V+YIMTHDSIGLGEDGPTHQPVEHLA 
Sbjct  433   LHSPGLLPYCATYFVFTDYMRAAMRISALSKARVLYIMTHDSIGLGEDGPTHQPVEHLAS  492

Query  700   LRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGYI  521
              RA+P +L  RP+DGNETAGAY+ A+ N ++PS++ L+RQK+   + GTS +GV KGGY+
Sbjct  493   FRAMPNILTLRPADGNETAGAYRAAVQNGERPSILVLARQKL-PQLPGTSIEGVSKGGYV  551

Query  520   ISDNS--GEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKE  347
             ISDNS  G   P++ILIGTG EL +   +   LR EG++VRVVSLVCW LF  Q  +Y+E
Sbjct  552   ISDNSRGGNSKPDVILIGTGSELEIAARAGDELRKEGKKVRVVSLVCWELFAEQSEKYRE  611

Query  346   VVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKT  167
              VLPS V  RVSVEAGS  GW  ++G +G  +G+D FGAS P   +FK++G T E V   
Sbjct  612   TVLPSGVTARVSVEAGSTFGWERFIGPKGKAVGIDRFGASAPAERLFKEFGITVEAVVAA  671

Query  166   AR  161
             A+
Sbjct  672   AK  673



>ref|WP_008314541.1| transketolase [Leptolyngbya sp. PCC 6406]
Length=668

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/665 (52%), Positives = 455/665 (68%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  CV+++R L +D VQ A +GH G+ +G A + + L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLEALCVNSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDRFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV +DDLK+  + G+ TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTLDDLKQFRQWGATTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + NAVGLA+AE HLA+RFNKP+  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   ICNAVGLAMAEAHLAARFNKPNATVVDHYTYAILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+ + V++   D+E +  AL +A + T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVLHVEDGNTDLEGIAKALETAKSVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  S   HG     D++K  ++ L W    G F V       M  
Sbjct  246   TLIKVTTTIGYGSPNKSNSAGVHGAPLGGDEIKLTREALGWT--YGDFEVPADALAHMGK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G + + EW   L +Y+ +YP++A  F  +L+G +  GW  +LP +   D   ATR 
Sbjct  304   AVDRGASYQAEWEETLATYRTQYPEDAALFERMLSGELPVGWADALPTYAPGDKALATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P LIGGSADL  SN   L   G F Q  +   RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPELIGGSADLTHSNLTELKISGSF-QKGAYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALSEAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L V RP+DG ET+GAYKVA+ +R  P+LMA SRQ +   ++G+S +GV 
Sbjct  483   ETIASLRAIPNLTVIRPADGTETSGAYKVAVESRKAPTLMAFSRQGL-PQLEGSSVEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y++SD+ G   P++ILIGTG E+ LC E+A VLR+EG++VR+VS+  W LF+ Q   
Sbjct  542   KGAYVLSDSDGT--PDLILIGTGSEVSLCVEAAKVLRSEGKKVRIVSMPSWELFDAQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLP  V KR++VEAG  +GW  YVG  G VI ++ FGAS P   V +K+GFT ENV
Sbjct  600   YQESVLPKAVTKRLAVEAGISMGWCRYVGGAGDVISVETFGASAPGGLVMEKFGFTVENV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VSRAK  664



>gb|AAL09768.1| At2g45290/F4L23.20 [Arabidopsis thaliana]
 gb|AAB82634.2| putative transketolase precursor [Arabidopsis thaliana]
Length=634

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/635 (54%), Positives = 438/635 (69%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A + + LY  VM++NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK 
Sbjct  1     MGCAPMSHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKS  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               + GS+TPGHPEN  T G+E TTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWGSKTPGHPENFETPGVEATTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEG++NE  SLA HW L KL   YDDNH +IDG TD+  +E +  RFEALG
Sbjct  121   YSILGDGCQMEGISNEVCSLAGHWGLGKLIAFYDDNHISIDGDTDIAFTESVDKRFEALG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEED  1346
             W+ I V N     + ++ A+  A   T KPT I+V T IG  S  +  S + HG    E 
Sbjct  181   WHVIWVKNGNNGYDEIRAAIREAKAVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V+  +  L W     PFHV   +         +G  LE +W++K  +Y+ KYP+EA + 
Sbjct  241   EVEATRNNLGWP--YEPFHVPEDVKSHWSRHTPEGAALEADWNAKFAAYEKKYPEEAAEL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
              ++++G +  GWE +LP +    P +ATR  S +CLN LAK VPG +GGSADL SSN   
Sbjct  299   KSIISGELPVGWEKALPTYTPDSPGDATRNLSQQCLNALAKAVPGFLGGSADLASSNMTM  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  +G+F Q  +P  RN+R+GVREH M  I NGIALH  G IP+ ATF VF+DYM+ ++R
Sbjct  359   LKAFGNF-QKATPEERNLRFGVREHGMGAICNGIALHSPGFIPYCATFFVFTDYMRAAMR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHL+  RA+P +++FRP+DGNETAGAYK+A
Sbjct  418   ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLSSFRAMPNIMMFRPADGNETAGAYKIA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             +  R  PS++ALSRQK+   + GTS + V KGGY ISDNS    P++ILIGTG EL +  
Sbjct  478   VTKRKTPSVLALSRQKL-PQLPGTSIESVEKGGYTISDNSTGNKPDVILIGTGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR +G+ VRVVS VCW LF+ Q   YKE VLPS V  RVS+EAGS  GW + VG 
Sbjct  537   QAAEKLREQGKSVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGG  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D FGAS P   ++K++G T E + + A+
Sbjct  597   KGKSIGIDTFGASAPAGKLYKEFGITIEAMVEAAK  631



>ref|WP_019494448.1| transketolase [Calothrix sp. PCC 7103]
Length=674

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/667 (53%), Positives = 451/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A + + L+   MR NP+ PKWFNRDRF
Sbjct  10    KTLEEICINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRVNPKNPKWFNRDRF  69

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L+GF SV I+D+K+  + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  70    VLSAGHGCMLQYALLYLSGFDSVTIEDIKQFRQWGSRTPGHPENFETAGVEVTTGPLGQG  129

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA S A H  L KL 
Sbjct  130   IANAVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSFAGHLGLGKLI  189

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+EA+  A+  A + T KP
Sbjct  190   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVEDGNTDLEAIAKAIEEAKSVTDKP  249

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K+ T+  H      D+V   +Q L W++   PF +       M+ 
Sbjct  250   SMIKVTTTIGYGSPNKQNTAGVHGAALGNDEVALTRQNLGWEH--EPFVIPQDALDHMQK  307

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW+  L  Y+ KY  EA +F   ++G +  GWE  LP +   D   ATR 
Sbjct  308   AIERGAKAESEWNQALSDYKAKYASEAAEFERYISGKLPDGWEKVLPTYTPEDKGVATRK  367

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G GDF Q       N+ YGVREH M  I
Sbjct  368   HSETCLNKLATVLPELIGGSADLTHSNLTEIKGKGDF-QKGHYENPNVHYGVREHGMGAI  426

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQPV
Sbjct  427   VNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSEAGSIWVMTHDSIGQGEDGPTHQPV  486

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LRAIP L V RP+DG ET+GAYKVAI  +  + P+L+A +RQ V  N+ G+S +G
Sbjct  487   ETIASLRAIPELTVIRPADGTETSGAYKVAIEKSKANAPTLLAFTRQNV-PNLAGSSIEG  545

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y I D+ G   P+IILIGTG E+ LC  +A  L  EG++VRVVS+  W LFE Q 
Sbjct  546   VTKGAYTIVDSEG--TPDIILIGTGSEVSLCVTAAEKLTGEGKKVRVVSMPSWELFEAQD  603

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KRVSVEAG   GW +YVG EG  + +D FGAS P     +K+GFT +
Sbjct  604   AAYKESVLPKAVTKRVSVEAGVSFGWHKYVGTEGATVSIDTFGASAPGPVCMEKFGFTVD  663

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  664   NVLATAK  670



>ref|WP_026721508.1| transketolase [Fischerella sp. PCC 9431]
Length=670

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/667 (52%), Positives = 462/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P WFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SVQ++D+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVQLEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE H+A++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHIAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V +   ++EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQVVSDGDTNLEAIDKAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W++   PF +     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVTATRNNLGWEH--EPFDIPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E+EW+     Y+ KYPQEA +F   ++G +  GWE +LP +       ATR 
Sbjct  304   AVERGAEFEREWNKVFADYKAKYPQEAAEFERQISGKLPEGWEKALPTYEPRSKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P +IGGSADL  SN   L G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPEMIGGSADLTHSNLTELKGAGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LR IP L V RP+DGNET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S +G
Sbjct  483   ETIASLRVIPNLTVIRPADGNETSGAYKVAIENANQKRPTLLALSRQNL-PQLEGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P+IILIGTG E+ LC ++A  LR EG++VRVVS+  W LF+ Q 
Sbjct  542   VTKGAYILSDSEG--TPDIILIGTGSEVPLCVDAATKLRAEGKKVRVVSMPSWELFDAQS  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V+KR++VEA S  GW  Y+GDEG +I +D FG S P   + +K+G+T +
Sbjct  600   ESYRESVLPKAVKKRLAVEAASSFGWCRYLGDEGAMISVDRFGVSAPGGTIMEKFGYTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAK  666



>gb|KHG02687.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG17603.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG30020.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=634

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/635 (55%), Positives = 433/635 (68%), Gaps = 5/635 (1%)
 Frame = -3

Query  2062  LGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKR  1883
             +G A +G+ LY  +MR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ DDLK 
Sbjct  1     MGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVQEDDLKN  60

Query  1882  LCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRT  1703
               +  SRTPGHPEN  T G+EVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH T
Sbjct  61    FRQWQSRTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDNEIVDHYT  120

Query  1702  YCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALG  1523
             Y I+GDGC MEGV NEA SLA HW L KL   YDDNH +IDG T++  +E++  RF+ LG
Sbjct  121   YAILGDGCQMEGVANEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVEERFKGLG  180

Query  1522  WNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEED  1346
             W+ I V N     + ++ A+  A     KPT I+V T IG  S  +  S + HG+     
Sbjct  181   WHVIWVKNGNTGYDEIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAK  240

Query  1345  DVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQF  1166
             +V   ++ L W +   PFHV   +        +QG  LE EW++K   Y+ KY  EA + 
Sbjct  241   EVDATRKNLVWPH--EPFHVPEDVKGHWSRLVQQGAALEAEWNAKFAEYEKKYKDEAAEL  298

Query  1165  IALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAY  986
               ++   +  GWE +LP +    P +ATR  S + LN L KV+PG  GGSADL SSN   
Sbjct  299   KLIITAELPAGWEKALPTYTPESPADATRNLSQQNLNALVKVLPGFFGGSADLASSNMTL  358

Query  985   LHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIR  806
             L  YG+F Q D+P  RN+R+GVREH M  I NGIA H  GLIP+ ATF VF+DYM+ +IR
Sbjct  359   LKMYGNF-QKDTPEERNLRFGVREHGMGAICNGIAHHSPGLIPYCATFFVFTDYMRAAIR  417

Query  805   LSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVA  626
             +SALS AGVIY+MTHDSIGLGEDGPTHQP+EHLA LRA+P + + RP+DGNETAGAYKVA
Sbjct  418   MSALSQAGVIYVMTHDSIGLGEDGPTHQPIEHLASLRAMPNVFMLRPADGNETAGAYKVA  477

Query  625   IANRDKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCE  446
             I NR+ PS++ALSRQK+   + GTS  GV KGGYIISDNS    P+IILIGTG EL +  
Sbjct  478   ILNRNTPSIIALSRQKL-TQLPGTSIKGVEKGGYIISDNSSGNNPDIILIGTGSELEIAA  536

Query  445   ESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGD  266
             ++A  LR  G+ VRVVSLV W LF+ Q   YKE VLPS V  RVS+EAGS  GW + VG 
Sbjct  537   KAADELRKAGKAVRVVSLVSWELFDNQSDAYKESVLPSGVSARVSIEAGSTFGWEKIVGS  596

Query  265   EGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             +G  IG+D FGAS P   ++K++G T E V   A+
Sbjct  597   KGKAIGIDRFGASAPAGRLYKEFGLTPEAVVAAAK  631



>ref|WP_017662794.1| transketolase [Geitlerinema sp. PCC 7105]
Length=668

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/665 (53%), Positives = 454/665 (68%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLEELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K   + GS TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVGLDDIKNFRQWGSVTPGHPENFETAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA+RFNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAARFNKPDCTLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED++ RFEA GW+   V+N   D++A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVAKRFEAYGWHVQHVENGNTDLDAIDKAIEAAKQVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+V   ++ L W+  R PF V   +    + 
Sbjct  246   SLIKVTTTIGYGSPNKADTAGVHGAALGTDEVAATRENLGWN--RDPFDVPEDVLSHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   EQEW+  L +Y++KY  +A +F  +L G +  GW+  LP +   D   ATR 
Sbjct  304   AVDRGAEAEQEWNQLLDTYRSKYASDAAEFERMLRGDLPQGWDADLPSFTPDDKGMATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA  +P LIGGSADL  SN   L   G+F Q      RN+R+GVREH M  I
Sbjct  364   HSQACLNALAPNLPELIGGSADLTHSNLTELKCSGNF-QKGQYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGV+Y+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALSEAGVVYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E LA LRAIP L+V RP+DGNET+GAYKVA+ANR +P+LMA +RQ +  N+ G SAD V 
Sbjct  483   ETLASLRAIPNLVVIRPADGNETSGAYKVAVANRKRPTLMAFTRQGL-PNLAGGSADNVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD  G   P++ILIGTG E+ LC E+A  L  EG++VRVVS+    LFE Q   
Sbjct  542   KGAYILSDCEGT--PDLILIGTGSEVSLCVEAAEKLTAEGKKVRVVSMPSCELFEEQDEA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLPS V KR+ VEA +  GW  Y+G EG ++ +D FGAS P   V +K+G+T +NV
Sbjct  600   YRESVLPSAVTKRLVVEAATRFGWERYMGAEGDMVSIDRFGASAPGGTVMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|WP_012165705.1| transketolase [Acaryochloris marina]
 ref|YP_001519794.1| transketolase [Acaryochloris marina MBIC11017]
 gb|ABW30475.1| transketolase [Acaryochloris marina MBIC11017]
Length=668

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/665 (51%), Positives = 460/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +D  C++ +R L +D V+ AK+GH G+ +G A + Y L+  +MRFNP+ P WFNRDRF
Sbjct  6     QSLDELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDRIMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL GF SV ++++K   + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGFNSVSLEEIKNFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + NAVGLA+AE HLA++FNKP+  +VDH +Y I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   ICNAVGLAMAEAHLAAKFNKPEHTLVDHYSYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V+N   D++ ++ A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQHVENGNTDLDGIQKAIEAAKVVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H     + ++K  ++ L W +   PF +   +    + 
Sbjct  246   SLIKVTTTIGYGSPNKADTAGVHGAALGDAEIKATRENLGWSH--EPFDIPDDVLSHFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E EW + L SY+++YP EA +F  +L G +   W+ +LPR+  +D   ATR 
Sbjct  304   AVDRGATAESEWDAVLASYRSQYPAEAAEFERMLKGELPADWDKALPRYTPADKGLATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   +N LA  +P +IGGSADL  SN   + G G+F++ D    RN+R+GVREH M  I
Sbjct  364   HSEITINALAGAIPEMIGGSADLTHSNLTEIKGSGNFQKGDY-NNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSAL+ AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALAEAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L V RP+DGNE +GAYKVAIA+R  P+L+A +RQ +  N+ G+S D V 
Sbjct  483   ETIASLRAIPNLTVIRPADGNEVSGAYKVAIASRKYPTLIAFTRQAL-PNLAGSSIDAVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD+ G   P++I+I TG E+ LCE++A  LR+EG++VRVVS+  W LFE Q  E
Sbjct  542   KGAYIMSDSDGT--PDMIMIATGSEVHLCEQAAEQLRSEGKKVRVVSMPSWELFEAQTPE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  + KR++VEA +  GW  Y+G EG  I ++ FGAS P     +++GFT ENV
Sbjct  600   YKESVLPKAITKRLAVEAAADFGWHRYIGFEGQSISINRFGASAPGNTCLEQFGFTVENV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|WP_015153806.1| transketolase [Chroococcidiopsis thermalis]
 ref|YP_007091127.1| transketolase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY87258.1| transketolase [Chroococcidiopsis thermalis PCC 7203]
Length=676

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/673 (51%), Positives = 458/673 (68%), Gaps = 15/673 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P W NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPAWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHGS+L Y  L+L G++ + +DDLK+  +  S+TPGHPEN +  G+E+TTGPLGQG
Sbjct  66    LLSAGHGSMLLYALLYLTGYEDLTLDDLKQFRQWESKTPGHPENFMNPGVEITTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VG+A+AE HLA+ FNKPD PI+DH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGIAMAEAHLAATFNKPDFPIIDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL  +ED+  RFEA  W+   V++   D++ ++ A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDLAFTEDVGKRFEAYNWHVQVVEDGNTDLDGIQKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S KK  T  AH     ED+VK  ++ L W++   PF V        + 
Sbjct  246   SLIKVRTTIGYGSPKKADTRHAHGEALGEDEVKATREHLGWNH--PPFEVPEDALNHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G  LEQEW+     Y+ +Y  EA+    +    + P W++ LP +   D   ATR 
Sbjct  304   AIDRGAKLEQEWNQMFERYKQQYADEARTLERMHEAELPPNWDSVLPTYKPEDKAIATRV  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +SG CLN +A+V+P LIGGSADL  SN   L   GDF Q    + R IR+GVREH M  I
Sbjct  364   HSGNCLNAIAEVLPELIGGSADLAPSNNTLLKNSGDF-QKGQYQNRYIRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+AL G GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGLALDGSGLIPYCATFLVFTDYMRAAIRLSALSEAGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--------ANRDKPSLMALSRQKVAANMD  560
             EH+A LR IP L V RP+DGNET+GAYKVAI         N+ +PS++AL+RQ +  N+ 
Sbjct  483   EHMAALRVIPDLYVLRPADGNETSGAYKVAIEAAKGKRSGNKVRPSVLALTRQAL-PNLA  541

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             G+S +GV KG YIISD+ G   P+IILIGTG E  LC ++A  LR EG++VRVVS+ CW 
Sbjct  542   GSSIEGVTKGAYIISDSEG--TPDIILIGTGSETQLCVKAAEQLRGEGKKVRVVSMPCWE  599

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             +FE Q  EYKE VLP  V+KRVSVEA    GW  YVG EG+ IG+D++G+S P     +K
Sbjct  600   IFEEQTPEYKESVLPKAVKKRVSVEAAVTFGWCRYVGSEGIAIGIDQYGSSAPGNVCMEK  659

Query  199   YGFTEENVSKTAR  161
             +GFT +NV   A+
Sbjct  660   FGFTVDNVLAKAK  672



>ref|WP_010477310.1| transketolase [Acaryochloris sp. CCMEE 5410]
Length=668

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/665 (51%), Positives = 458/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +D  C++ +R L +D V+ AK+GH G+ +G A + Y L+  +MRFNP+ P WFNRDRF
Sbjct  6     QSLDELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDRIMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL GF SV ++++K   + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGFNSVSLEEIKNFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             + NAVGLA+AE HLA++FNKP+  +VDH +Y I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   ICNAVGLAMAEAHLAAKFNKPEHTLVDHYSYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V+N   D++ ++ A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQHVENGNTDLDGIQKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGTFEED-DVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S     +   HG    D ++K  ++ L W +   PF +   +    + 
Sbjct  246   SLIKVTTTIGYGSPNRADTAGIHGAALGDAEIKATRENLGWSH--EPFDIPDDVLSHFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E EW + L SY+++YP EA +F  +L G +   W+ SLP +  +D   ATR 
Sbjct  304   AVDRGATAESEWDAVLTSYRSQYPAEAAEFERMLKGELPADWDKSLPSYTPADKGLATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   +N LA  +P +IGGSADL  SN   + G G+F++ D    RN+R+GVREH M  I
Sbjct  364   HSEITINALAGAIPEMIGGSADLTHSNLTEIKGSGNFQKGDY-NNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSAL+ AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALAEAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L V RP+DGNE +GAYKVAIA+R  P+L+A +RQ +  N+ G+S D V 
Sbjct  483   ETIASLRAIPNLTVIRPADGNEVSGAYKVAIADRKYPTLIAFTRQAL-PNLAGSSIDAVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD+ G   P++I+I TG E+ LCE++A  LR+EG++VRVVS+  W LFE Q  E
Sbjct  542   KGAYIMSDSDGT--PDMIMIATGSEVHLCEQAAEQLRSEGKKVRVVSMPSWELFEAQTPE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  + KR++VEA +  GW  Y+G EG  I ++ FGAS P     +++GFT ENV
Sbjct  600   YKESVLPKAITKRLAVEAAADFGWHRYIGFEGQSISINRFGASAPGNTCLEQFGFTVENV  659

Query  175   SKTAR  161
                A+
Sbjct  660   LAKAK  664



>ref|WP_015180446.1| transketolase [Microcoleus sp. PCC 7113]
 ref|YP_007119688.1| transketolase [Microcoleus sp. PCC 7113]
 gb|AFZ16282.1| transketolase [Microcoleus sp. PCC 7113]
Length=670

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/667 (53%), Positives = 453/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D VQ A +GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV +DD+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTLDDIKQFRQWGSKTPGHPENFETLGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V++   D++A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDVSFTEDVGKRFEAYGWHVQHVEDGNSDLDAIAKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H     +D+VK  ++ L W+     F V     +  + 
Sbjct  246   SLIKVTTIIGYGSPNKSNTADVHGAALGKDEVKATRENLGWEYPE--FEVPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE EW   L  Y+ KYP+EA +F    +  +  GWE +LP +   D   ATR 
Sbjct  304   AVERGANLETEWDQALADYKAKYPEEAAEFERFASNKLPEGWEKALPTYTPEDKALATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P LIGGSADL  SN   L G+GDF Q      RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPELIGGSADLTHSNYTLLKGFGDF-QKGQYANRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHSSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LRAIP LLV RP+DGNET+GAYKVAI  A+ ++P+LMA SRQ +   + G+  D 
Sbjct  483   ETIASLRAIPNLLVIRPADGNETSGAYKVAIQAASENRPTLMAFSRQNL-PQLAGSGIDH  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P++ILIGTG E  LC ++A  LR EG+ VRVVS+ CW LF+ Q 
Sbjct  542   VAKGAYILSDSEGT--PDLILIGTGGETYLCVDAAEKLRAEGKNVRVVSMPCWELFDEQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V KR++VEA S  GW  Y+G+EG +I +D FG S P     +K+GFT +
Sbjct  600   EAYRESVLPKAVTKRLAVEAASSFGWCRYLGNEGAMISIDRFGVSAPGGVALEKFGFTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAK  666



>ref|WP_015119641.1| transketolase [Rivularia sp. PCC 7116]
 ref|YP_007056622.1| transketolase [Rivularia sp. PCC 7116]
 gb|AFY56075.1| transketolase [Rivularia sp. PCC 7116]
Length=683

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/667 (52%), Positives = 451/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L VD V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  19    QTLEQLCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRFNPKNPKWFNRDRF  78

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+LAGF SV I+D+K   +  S TPGHPEN +T G+E+TTGPLGQG
Sbjct  79    VLSAGHGSMLQYALLYLAGFDSVSIEDIKNFRQWESSTPGHPENFMTLGVEITTGPLGQG  138

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA+ +NKPD  IVDH TYCI+GDGC+MEG++ EA S A H  L KL 
Sbjct  139   IANAVGLAMAEAHLAAMYNKPDAKIVDHYTYCILGDGCNMEGISGEACSFAGHQGLGKLI  198

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V +   D++A+  A+  A + T KP
Sbjct  199   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVKDGNNDLDAIAKAIEEAKSVTDKP  258

Query  1432  TFIRVKTCIG-KLSKKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG     K+ T+  H      D++K  ++ L W +   PF V       M+ 
Sbjct  259   TMIKVTTTIGYGAPNKQDTAGIHGAALGADEIKLTRENLGWKH--EPFVVPEDALNHMRK  316

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E++W+     Y++KY +EA +F   L G +  GW+  LP +   D   ATR 
Sbjct  317   AVERGAGYEEDWNKTFADYKSKYAKEAAEFERYLTGKLPDGWDKVLPTYTPEDKGLATRK  376

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             YS  CLN LA V+P LIGGSADL  SN   +   G+F Q    + RN+ +GVREH M GI
Sbjct  377   YSQDCLNKLASVLPELIGGSADLTHSNLTEIKESGEF-QKGQHQNRNVHFGVREHGMGGI  435

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALH  GL+P+ ATFL+F+DYM+ +IRLSALSH G +++MTHDSIG GEDGPTHQP+
Sbjct  436   CNGMALHDSGLVPYGATFLIFTDYMRAAIRLSALSHTGTLWVMTHDSIGQGEDGPTHQPI  495

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNE +GAYK AI  A +  P+L+A +RQ V  N+ GTS D 
Sbjct  496   ETLASLRAIPNLNVIRPADGNEVSGAYKCAIERAKKKDPTLLAFTRQGV-PNLKGTSIDN  554

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y + D  G   P+IILIGTG E+ LC  +A  L  EG++VRVVS+  W LFE Q 
Sbjct  555   VAKGAYTLVDCDG--TPDIILIGTGSEVQLCVGAAEKLSGEGKKVRVVSMPSWELFEDQD  612

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE V PS+V KRVSVEA +  GW +Y+G EG  + +D FGAS P   V +K+GFT +
Sbjct  613   DSYKESVFPSSVTKRVSVEAAASFGWHKYIGTEGAAVSIDRFGASAPGATVMEKFGFTVD  672

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  673   NVVATAK  679



>ref|WP_017311149.1| transketolase [Fischerella sp. PCC 9339]
Length=670

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/667 (52%), Positives = 462/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P WFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SVQ++D+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVQLEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE H+A++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHIAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V +   ++EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQVVSDGDTNLEAIDKAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W++   PF +     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVTATRNNLGWEH--EPFDIPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E +W+     Y+ KYPQEA +F   ++G +  GWE +LP +       ATR 
Sbjct  304   AVERGAEYESQWNKVFADYKAKYPQEAAEFERQISGKLPEGWEKALPTYEPGSKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P +IGGSADL  SN   L G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPEMIGGSADLTHSNLTELKGAGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LR IP L V RP+DG ET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S +G
Sbjct  483   ETIASLRVIPNLTVIRPADGTETSGAYKVAIENANQHRPTLLALSRQNL-PQLEGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P+IILIGTG E+ LC ++A  LR EG++VRVVS+  W LF+ Q 
Sbjct  542   VTKGAYILSDSEGT--PDIILIGTGSEVPLCVDAATKLRAEGKKVRVVSMPSWELFDAQS  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
             ++Y+E VLP  V+KR++VEA S  GW  YVGDEG +I +D FG S P   + +K+G+T +
Sbjct  600   QDYRESVLPKAVKKRLAVEAASSFGWCRYVGDEGAMISVDRFGVSAPGGTIMEKFGYTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAK  666



>dbj|BAP17071.1| transketolase [cyanobacterium endosymbiont of Epithemia turgida 
isolate EtSB Lake Yunoko]
Length=668

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/665 (52%), Positives = 459/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ A++GH G+ +G A + + L+   MR+NP+ PKW NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAESGHPGLPMGAAPMAFVLWDKFMRYNPKNPKWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHL G+ SV IDD+K+  + GS+TPGHPEN +TEGIEVTTGPLGQG
Sbjct  66    VLSAGHGCMLYYALLHLTGYDSVSIDDIKQFRQWGSQTPGHPENHVTEGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  ++D  TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDCKLIDQYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++++  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDSIARAIEVAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  +  S   HG     D+VK  ++ LRW+    PF +        + 
Sbjct  246   SLIKITTTIGYGSPNKANSHDVHGAALGADEVKATRKHLRWE--YAPFDIPSDALNHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G + E EW+  L  Y+ KYP++A     +++G +  GW+ +LP +      +ATR 
Sbjct  304   SVDRGASYEAEWNKLLTQYKTKYPEDAALLERMVSGELPNGWDKALPVYTPESKKDATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN +A V+P LIGGSADL  SN+  L G GDF Q    + RNIR+GVREH M  I
Sbjct  364   QSGITLNAIAGVLPELIGGSADLAPSNKTLLKGLGDF-QKGQYQNRNIRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIA HG GLIP+ ATFLVF+DYM+N+IRLSAL+  GVI++MTHDS+ LGEDGPTHQPV
Sbjct  423   CNGIASHGSGLIPYGATFLVFTDYMRNAIRLSALAETGVIWVMTHDSVALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LR IP L+V RP+DGNET+GAYK+AI NR +P+L+ALSRQ +  N+ G+S   V 
Sbjct  483   EHIASLRLIPNLIVIRPADGNETSGAYKIAIENRHRPTLLALSRQAL-PNLAGSSIHAVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+S+  G   P+IILIGTG E+ LC  +A VL  EG++VRVVS+  W LFE Q   
Sbjct  542   KGAYIVSNCDGT--PDIILIGTGSEVELCLNAAEVLIGEGKKVRVVSMPTWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAG   GW  YVGDEG  I +D FGAS P   V +K+G+T ENV
Sbjct  600   YKESVLPKAVKKRLAVEAGVSFGWHRYVGDEGATISIDTFGASAPGDVVLEKFGYTVENV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_015956023.1| transketolase [Cyanothece sp. PCC 7424]
 ref|YP_002379306.1| transketolase [Cyanothece sp. PCC 7424]
 gb|ACK72438.1| transketolase [Cyanothece sp. PCC 7424]
Length=668

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/665 (53%), Positives = 458/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D VQ A +GH G+ +G A + + L+   MR+NP+ PKW NRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K   +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVSLDDIKEFRQWESKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+ FNKPD  ++DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAAVFNKPDCKLIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG TD++ +ED+  R+EA GW+   V++   +++A+  A+ +A   T KP
Sbjct  186   AFYDDNHISIDGHTDISFTEDVGKRYEAYGWHVQHVEDGNTNLDAIAKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T   H      D++K  ++ L W+   GPF V        + 
Sbjct  246   SLIKVTTTIGYGSPNKADTHDVHGSPLGNDEIKATRENLGWE--YGPFEVPQDALSRFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW      YQ KYPQEA     +++G +  GWE +LP +      +ATR 
Sbjct  304   AVERGAQAENEWKQLYSEYQAKYPQEAALLERMVSGELPAGWEKALPTYTPESKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN +A V+P LIGGSADL  SN+  L    DF Q      RN+R+GVREH M  I
Sbjct  364   QSGATLNAIATVIPELIGGSADLAPSNKTLLKCSKDF-QKGKYENRNVRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+N+IRLSALS A VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYGATFLVFTDYMRNAIRLSALSKARVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+  LR IP LLV RP+DGNET+GAYKVAI NR++P+L+ALSRQ +  N++G++ D V 
Sbjct  483   EHIGSLRMIPDLLVMRPADGNETSGAYKVAIENRERPTLLALSRQNL-PNLEGSTIDNVS  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD+ G   P++ILIGTG E+ LC E+A VLR EG++VRVVS+ CW LFE Q   
Sbjct  542   KGAYILSDSEG--TPDLILIGTGGEVPLCVEAAKVLRGEGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  VRKRV+VEAG+  GW  Y  DEGV IG+D FGAS P     K++GFT +NV
Sbjct  600   YKESVLPKAVRKRVAVEAGTTFGWCRYTTDEGVCIGIDTFGASAPGEVALKEFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   IAKAK  664



>ref|WP_006278283.1| transketolase [Cylindrospermopsis raciborskii]
 gb|EFA68862.1| transketolase [Cylindrospermopsis raciborskii CS-505]
Length=670

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/667 (53%), Positives = 456/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD ++ +K+GH G+ +G A + + L+   MR+NP+ P+WFNRDRF
Sbjct  6     QSLEELCINSIRFLAVDAIEKSKSGHPGLPMGAAPMAFVLWDKFMRYNPKNPRWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV I+D+K+  + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYAMLYLTGYNSVTIEDIKQFRQWGSRTPGHPENFETAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKP   IVDH TY I+GDGC+MEGV+ EAASLA H+ L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPGSTIVDHYTYVILGDGCNMEGVSGEAASLAGHYGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+ A+ +A+ SA +   KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDINAIASAIESAKSVKDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+V   ++ L W+    PF V   +   +  
Sbjct  246   TMIKVTTTIGYGSPNKANTAGVHGAALGGDEVALTRKNLGWE--YEPFVVPQDVISHLGK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                +G   E+EW+     Y+ KYPQEA +F  L++G +  GW   LP +  +D    TR 
Sbjct  304   AVGRGADYEKEWNKAFADYKAKYPQEAAEFERLVSGKLPDGWNQVLPTYTAADKALPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G GDF Q    + RNI +GVREHAM  I
Sbjct  364   HSETCLNKLAGVLPELIGGSADLTHSNLTEIKGEGDF-QKGQFQNRNIHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AGVI++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSEAGVIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNE++GAY VAI  A ++ P+L+A +RQ V  N+ GTS +G
Sbjct  483   ETLASLRAIPNLTVIRPADGNESSGAYTVAITRAKQNAPTLLAFTRQNV-PNLAGTSVEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGYII D+ G   P+IILIGTG EL LC  +A  L   G++VRVVS+    LFE Q 
Sbjct  542   VTKGGYIILDSQGT--PDIILIGTGSELSLCVGAAEKLTATGKKVRVVSMPSTDLFEEQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR+ VEAGS  GW +Y+G EG  + +D FGAS P     +K+GFT +
Sbjct  600   SSYKESVLPKAVIKRLVVEAGSSFGWHKYIGIEGDAVSIDRFGASAPGGICLEKFGFTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAQ  666



>dbj|BAB62078.1| transketolase [Polygonum tinctorium]
Length=620

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/620 (55%), Positives = 428/620 (69%), Gaps = 5/620 (1%)
 Frame = -3

Query  2020  MRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPEN  1841
             MR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SV+ +DLK+  + GS+TPGHPEN
Sbjct  1     MRYNPKNPFWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQFRQWGSKTPGHPEN  60

Query  1840  VITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVT  1661
               T GIEVTTGPLGQG+ANAVGLALAE HLA+RFNKPD  IVDH TY I+GDGC MEG+ 
Sbjct  61    FETIGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGIA  120

Query  1660  NEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDME  1481
             NEA SLA HW L KL   YDDNH +IDG T++  +E +  RFEALGW+ I V N     +
Sbjct  121   NEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTESVDKRFEALGWHVIWVKNGNTGYD  180

Query  1480  ALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNG  1304
              ++ A+  A     KPT I+V T IG  S  +  S + HG      +V+  ++ L W   
Sbjct  181   EIRAAIEEAKKVKDKPTMIKVTTTIGFGSPNKSNSYSVHGAALGAKEVEATRKNLGWP--  238

Query  1303  RGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWET  1124
               PFHV   + +       +G  LE EW++K   Y++KYP EA +  +++ G    GWE 
Sbjct  239   YEPFHVPEEVEKHWSRHVPEGAALEAEWNAKFAEYKSKYPTEAAELKSIIEGEFPAGWEK  298

Query  1123  SLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPR  944
             +LP +    P +ATR  S  CLN LA VVPGL+GGSADL SSN   L  +GDF Q D+P 
Sbjct  299   ALPTYTPESPGDATRNLSQTCLNALAPVVPGLLGGSADLASSNMTLLKSFGDF-QKDTPE  357

Query  943   GRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMT  764
              RN+R+GVREH M  I NGIALH  G +P+ ATF VF+DYM+ +IR+SALS A VIY+MT
Sbjct  358   ERNVRFGVREHGMGAICNGIALHSPGFVPYCATFFVFTDYMRGAIRISALSLARVIYVMT  417

Query  763   HDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSR  584
             HDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAG+Y+VA+  +  PS++ALSR
Sbjct  418   HDSIGLGEDGPTHQPIEHLASFRAMPNILMMRPADGNETAGSYRVAVLKKQTPSILALSR  477

Query  583   QKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVR  404
             QK+  N+ GTS +GV KGGY I+DNS    P++ILIGTG EL +  ++   LR  G+ VR
Sbjct  478   QKL-PNLPGTSIEGVEKGGYTITDNSTGNKPDVILIGTGSELEIAAKAGDELRKAGKAVR  536

Query  403   VVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASG  224
             VVS VCW LFE Q  EYKE VLP+ V  RVS+EAGS  GW + VG +G  IG+D FGAS 
Sbjct  537   VVSFVCWELFEEQSDEYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASA  596

Query  223   PDTHVFKKYGFTEENVSKTA  164
             P   ++K+YG T E V + A
Sbjct  597   PAGRIYKEYGITVEAVIEAA  616



>gb|KDO85801.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=721

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/691 (51%), Positives = 450/691 (65%), Gaps = 35/691 (5%)
 Frame = -3

Query  2230  LEELKRAYPSQACSAHEWEEDDDKFQEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLA  2051
             L   + + P +A +    E   D     +  + V+ +R L VD V+ A +GH G+ +G A
Sbjct  62    LSTSQASLPIRAAAVETLETSTDA---ALVEKSVNTIRFLAVDAVEKANSGHPGLPMGCA  118

Query  2050  EVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKL  1871
              +G+ LY  VMR+NP+ P WFNRDRFVLSAGHG +LQY  LHLAG+ SVQ          
Sbjct  119   PMGHILYDEVMRYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVQ----------  168

Query  1870  GSRTPGHPENVITEGIEVTTGPLGQGVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIM  1691
                              VTTGPLGQG+ANAVGLALAE HLA+R+NKPD  IVDH TY I+
Sbjct  169   -----------------VTTGPLGQGMANAVGLALAEKHLAARYNKPDNEIVDHYTYVIL  211

Query  1690  GDGCSMEGVTNEAASLAAHWKLNKLTLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTI  1511
             GDGC MEG+ NEA+SLA H  L KL   YDDNH +IDG T++  +E++  RFE LGW+ I
Sbjct  212   GDGCQMEGIANEASSLAGHLGLGKLIAFYDDNHISIDGDTEIAFTENVDKRFEGLGWHVI  271

Query  1510  TVDNTQGDMEALKNALNSAHTETQKPTFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQ  1334
              V N     + ++ A+  A   T KPT IRV T IG  S  +  S + HG+     +V  
Sbjct  272   WVKNGNTGYDDIRAAIKEAKAVTDKPTLIRVTTTIGFGSPNKANSYSVHGSALGAKEVDA  331

Query  1333  MKQKLRWDNGRGPFHVIPMLYREMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALL  1154
              ++ L W     PFHV   + +       +G TLE EW++K   Y+ KYP+EA +F ++ 
Sbjct  332   TRKNLGWP--YEPFHVPEDVKKHWSRHVAEGATLEAEWNAKFAEYEKKYPEEAAEFKSIS  389

Query  1153  NGGIVPGWETSLPRWLMSDPVEATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGY  974
             +G +  GWE +LP +    P EATR  S  CLN LAK +PGL+GGSADL SSN   L  +
Sbjct  390   SGQLPAGWEKALPTYTPESPAEATRNLSQTCLNALAKTLPGLLGGSADLASSNMTLLKMF  449

Query  973   GDFEQPDSPRGRNIRYGVREHAMAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSAL  794
             GDF Q D+P  RN+R+GVREH M  I NGIALH  GLIP+ ATF VF+DYM+ +IR+SAL
Sbjct  450   GDF-QKDTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAIRISAL  508

Query  793   SHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANR  614
               AGVIY+MTHDSIGLGEDGPTHQP+EHLA  RA+P +L+ RP+DGNETAGAYKVA+ANR
Sbjct  509   CEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVANR  568

Query  613   DKPSLMALSRQKVAANMDGTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAG  434
              +PS++ALSRQK+  ++ GTS DGV KG YIISDNS    P++ILIGTG EL +  ++A 
Sbjct  569   KRPSILALSRQKL-PHLAGTSIDGVEKGAYIISDNSSGNKPDVILIGTGSELEIAAKAAE  627

Query  433   VLRNEGRRVRVVSLVCWRLFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVV  254
              LR  G+ VRVVS V W LF+ Q   YKE VLP+ V  RVS+EAGS  GW + VG +G  
Sbjct  628   ELRKGGKAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKA  687

Query  253   IGMDEFGASGPDTHVFKKYGFTEENVSKTAR  161
             IG+D FGAS P   ++K++G T E V   A+
Sbjct  688   IGIDRFGASAPAGKIYKEFGITAEAVITAAK  718



>ref|WP_026734655.1| transketolase [Fischerella sp. PCC 9605]
Length=670

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/667 (52%), Positives = 455/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P WFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV I+D+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTIEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV++EA SLA H  L KL 
Sbjct  126   IANGVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSSEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+  RFEA GW+   + +   +++A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVGKRFEAYGWHVQAIPDGDTNLDAIHKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W+    PF V     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVIATRNNLGWE--YEPFVVPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW+     Y+ KYPQEA +F  +++G +  GWE +LP +   D   ATR 
Sbjct  304   AVERGAQYEDEWNKVFADYKAKYPQEAAEFERMVSGKLPEGWEKALPTYKPGDKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P LIGGSADL  SN   + G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEITLNALAPVLPELIGGSADLTHSNLTEIKGGGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHKSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S + 
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIENANQHRPTLLALSRQNL-PQLEGSSIES  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y++S   GE  P++ILIGTG E+ LC E+A  L  EG++VRV+S+  W LF+ Q 
Sbjct  542   VTKGAYVLS--GGEGTPDLILIGTGSEVPLCVEAAKKLEEEGKKVRVISMPSWELFDAQS  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V+KR++VEA S  GW  YVGDEG +I +D FG S P     +K+G+T  
Sbjct  600   ESYRESVLPKAVKKRLAVEAASNFGWCRYVGDEGAMISVDRFGVSAPGGVAMEKFGYTVA  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAK  666



>ref|WP_039754505.1| transketolase [Hassallia byssoidea]
 gb|KIF28216.1| transketolase [Hassallia byssoidea VB512170]
Length=670

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/667 (52%), Positives = 452/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  LHL GF SV I+D+K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLHLTGFDSVSIEDIKQFRQWESKTPGHPENFMTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEG++ EA S A H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGISGEACSFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D++A++ A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVEDGNKDLDAIEKAIAEAKEVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  +  +   HG+    D+V   +  L W     PF V       M  
Sbjct  246   TMIKVTTTIGYGSPNKANTAGIHGSALGGDEVTLTRNNLEWT--YEPFVVPEDAKNHMGK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW+     Y+ KY +EA  F   ++G +  GW+  LP +   D    TR 
Sbjct  304   AVERGANYEAEWNKTFGDYKAKYAEEAALFERFISGKLPDGWDKVLPTYTPEDKGIPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LAKV+P LIGGSADL  SN   + G GDF Q       NI +GVREHAM  I
Sbjct  364   HSENCLNKLAKVLPELIGGSADLTHSNLTEIKGIGDF-QKGHYENPNIHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGIALHQSGLIPYGATFLIFTDYMRAAIRLSALSQAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L+V RP+DGNE++GAYKVA+  + ++ P+L+A +RQ V  N+ GTS +G
Sbjct  483   ETLASLRAIPNLIVIRPADGNESSGAYKVAVEKSKQNAPTLLAFTRQNV-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y + D+ G   PE+ILIGTG EL LC  +A  L +EG++VRVVS+  W LFE Q 
Sbjct  542   VTKGAYTVVDSEG--TPELILIGTGSELSLCVTAAEKLTSEGKKVRVVSMPSWELFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE +LP  V KRVSVEA +  GW +YVG EG  + +D FGAS P     +K+GF+ E
Sbjct  600   AAYKESILPKAVTKRVSVEAAASFGWHKYVGMEGDCVSIDRFGASAPGGVCLEKFGFSVE  659

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  660   NVLATAK  666



>ref|WP_006528204.1| transketolase [Gloeocapsa sp. PCC 73106]
 gb|ELR98971.1| transketolase [Gloeocapsa sp. PCC 73106]
Length=668

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/665 (52%), Positives = 455/665 (68%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ +R L +D V+ A +GH G+ +G A + + L+   +RFNP+ PKW NRDRF
Sbjct  6     QSLEELCINAIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDRFLRFNPKNPKWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV ++D+K+  +  S+TPGHPEN +T GIEVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVSLEDIKQFRQWNSKTPGHPENHVTAGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VG A+AE HLA+ FNKPD P++DH TY I+GDGC+MEG++ EA SLA H  L KL 
Sbjct  126   IANGVGFAMAEAHLAATFNKPDFPMIDHYTYVILGDGCNMEGISGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL+ +ED+  R+EA GW+   V+N   D+ A++ A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDLSFTEDVGKRYEAYGWHVQHVENGNTDLAAIEKAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  +  S   HG+   +D++K  +Q L W      F V   +    + 
Sbjct  246   SLIKVTTLIGYGSPNKADSHDVHGSPLGKDEIKATRQNLGWSYPE--FEVPSEVLDHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T ++EW     +YQ +YP+EA     +L G +  GWE +LP +      +ATR 
Sbjct  304   AVDRGATYQEEWEQLFQNYQAQYPEEAALLSRMLTGKLPEGWEKALPTYTPESKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN LA V+P L GGSADL  SN+  L GYGDF Q    + RN+R+GVREH M  I
Sbjct  364   QSGATLNALAGVLPELFGGSADLAPSNKTLLKGYGDF-QKGQYQNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+NSIRLSA+S AGVI++MTHDS+ LGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYGATFLVFTDYMRNSIRLSAISEAGVIWVMTHDSVALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP+L+V RP+DGNET+GAYKVA+ NR +P+L+ALSRQ +  N+ G+S +   
Sbjct  483   EHIASLRAIPQLVVMRPADGNETSGAYKVAVENRHRPTLLALSRQNL-PNLAGSSIEATA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI++D  G   PE+ILIGTG E  LC E+   L  EG +VRVVS+  W LF+ Q   
Sbjct  542   KGAYILNDCEGT--PELILIGTGGETHLCVEAGARLSQEGIKVRVVSMPSWELFDMQDSA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLP    KR++VEAGS +GW  YVG EG  I +D FGAS P   V +K+G+T +NV
Sbjct  600   YRESVLPKAATKRLAVEAGSSMGWCRYVGSEGDTISIDHFGASAPGEIVMEKFGYTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VNKAK  664



>ref|WP_010997495.1| transketolase [Nostoc sp. PCC 7120]
 ref|NP_487384.1| transketolase [Nostoc sp. PCC 7120]
 sp|Q8YRU9.1|TKT_NOSS1 RecName: Full=Transketolase; Short=TK [Nostoc sp. PCC 7120]
 dbj|BAB75043.1| transketolase [Nostoc sp. PCC 7120]
Length=670

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/667 (52%), Positives = 447/667 (67%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++   ++ +R L VD ++ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEELSINAIRFLAVDAIEKAKSGHPGLPMGAAPMAFVLWNRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+L G+ SV I+D+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLTGYDSVSIEDIKQFRQWESKTPGHPENFMTAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EAAS A H  L KL 
Sbjct  126   IANGVGLAIAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEAASFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFE+ GW+ I V +   D+EA+  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFESYGWHVIHVKDGNTDLEAIHKAIEEAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+V   +Q L W +   PF V   +    + 
Sbjct  246   TMIKVTTIIGYGSPNKSNTAGVHGAALGGDEVALTRQNLGWSH--DPFVVPEDVLNYTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E +W+     Y+ KYPQEA +F   L+G +  GW+  LP +   D    TR 
Sbjct  304   AVERGAGYESDWNKTYADYKAKYPQEAAEFERYLSGKLADGWDKVLPSYTPEDKGLPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G GDF Q    +  NI +GVREH M  I
Sbjct  364   HSETCLNKLAAVLPELIGGSADLTHSNLTEIKGKGDF-QKGQYQNPNIHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFL+FSDYM+  IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGIALHGSGLIPYGATFLIFSDYMRAPIRLSALSQAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  A  + P+L+A +RQ V  N+ GTS D 
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIERAKNNAPTLLAFTRQNV-PNLAGTSIDD  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGYI+ D  G   P++ILIGTG EL LC  +A  L+ EG++VRVVSL  W LF+ Q 
Sbjct  542   VAKGGYIVVDTDGT--PDLILIGTGSELSLCVTAAEKLKAEGKKVRVVSLAAWDLFDAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR++VEA S  GW +Y+G EG  + +D FGAS P     +K+GF+ +
Sbjct  600   AAYKESVLPKAVTKRLAVEAASSFGWHKYIGSEGDAVTIDRFGASAPGGVCLEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_015141161.1| transketolase [Nostoc sp. PCC 7524]
 ref|YP_007078352.1| transketolase [Nostoc sp. PCC 7524]
 gb|AFY50755.1| transketolase [Nostoc sp. PCC 7524]
Length=670

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/667 (52%), Positives = 450/667 (67%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++   ++ +R L VD ++ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEELSINAIRFLAVDAIEKAKSGHPGLPMGAAPMAFVLWNRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+L G+ SV I+D+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLTGYDSVTIEDIKQFRQWESKTPGHPENFVTAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EAASLA H  L KL 
Sbjct  126   IANGVGLAIAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEAASLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V     D+EA+  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVKEGNTDLEAIAKAIEEAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+VK  +++L W++   PF V   +    + 
Sbjct  246   TMIKVTTTIGYGSPNKANTAGVHGAALGADEVKLTRERLNWEH--EPFVVPEDILSYTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E +W+     Y+ KYPQEA +F   L+G +  GW+  LP +   D    TR 
Sbjct  304   AIERGAGYEADWNQAFADYKAKYPQEAAEFERYLSGKLAEGWDKVLPTYTPEDKGLPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA VVP LIGGSADL  SN   + G GDF Q    +  NI +GVREH M  I
Sbjct  364   HSETCLNKLAAVVPELIGGSADLTHSNLTEIKGKGDF-QKGQYQNPNIHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGIALHSSGLIPYGATFLIFTDYMRAAIRLSALSLAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  A  + P+L+A +RQ V  N+ GTS + 
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIERAKANAPTLLAFTRQNV-PNLAGTSIEN  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGY++ D+ G   P++ILIGTG EL LC  +A  L  EG++VRVVSL  W LFE Q 
Sbjct  542   VAKGGYVLVDSEGT--PDLILIGTGSELSLCVTAAEKLTAEGKKVRVVSLPAWDLFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR++VEA S  GW +YVG EG  + +D FGAS P     +K+GF+ +
Sbjct  600   ATYKESVLPKAVTKRLAVEAASSFGWHKYVGTEGDTVTIDRFGASAPGGVCLEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_035992986.1| transketolase [Leptolyngbya sp. KIOST-1]
Length=668

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/665 (52%), Positives = 458/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + Y L+   MRFNP+ P+WFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDKFMRFNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  + G+RTPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGARTPGHPENFETLGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDATLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED++ RFEA GW+   V+N   D++A+  A+ +A   T +P
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVAKRFEAYGWHVQHVENGNTDLDAIAKAIEAAKAVTDRP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K+ T+  H      D++K  ++ L W +G   F V       M+ 
Sbjct  246   SMIKVTTTIGYGSPNKQNTAGVHGAALGGDEIKLTRENLGWSHGD--FEVPEDALSHMRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G +LE EW   L +Y+++Y  EA +F  +L+G +  GW  +LP +   D   ATR 
Sbjct  304   AVERGASLEAEWEETLATYRSQYATEAAEFERMLSGKLPEGWADALPTYTPEDKALATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA  +P LIGGSADL  SN   L   G F Q  +   RN+R+GVREH M  I
Sbjct  364   NSEITLNALAPAIPELIGGSADLTHSNLTELKISGSF-QKGAYENRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHNSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             E +A LRAIP L+V RP+DG ET+GAYK+A+ +R  P+LMA SRQ +  N+ G+S +GV 
Sbjct  483   ETIASLRAIPNLIVIRPADGTETSGAYKIAVEHRKTPTLMAFSRQNL-PNLPGSSIEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+ D  G   P++ILIGTG E+ LC ++A  LR+ G +VRVVS+  W LF+ Q   
Sbjct  542   KGAYIVDDCDGT--PDLILIGTGSEVSLCVDAAKELRSAGTKVRVVSMPSWELFDAQEAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             Y+E VLP  V KR++VEAG  +GW  YVG EG V+G+D FGAS P   V +K+GFT ENV
Sbjct  600   YQESVLPKAVTKRLAVEAGITMGWCRYVGAEGDVVGVDRFGASAPGGLVMEKFGFTVENV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VNRAK  664



>ref|WP_016863351.1| transketolase [Fischerella muscicola]
Length=670

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/667 (52%), Positives = 462/667 (69%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P WFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPYWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SVQ++D+K+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVQLEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNK D  IVDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKSDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V +   ++EA+  A+ +A + T KP
Sbjct  186   ALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQVVSDGDTNLEAIDKAIAAAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S  K  T+  H      D+V   +  L W++   PF++     +  + 
Sbjct  246   SLIKVRTTIGYGSPNKANTAGVHGAALGGDEVTATRNNLGWEH--EPFNIPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E +W+     Y+ KYPQEA +F   ++G +  GWE +LP +       ATR 
Sbjct  304   AVERGAEYESQWNKVFADYKAKYPQEAAEFERQISGKLPEGWEKALPTYEPGSKAIATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA V+P +IGGSADL  SN   L G GDF Q    + RN+R+GVREH M  I
Sbjct  364   TSEMTLNALAPVLPEMIGGSADLTHSNLTELKGAGDF-QKGQYQNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSIGLGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIGLGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LR IP L V RP+DG ET+GAYKVAI  AN+ +P+L+ALSRQ +   ++G+S +G
Sbjct  483   ETIASLRVIPNLTVIRPADGTETSGAYKVAIENANQHRPTLLALSRQNL-PQLEGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG YI+SD+ G   P+IILIGTG E+ LC ++A  LR +GR+VRVVS+  W LF+ Q 
Sbjct  542   VTKGAYILSDSEG--TPDIILIGTGSEVPLCVDAAAELRAKGRKVRVVSMPSWELFDAQN  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V+KR++VEA S  GW  Y+GDEG +I +DEFG S P   + +++G+T +
Sbjct  600   ESYRESVLPKAVKKRLAVEAASSFGWCRYLGDEGAMISVDEFGRSAPGGRIMEEFGYTVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVVAKAK  666



>ref|WP_009556088.1| transketolase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69176.1| transketolase [Oscillatoriales cyanobacterium JSC-12]
Length=670

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/661 (52%), Positives = 456/661 (69%), Gaps = 9/661 (1%)
 Frame = -3

Query  2134  CVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAGH  1955
             C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKW+NRDRFVLSAGH
Sbjct  12    CINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDQFMRFNPKNPKWYNRDRFVLSAGH  71

Query  1954  GSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAVG  1775
             G +LQY  ++L G+ SV +DD+K+  + GS+TPGHPEN  T G+EVTTGPLGQG+ANAVG
Sbjct  72    GCMLQYALMYLTGYDSVTLDDIKQFRQWGSKTPGHPENFETAGVEVTTGPLGQGIANAVG  131

Query  1774  LALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYDDN  1595
             LA+AE H+A+ FNKPD+ +VDH TY I+GDGC+MEGV+ EA SLA H  L KL  LYDDN
Sbjct  132   LAMAEAHMAATFNKPDVTLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLIALYDDN  191

Query  1594  HNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIRVK  1415
             H +IDG+TD+  +ED++ RFEA GW+   V +   D+EA+  A+  A   T KP+ I++ 
Sbjct  192   HISIDGSTDIAFTEDVAKRFEAYGWHVQHVPDGNTDLEAIAKAIAEAKAVTNKPSLIKIT  251

Query  1414  TCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQGE  1238
             T IG  S  K  T+  H     ED++K  ++ L W     PF +       M+   E+G 
Sbjct  252   TTIGYGSPNKANTAGVHGAALGEDEIKLTRENLGWQ--YAPFTIPDDALNHMRKAVERGA  309

Query  1237  TLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGKCL  1058
             +LE EW      Y+ KY +EA +F  L+NG +  GW+  LP +  +D   A+R +S  CL
Sbjct  310   SLEAEWQETWAQYKTKYTKEAAEFERLINGKLPDGWDKVLPTYTPADKAVASRKHSEICL  369

Query  1057  NHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGIAL  878
             N LA V+P L GGSADL  SN   L G+GDF Q    + RN+R+GVREH M  I NGIAL
Sbjct  370   NALAPVLPELFGGSADLTHSNLTELKGFGDF-QAGHYQNRNVRFGVREHGMGAICNGIAL  428

Query  877   HGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLAGL  698
             HG GLIP+ ATFLVF+DYM+ +IRLSAL+  GVI++MTHDSI LGEDGPTHQPVE +A L
Sbjct  429   HGSGLIPYGATFLVFTDYMRGAIRLSALAQCGVIWVMTHDSIALGEDGPTHQPVETIASL  488

Query  697   RAIPRLLVFRPSDGNETAGAYKVAIAN--RDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
             RAIP L V RP+DG ET+GAYKVAI N   ++P+L+ALSRQ +  N+ G+S DGV KG Y
Sbjct  489   RAIPNLTVLRPADGTETSGAYKVAILNAKENRPTLLALSRQNL-PNLSGSSIDGVAKGAY  547

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              + D  G   P++ILIGTG E+ LC ++A  L  EG++VRVVS+  W LFE Q   YKE 
Sbjct  548   AVIDCDGT--PDLILIGTGSEVGLCVKAAEQLTGEGKKVRVVSMPSWELFEAQDTAYKES  605

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLP  V+KR++VEAG  +GW ++VG+EG V+ +D FGAS P     +K+GFT +NV   A
Sbjct  606   VLPKAVKKRLAVEAGISMGWCKFVGEEGDVVSIDRFGASAPGGTCLEKFGFTVDNVVTKA  665

Query  163   R  161
             +
Sbjct  666   K  666



>ref|WP_012264879.1| transketolase [Microcystis aeruginosa]
 ref|YP_001656511.1| transketolase [Microcystis aeruginosa NIES-843]
 dbj|BAG01319.1| transketolase [Microcystis aeruginosa NIES-843]
Length=668

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS DGV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLDGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D+ G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDSEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT  NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVNNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_009341460.1| transketolase [Raphidiopsis brookii]
 gb|EFA74379.1| transketolase [Raphidiopsis brookii D9]
Length=698

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/667 (53%), Positives = 456/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD ++ +K+GH G+ +G A + + L+   MR+NP+ P+WFNRDRF
Sbjct  34    QSLEELCINSIRFLAVDAIEKSKSGHPGLPMGAAPMAFVLWDKFMRYNPKNPRWFNRDRF  93

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV I+D+K+  + GSRTPGHPEN  T G+EVTTGPLGQG
Sbjct  94    VLSAGHGCMLQYAMLYLTGYDSVTIEDIKQFRQWGSRTPGHPENFETSGVEVTTGPLGQG  153

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNK    IVDH TY I+GDGC+MEGV+ EAASLA H+ L KL 
Sbjct  154   IANAVGLAMAEAHLAAKFNKLGSTIVDHYTYVILGDGCNMEGVSGEAASLAGHYGLGKLI  213

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+ A+ +AL +A     KP
Sbjct  214   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDINAIASALEAAKAVKDKP  273

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+V   ++ L W+    PF V   +   +  
Sbjct  274   TMIKVTTTIGYGSPNKSNTAGVHGAALGGDEVALTRKNLGWE--YEPFVVPQDVISHLGK  331

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
                +G   E+EW+     Y+ KYPQEA +F  LL+G +  GW   LP +  +D    TR 
Sbjct  332   AVGRGADYEKEWNKAFADYKAKYPQEAAEFERLLSGKLPDGWNQVLPTYTAADKALPTRK  391

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + G GDF Q    + RNI +GVREHAM  I
Sbjct  392   HSETCLNKLAGVLPELIGGSADLTHSNLTEIKGEGDF-QKGQFQNRNIHFGVREHAMGAI  450

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AGVI++MTHDSIG GEDGPTHQP+
Sbjct  451   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSEAGVIWVMTHDSIGQGEDGPTHQPI  510

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNE++GAY VAI  A ++ P+L+A +RQ V  N+ GTS +G
Sbjct  511   ETLASLRAIPNLTVIRPADGNESSGAYTVAITRAKQNAPTLLAFTRQNV-PNLAGTSVEG  569

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGYII D+ G   P+IILIGTG EL LC  +A  L   G++VRVVS+    LFE+Q 
Sbjct  570   VTKGGYIILDSPGT--PDIILIGTGSELSLCVGAAEKLTATGKKVRVVSMPSTDLFEQQD  627

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR++VEAGS  GW +Y+G EG  + +D FGAS P     +K+GFT +
Sbjct  628   SSYKESVLPKGVTKRLAVEAGSSFGWHKYIGIEGDAVSIDRFGASAPGGTCLEKFGFTVD  687

Query  181   NVSKTAR  161
             NV   A+
Sbjct  688   NVVAKAQ  694



>ref|WP_017719390.1| transketolase [Oscillatoria sp. PCC 10802]
Length=671

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/669 (53%), Positives = 460/669 (69%), Gaps = 12/669 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV I+D+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTIEDIKQFRQWESKTPGHPENFVTAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             ++NAVGLA+AE HLA++FNKP   ++DH TY I+GDGC MEGV+ EA SLA H  L KL 
Sbjct  126   ISNAVGLAMAEAHLAAKFNKPGYNLIDHYTYVILGDGCQMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGD----MEALKNALNSAHTE  1445
              LYDDNH +IDG TDL+ +ED+  RFEA GW+ ITVDNT  D    ++A+  A+  A   
Sbjct  186   ALYDDNHISIDGHTDLSFTEDVGKRFEAYGWHVITVDNTNLDEDTNLDAVHKAIEEAKQV  245

Query  1444  TQKPTFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYR  1268
             T KP+ I+V+T IG  S  K  T   H      D+VK  ++ L W+    PF V      
Sbjct  246   TDKPSLIKVRTIIGFGSPNKRDTHGVHGAALGGDEVKATREFLGWE--YEPFVVPQDALN  303

Query  1267  EMKLQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVE  1088
               +   E+G   E EW+     Y+ +Y  EA +   L+ G +  GWE  LP +  +D  +
Sbjct  304   HFRKAVERGAQWEGEWNEAFDKYKAEYAAEAAELERLIAGKLPEGWEKVLPTYTPADKGD  363

Query  1087  ATRGYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHA  908
             ATR +SGKCLN LA V+P LIGGSADL  SN  YL  + DF++      RN+R+GVREH 
Sbjct  364   ATRNHSGKCLNALADVIPELIGGSADLAPSNMTYLKKFKDFQKGQYGE-RNLRFGVREHG  422

Query  907   MAGISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPT  728
             M  I+NG+ALH GGL+P+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSI LGEDGPT
Sbjct  423   MGAIANGMALH-GGLVPYCATFLVFADYMRGAIRLSALSEAGVIYVMTHDSIALGEDGPT  481

Query  727   HQPVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSA  548
             HQPVE +A LR IP LLV RP+DGNET+G+YKV I NR +P+L+ALSRQ +  N+ G+S 
Sbjct  482   HQPVETIASLRVIPDLLVIRPADGNETSGSYKVGIENRTRPTLLALSRQNL-PNLAGSSI  540

Query  547   DGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFER  368
             +GV KG YI+SD+ G   P+IILIGTG EL LC  +A  LR EG++VRVVS+ CW LF+ 
Sbjct  541   EGVAKGAYILSDSEGT--PDIILIGTGGELHLCVSAADKLRAEGKKVRVVSMPCWELFDE  598

Query  367   QPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFT  188
             Q   Y+E VLP  V KR++VEAGS  GW  Y+G EG  I +D FG S P     +K+G+T
Sbjct  599   QDEAYRESVLPKAVTKRLAVEAGSSFGWCRYLGGEGASISIDRFGVSAPGNVALEKFGYT  658

Query  187   EENVSKTAR  161
              +NV   A+
Sbjct  659   VDNVLAKAQ  667



>ref|WP_013321191.1| transketolase [Cyanothece sp. PCC 7822]
 ref|YP_003886359.1| transketolase [Cyanothece sp. PCC 7822]
 gb|ADN13084.1| transketolase [Cyanothece sp. PCC 7822]
Length=668

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/665 (53%), Positives = 460/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D VQ A +GH G+ +G A + + L+   MR+NP+ PKW NRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDQFMRYNPKNPKWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV I+D+K+  +  S+TPGHPEN +T+G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVSIEDIKQFRQWESKTPGHPENFMTDGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+ FNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAAVFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG TD++ +ED+  R+EA GW+   V     D++A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGHTDISFTEDVGKRYEAYGWHVQHVPGGNTDLDAIAKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T   H      D++K  ++ L W+   GPF V     +  + 
Sbjct  246   SLIKVTTTIGYGSPNKADTHDVHGSPLGNDEIKATRENLGWE--YGPFEVPEDALKRFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   EQEW++    Y++KYP+EA     +++G +  GWE +LP +      +ATR 
Sbjct  304   AVDRGAQYEQEWNNLFSEYKSKYPEEAALLERMVSGKLPEGWEKALPVYAPGSKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN +A V+P LIGGSADL  SN+  L    DF Q      RNIR+GVREH M  I
Sbjct  364   QSGATLNAIATVLPELIGGSADLAPSNKTLLKCSKDF-QKGKYENRNIRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+NSIRLSALS AGVI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYGATFLVFTDYMRNSIRLSALSKAGVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LR IP LLV RP+DGNET+GAYKVA+ NRD+P+L+ALSRQ +   ++ +S +   
Sbjct  483   EHIASLRLIPDLLVMRPADGNETSGAYKVAVDNRDRPTLLALSRQNLPI-LESSSIENTA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YI+SD+ G   P+IILIGTG E+ LC E+A VLR EG++VRVVS+ CW LFE Q   
Sbjct  542   KGAYILSDSDGT--PDIILIGTGGEVPLCVEAAKVLRGEGKKVRVVSMPCWELFEEQDAA  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KRV+VEAG   GW  Y  DEGV IG+D FGAS P     +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRVAVEAGVTAGWCRYTTDEGVAIGIDTFGASAPGEVALEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_015149789.1| transketolase [Oscillatoria acuminata]
 ref|YP_007087082.1| transketolase [Oscillatoria acuminata PCC 6304]
 gb|AFY83162.1| transketolase [Oscillatoria acuminata PCC 6304]
Length=676

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/668 (51%), Positives = 458/668 (69%), Gaps = 14/668 (2%)
 Frame = -3

Query  2155  QEMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDR  1976
             ++ ++  C++++R L +D V+ A +GH G+ +G A + + L+   MRFNP+ PKWFNRDR
Sbjct  8     KQSLEELCINSIRFLAIDAVEKANSGHPGLPMGAAPMAFVLWDKFMRFNPKNPKWFNRDR  67

Query  1975  FVLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQ  1796
             FVLSAGHG +LQY  L+L G++ ++++DLK+  +  S+TPGHPEN  TEG+EVTTGPLGQ
Sbjct  68    FVLSAGHGCMLQYALLYLTGYRGLELEDLKQFRQWESKTPGHPENFQTEGVEVTTGPLGQ  127

Query  1795  GVANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKL  1616
             G+ANAVGLA+AE HLA++FNKPD+ IVDH TY I+GDGC+MEG++ EA SLA HW L KL
Sbjct  128   GIANAVGLAVAEAHLAAKFNKPDLKIVDHYTYVILGDGCNMEGISGEACSLAGHWGLGKL  187

Query  1615  TLLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQK  1436
                YDDNH +IDG+TD++ +ED+S RFE+  W+ + V+N   D++A+  A+  A   T K
Sbjct  188   IAFYDDNHISIDGSTDISFTEDVSKRFESYNWHVLHVENGNTDLDAIAKAIEEAKKVTDK  247

Query  1435  PTFIRVKTCIGKLSKKEGTSKAHHG-TFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMK  1259
             PT I+V T IG  S  +  S   HG      +V+  +  L W+   GPF V        +
Sbjct  248   PTLIKVTTTIGFGSPNKANSHDVHGAALGASEVQATRDHLGWN--YGPFEVPEDALGHFR  305

Query  1258  LQAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATR  1079
                ++G   E+EW+S    Y  +Y +EA     +++G +  GW+ +LP +   +  +ATR
Sbjct  306   KAVDRGAKYEEEWNSLWTRYTAEYSEEAAVLERMMSGKLPDGWDKALPTFKPGEKADATR  365

Query  1078  GYSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAG  899
               SG CLN +A V+P LIGGSADL  SN+  L    DF Q  +   RN+R+GVREH M  
Sbjct  366   NQSGACLNAIAGVLPDLIGGSADLAPSNKTLLKSSKDF-QKGAYENRNVRFGVREHGMGA  424

Query  898   ISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQP  719
             I NGIALHG GLI + ATFLVF+DYM+ +IRLSALS AGVI++MTHDSI LGEDGPTHQP
Sbjct  425   ICNGIALHGSGLISYGATFLVFTDYMRGAIRLSALSQAGVIWVMTHDSIALGEDGPTHQP  484

Query  718   VEHLAGLRAIPRLLVFRPSDGNETAGAYKVAI-------ANRDKPSLMALSRQKVAANMD  560
             +EH+  LRAIP L+V RP+DGNET+GAYKVA+       A+   PSL+ALSRQ +  N++
Sbjct  485   IEHIPSLRAIPDLIVLRPADGNETSGAYKVAVEKAKGIGADHPYPSLLALSRQNL-PNLE  543

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             GTS +GV KGGY ISD+ G   P+IILIGTG EL LC E+A  LR +G++VRVVS+    
Sbjct  544   GTSIEGVAKGGYTISDSEG--TPDIILIGTGGELYLCAEAAEKLRGQGKKVRVVSMPSCE  601

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             LF+ Q   Y+E VLP  V+KR+ VEAGS  GW  Y GD+G  I +D FGAS P     ++
Sbjct  602   LFDEQDEAYRESVLPKAVKKRLVVEAGSSYGWHRYFGDQGSSISVDRFGASSPGEVALER  661

Query  199   YGFTEENV  176
             +G+T +N+
Sbjct  662   FGYTADNI  669



>ref|WP_009631538.1| transketolase [Synechocystis sp. PCC 7509]
Length=676

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/673 (50%), Positives = 458/673 (68%), Gaps = 15/673 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P W NRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMSFVLWDRFMRFNPKNPAWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHGS+LQY  L+L G++ + +DD+K+  +  S+TPGHPEN +  G+E+TTGPLGQG
Sbjct  66    LLSAGHGSMLQYALLYLTGYEDLTLDDIKQFRQWESKTPGHPENFMNPGVEITTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VG+A+AE HLA+ FNKPD PI+DH TY IMGDGC+MEGV +EA SLA H  L KL 
Sbjct  126   IANGVGIAMAEAHLAATFNKPDFPIIDHYTYVIMGDGCNMEGVASEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +I+G+TDL  +ED+  R+EA GW+ + V++   +++A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIEGSTDLAFTEDVGKRYEAYGWHVLVVEDGNTNIDAIHKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLSKKEGTS-KAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V+T IG  S  +  S +AH       +V+  ++ L W+    PF +        + 
Sbjct  246   TMIKVRTTIGYGSPNKADSYEAHGAALGAAEVQATRESLGWE--YEPFEIPTDAMNHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E++W+     YQ +YPQEA     +    +  GWE+ LP++   D  EATR 
Sbjct  304   AIERGAKYEEDWNQLYARYQEQYPQEAATLERMHKAELPEGWESVLPKYTPEDKGEATRV  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG+ LN L+ V P LIGGSADL SSN   + G GD+ Q    + RN+R+GVREH M  I
Sbjct  364   QSGRTLNALSAVFPELIGGSADLASSNNTLIKGAGDY-QKGQYQNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+AL G GLIP+ ATFLVF+DYM+ +IRLSALS +GVIY+MTHDSI LGEDGPTHQP+
Sbjct  423   CNGLALDGSGLIPYCATFLVFTDYMRAAIRLSALSESGVIYVMTHDSIQLGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--------ANRDKPSLMALSRQKVAANMD  560
             EH+  LR IP LLV RP+DGNET+GAYKVAI         N+ +P+++ALSR     N+ 
Sbjct  483   EHVNSLRMIPDLLVMRPADGNETSGAYKVAIKAARGKKFGNKTRPTVIALSRL-AQPNLA  541

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
              TS +GV KG YI+SD+ G   P++IL+GTG E  LC ++A  LR EG++VRVVS+VCW 
Sbjct  542   NTSIEGVEKGAYILSDSDG--TPDVILMGTGSETQLCVKAAEQLRGEGKKVRVVSMVCWE  599

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             +F+ Q   Y+E VLP  V+KR+SVEAG   GW  YVGDEG+ IG+D FGAS P     +K
Sbjct  600   IFQDQDTAYRESVLPKAVKKRISVEAGVTFGWCRYVGDEGIAIGIDTFGASAPGPVCMEK  659

Query  199   YGFTEENVSKTAR  161
             +GFT ENV   A+
Sbjct  660   FGFTVENVVAKAK  672



>ref|XP_001701881.1| transketolase [Chlamydomonas reinhardtii]
 gb|EDP06856.1| transketolase [Chlamydomonas reinhardtii]
Length=718

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/661 (52%), Positives = 447/661 (68%), Gaps = 6/661 (1%)
 Frame = -3

Query  2137  RCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVLSAG  1958
             +C++ +R L +D +  +K+GH GM +G A +GY L+  VM++NP+ P +FNRDRFVLSAG
Sbjct  57    KCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFNRDRFVLSAG  116

Query  1957  HGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVANAV  1778
             HGS+ QY  +HL G+ SV +D +K+  +  S TPGHPEN +T G+EVTTGPLGQG+ NAV
Sbjct  117   HGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGHPENFVTPGVEVTTGPLGQGICNAV  176

Query  1777  GLALAEVHLASRFNKPDI-PIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLLYD  1601
             GLA+AE HLA+RFNKPD+ PIVDH TYCI+GDGC MEG++NEA SLA HW L KL  LYD
Sbjct  177   GLAVAEAHLAARFNKPDVKPIVDHYTYCILGDGCMMEGISNEACSLAGHWGLGKLIALYD  236

Query  1600  DNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTFIR  1421
             DN  +IDG TD++ +ED++ R+EALGW+ I V N   D++ L+ A+  A     KPT I+
Sbjct  237   DNKISIDGHTDISFTEDVAKRYEALGWHVIHVINGNTDVDGLRAAIAQAKAVKDKPTLIK  296

Query  1420  VKTCIGKLSKKEGTSKAHHGT-FEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQAEQ  1244
             V T IG  S  +  S   HG     D+    ++ L W  G   F V   +Y   +   ++
Sbjct  297   VSTLIGYGSPNKADSHDVHGAPLGPDETAATRKNLNWPYGE--FEVPQDVYDVFRGAIKR  354

Query  1243  GETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYSGK  1064
             G   E  WH     Y+ KYP+E  +F AL +  +   WE +LP +   D   ATR +S  
Sbjct  355   GAEEEANWHKACAEYKAKYPKEWAEFEALTSCKLPENWEAALPHFKPEDKGLATRQHSQT  414

Query  1063  CLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISNGI  884
              +N LA  +PGLIGGSADL  SN   +   GDF Q  S   RN+R+GVREHAM  I NGI
Sbjct  415   MINALAPALPGLIGGSADLAPSNLTLMKISGDF-QKGSYAERNLRFGVREHAMGAICNGI  473

Query  883   ALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEHLA  704
             ALH  GLIP+ ATF +F+DYM+N++R+SALS AGV+Y+MTHDSIGLGEDGPTHQP+EHLA
Sbjct  474   ALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVVYVMTHDSIGLGEDGPTHQPIEHLA  533

Query  703   GLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKGGY  524
               RA+P +L+ RP+ GNETAGAYKVAIANR +P+ +ALSRQ +  N+   S +GV KG Y
Sbjct  534   SFRAMPDMLMIRPAGGNETAGAYKVAIANRKRPTTIALSRQNM-PNIPNCSVEGVAKGAY  592

Query  523   IISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYKEV  344
              I D      P++IL+GTG EL L   +AG+L  EG+ VRVVS  CW LFE Q  EYKE 
Sbjct  593   TIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSFPCWELFEEQSAEYKES  652

Query  343   VLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSKTA  164
             VLPS V  RVSVEA +  GW +Y+G +G  +G+D FGAS P   +++K+G T  +V + A
Sbjct  653   VLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLYEKFGITVNHVVEAA  712

Query  163   R  161
             +
Sbjct  713   K  713



>dbj|GAL95388.1| transketolase [Microcystis aeruginosa NIES-44]
Length=668

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 464/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W     PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWQ--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D+ G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDSEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_002784465.1| Transketolase (TK) [Microcystis aeruginosa]
 emb|CCI13975.1| Transketolase (TK) [Microcystis aeruginosa PCC 9806]
Length=668

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 464/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGTTAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D+ G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDSEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSSMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_038091381.1| transketolase [Tolypothrix bouteillei]
Length=671

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/667 (52%), Positives = 458/667 (69%), Gaps = 8/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   +RFNP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFLRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV IDDLK+  + GS+TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTIDDLKQFRQWGSKTPGHPENFETPGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE H+A +FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAIAEAHIAGKFNKPDATLVDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED++ RFEA GW+   V +   D+EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDVSFTEDVNKRFEAYGWHVQHVQDGNNDLEAIAAAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             +FI++ T IG  S  K+ T+  H      D+VK  ++ L W++   PF V     +  + 
Sbjct  246   SFIKITTTIGYGSPNKQNTAGVHGAALGGDEVKLTRENLGWEH--EPFVVPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE +W+     Y+ KY ++A +F  LL+G +  GWE +LP +   D   ATR 
Sbjct  304   AVERGAQLETDWNKIWADYKAKYAEDAAEFERLLSGKLPEGWEKTLPVYKAEDKAVATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA  +P LIGGSADL  SN  YL   GDF Q      RN+R+GVREH M  I
Sbjct  364   TSEVTLNALAPALPELIGGSADLTHSNLTYLKVSGDF-QKGQYHNRNLRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDS+ LGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSEAGVIYVMTHDSLALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L+V+RP+DGNET+GAYKVA+  AN+ +P+LMA SRQ +   + G+S + 
Sbjct  483   ETLASLRAIPNLIVYRPADGNETSGAYKVAVEQANKHRPTLMAFSRQNL-PQLPGSSIEK  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
               KGGYI+ D    E P++ILI TG E+ LC E+A  LR  G++VRVVSL  W +FE QP
Sbjct  542   AAKGGYIV-DGDENETPDLILIATGSEVHLCVEAAQKLREAGKKVRVVSLPSWEIFEEQP  600

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
              +Y+E VLP  V KR++VEA S  GW  Y+G EG +I ++ FG S P     +K+G+T +
Sbjct  601   ADYRESVLPKAVTKRLAVEAASSFGWHRYLGSEGTMISVERFGVSAPGNVAMEKFGYTVD  660

Query  181   NVSKTAR  161
             NV   A+
Sbjct  661   NVLAKAK  667



>ref|WP_015162462.1| transketolase [Chamaesiphon minutus]
 ref|YP_007099906.1| transketolase [Chamaesiphon minutus PCC 6605]
 gb|AFY96379.1| transketolase [Chamaesiphon minutus PCC 6605]
Length=670

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/667 (53%), Positives = 464/667 (70%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +D+  ++++R L VD ++ AK+GH G+ +G A + Y L+++ MR+NP+ P+WFNRDRF
Sbjct  6     QSLDQLAINSIRFLAVDAIEKAKSGHPGLPMGAAPMAYVLWQNFMRYNPKNPQWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  LHL G+ SV I+D+K   + GS TPGHPEN  T GIEVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLHLTGYDSVSIEDIKNFRQWGSSTPGHPENFETAGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+++NKPD  IVDH TY I+GDGC+MEG++ EAAS+A HW L KL 
Sbjct  126   IANGVGLALAEAHLAAKYNKPDATIVDHYTYVIVGDGCNMEGISGEAASIAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
             +LYDDNH +IDG+TD+  +ED+S RFEA GW+TI V++   D+ A+  AL  A   T KP
Sbjct  186   VLYDDNHISIDGSTDVAFTEDVSKRFEAYGWHTIHVEDGNTDLAAISAALEEAKKVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K  T+  H      D+VK  ++ L W+    PF +       M+ 
Sbjct  246   TMIKVTTIIGYGSPNKCNTAGIHGAALGGDEVKLTRENLGWE--YAPFELPADAVAHMRE  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   E EW + L +Y++KYPQEA +F  LL   +  GW++ LP +   D   A+R 
Sbjct  304   AIDRGAKYEGEWEATLATYKSKYPQEAAEFEGLLTRQLPAGWDSVLPTYTPEDKPVASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+ GLIGGSADL  SN   + G GDF Q D+ + RN+ +GVREHAM  I
Sbjct  364   HSEICLNKLAPVLHGLIGGSADLTHSNLTEIKGSGDF-QKDAYQNRNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALH  GLIP+ ATFL+F+DYM+ +IRLSALS  G +++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGMALHNSGLIPYGATFLIFTDYMRAAIRLSALSQVGTLWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LRAIP L V RP+DGNET+GAYKVAI  A++  P+L+ALSRQ +  N+ GTS +G
Sbjct  483   ETIASLRAIPNLTVIRPADGNETSGAYKVAIEKASQQAPTLLALSRQNL-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y I D+ G   P+IILIGTG E+ LC  +A  L  EG++VRVVS+  W LF+ Q 
Sbjct  542   VTKGAYTIVDSQGT--PDIILIGTGSEVSLCVSAAEKLTAEGKKVRVVSMPSWELFDAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V KRV+VEA   +GW  +VG +G ++ +D FGAS P   V +KYGFT +
Sbjct  600   AAYQESVLPKAVTKRVAVEAACSMGWHRFVGMDGGLVTVDRFGASAPGGVVMEKYGFTVD  659

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  660   NVVATAK  666



>ref|WP_002748986.1| transketolase [Microcystis aeruginosa]
 emb|CAO88531.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS45025.1| transketolase [Microcystis aeruginosa DIANCHI905]
Length=668

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_007100994.1| transketolase [Synechococcus sp. RS9917]
 gb|EAQ70182.1| transketolase [Synechococcus sp. RS9917]
Length=669

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/663 (52%), Positives = 450/663 (68%), Gaps = 6/663 (1%)
 Frame = -3

Query  2146  VDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRFVL  1967
             +D  C++++RML VD V  +K+GH G+ +G A +GY L+   ++ NP+ P WFNRDRFVL
Sbjct  8     LDTLCINSIRMLAVDAVNKSKSGHPGLPMGAAPMGYTLWDKFLKHNPKNPLWFNRDRFVL  67

Query  1966  SAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQGVA  1787
             SAGHG +L Y  LHL G+ SV IDD+K+  + GS+TPGHPE   T G+EVTTGPLG G++
Sbjct  68    SAGHGCMLLYALLHLTGYDSVTIDDIKQFRQWGSKTPGHPETFETPGVEVTTGPLGAGIS  127

Query  1786  NAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLTLL  1607
             NAVGLA+AE HLA++FNKPD  +VDH TY IMGDGC+ EGV++EA SLA H KL KL  L
Sbjct  128   NAVGLAIAEAHLAAKFNKPDAKVVDHYTYVIMGDGCNQEGVSSEACSLAGHLKLGKLIAL  187

Query  1606  YDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKPTF  1427
             YDDNH TIDG TD++ +ED+  R+EA GW+   V +   D+ A+ +A+ +A   T KP+ 
Sbjct  188   YDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVADGNTDVNAIAHAIEAAKAVTDKPSI  247

Query  1426  IRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKLQA  1250
             I+V T IG  S  K  T+  H     E++ +  +++L W++  GPF V    Y + +   
Sbjct  248   IKVTTTIGYGSPNKSDTAGVHGAPLGEEEAELTRKQLGWNH--GPFEVPQEAYDQYRQAI  305

Query  1249  EQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRGYS  1070
             E+G +LE EW+  L SY++KYP EA +F  +L G +  GW+  LP +  +D   ATR +S
Sbjct  306   ERGASLEAEWNQALASYRSKYPSEAAEFERMLRGELPQGWDKDLPSYTPNDKGLATRKHS  365

Query  1069  GKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGISN  890
               CL  L   +P LIGGSADL  SN   + G     QP+SP  R + +GVREHAMA I N
Sbjct  366   QICLGALGPNLPELIGGSADLTHSNYTDIAGETGSFQPESPEKRYLHFGVREHAMAAILN  425

Query  889   GIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPVEH  710
             GIA H  GLIP+  TFLVF+DYM+ S+RLSALS  GVIY++THDSIG+GEDGPTHQP+E 
Sbjct  426   GIAYHNSGLIPYGGTFLVFADYMRGSMRLSALSELGVIYVLTHDSIGVGEDGPTHQPIET  485

Query  709   LAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVGKG  530
             +  LRA+P LLVFRP DGNET+GAYK+AI NR +PS + LSRQ + AN   +S D V  G
Sbjct  486   IPSLRAMPNLLVFRPGDGNETSGAYKLAIQNRKRPSALCLSRQAM-ANQANSSIDKVAHG  544

Query  529   GYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPREYK  350
             GYI+ D +G   PE+ILIGTG EL LC ++A  L  EG +VRVVS+ C  LF+ Q   YK
Sbjct  545   GYILEDCAGT--PELILIGTGTELDLCVQAAKQLTAEGHKVRVVSMPCVELFDEQSDAYK  602

Query  349   EVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENVSK  170
             E VLPS VRKR+ VEA    GW  +VG +G  + MD FGAS P     +K+GFT ENV  
Sbjct  603   EEVLPSAVRKRIVVEAAEAFGWHRFVGLDGATVTMDRFGASAPGGTCMEKFGFTVENVVA  662

Query  169   TAR  161
              A+
Sbjct  663   KAK  665



>ref|WP_002768496.1| transketolase [Microcystis aeruginosa]
 emb|CCI02831.1| Transketolase (TK) [Microcystis aeruginosa PCC 9443]
Length=668

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDRFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y+I+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYVITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGYVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_039715842.1| transketolase [Scytonema millei]
 gb|KIF18313.1| transketolase [Scytonema millei VB511283]
Length=676

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/673 (51%), Positives = 456/673 (68%), Gaps = 15/673 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ +R L +D V+ AK+GH G+ +G A + + L+   MRFNP+ P W NRDRF
Sbjct  6     QSLEELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPAWLNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHGS+L Y  L+L G++ + +DDLK+  +  S+TPGHPEN +  G+E+TTGPLGQG
Sbjct  66    LLSAGHGSMLLYALLYLTGYEDLTLDDLKQFRQWESKTPGHPENFMNPGVEITTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VG+A+AE HLA+ FNKPD PI+DH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANGVGIAMAEAHLAATFNKPDFPIIDHYTYVILGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TDL  +ED+  RFEA  W+   V++   +++ ++ A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDLAFTEDVGKRFEAYNWHVQVVEDGNTNLDEIQKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V+T IG  S KK  T  AH     ED+VK  ++ L W++   PF V        + 
Sbjct  246   SLIKVRTTIGYGSPKKADTRHAHGEALGEDEVKATREHLGWNH--PPFEVPEDALNHWRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   EQEW+     Y+ +YP EA+    +    + P W++ LP +   D   ATR 
Sbjct  304   AIERGAKTEQEWNQLFDRYKQQYPDEARTLERMHEAELPPNWDSVLPTYKPEDKGIATRV  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +SG CLN +A+V+P LIGGSADL  SN   L   GDF Q    + R IR+GVREH M  I
Sbjct  364   HSGNCLNAIAEVLPELIGGSADLAPSNNTLLKNSGDF-QKGQYQNRYIRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+AL G GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDSI LGEDGPTHQPV
Sbjct  423   CNGLALDGSGLIPYCATFLVFTDYMRAAIRLSALSEAGVIYVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIA--------NRDKPSLMALSRQKVAANMD  560
             EH+A LR IP L V RP+DGNET+GAYKVAI         ++ +PS++AL+RQ +  N+ 
Sbjct  483   EHMAALRVIPDLYVIRPADGNETSGAYKVAIEAAKGKRPDSKVRPSVLALTRQAL-PNLA  541

Query  559   GTSADGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWR  380
             G+S +GV KG YI+SD+ G   P+II IGTG E  LC ++A  LR EG++VRVVS+ CW 
Sbjct  542   GSSIEGVTKGAYILSDSDG--TPDIIFIGTGSETQLCVKAAEQLRGEGKKVRVVSMPCWE  599

Query  379   LFERQPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKK  200
             +FE Q  EYKE VLP  V+KRVSVEA    GW  YVG EG+ IG+D++G+S P     +K
Sbjct  600   IFEEQTPEYKESVLPKAVKKRVSVEAAVTFGWCRYVGSEGIAIGIDQYGSSAPGNVCMEK  659

Query  199   YGFTEENVSKTAR  161
             +GFT +NV   A+
Sbjct  660   FGFTVDNVLAKAK  672



>ref|WP_015224632.1| transketolase [Halothece sp. PCC 7418]
 ref|YP_007166968.1| transketolase [Halothece sp. PCC 7418]
 gb|AFZ42754.1| transketolase [Halothece sp. PCC 7418]
Length=701

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/669 (53%), Positives = 460/669 (69%), Gaps = 11/669 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D V+ A +GH G+ +G A + + L+   +RFNP+ P WFNRDRF
Sbjct  35    QSLEQLCINSIRFLAIDAVEKASSGHPGLPMGAAPMAFVLWDKFLRFNPKNPHWFNRDRF  94

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV +DD+K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  95    VLSAGHGCMLQYALLYLTGYDSVSLDDIKQFRQWESKTPGHPENFMTEGVEVTTGPLGQG  154

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             ++NAVGLA AE HLA+RFNKPD  IVDH TY I  DG  MEGV+NEA SLA H  L KL 
Sbjct  155   ISNAVGLAAAEAHLAARFNKPDCQIVDHYTYVIASDGDLMEGVSNEACSLAGHLGLGKLI  214

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG T+L+ +ED   R+EALGW+T  +++   D+E L+ A+ +A   T KP
Sbjct  215   ALYDDNHISIDGETELSFTEDRMKRYEALGWHTQVIEDGNTDLEGLEKAIANAKAVTDKP  274

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I V+T IG  S  K  T   H     +D+V   +++L W+ G   F V        + 
Sbjct  275   SIIGVRTVIGFGSPNKANTHDVHGAALGKDEVAATRKELGWEYGE--FEVPEDALSHFRK  332

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G   EQEW+     Y+ KYP++AK    L++G +  GWE +LP +   D  +ATR 
Sbjct  333   AVDRGAQSEQEWNQLFAEYKGKYPEDAKNLQQLISGELPAGWEDALPTYTPDDKADATRN  392

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN L+ V+PGL+GGSADL  SN+ Y+   GDF Q  +   RN R+GVREH M  I
Sbjct  393   QSGAVLNALSPVLPGLVGGSADLAPSNKTYVKSSGDF-QKGAYENRNFRFGVREHGMGAI  451

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              N +ALH  GLIP+ ATFL+F+DYM+ +IRLSALS AGVI++MTHDSIG+GEDGPTHQP+
Sbjct  452   CNAMALHNSGLIPYGATFLIFTDYMRGAIRLSALSRAGVIWVMTHDSIGVGEDGPTHQPI  511

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI----ANRDKPSLMALSRQKVAANMDGTSA  548
             E +A LRAIP L VFRP+DGNET+GAYKVA+     N   P+L+ALSRQK+  N+ G+S 
Sbjct  512   EQVASLRAIPELAVFRPADGNETSGAYKVAVERAAGNPHAPTLLALSRQKL-PNLQGSSI  570

Query  547   DGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFER  368
             +   KGGY++SD++G   PE+ILIGTG E+ LC  +A  LR EG+ VRVVS+ CW LFE 
Sbjct  571   EKAAKGGYVLSDSNG--TPELILIGTGSEVELCVNAAEQLRQEGKNVRVVSMPCWELFEE  628

Query  367   QPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFT  188
             Q   YKE VLP  V KRV+VEAG+  GW  YVG EG VIG+D FGAS P     K +GFT
Sbjct  629   QDAGYKESVLPQVVTKRVAVEAGTTFGWCRYVGAEGEVIGIDHFGASSPGGVAMKNFGFT  688

Query  187   EENVSKTAR  161
              ENV +TA+
Sbjct  689   TENVVETAK  697



>ref|WP_002754495.1| transketolase [Microcystis aeruginosa]
 emb|CCH92948.1| Transketolase (TK) [Microcystis aeruginosa PCC 9432]
Length=668

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_002775984.1| transketolase [Microcystis aeruginosa]
 emb|CCI06396.1| Transketolase (TK) [Microcystis aeruginosa PCC 7941]
Length=668

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 463/665 (70%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGTTAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTLDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_015200504.1| transketolase [Calothrix parietina]
 ref|YP_007139865.1| transketolase [Calothrix sp. PCC 6303]
 gb|AFZ03893.1| transketolase [Calothrix sp. PCC 6303]
Length=670

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/667 (52%), Positives = 454/667 (68%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MR NP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRMNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  LHLAG+ SV I+ +K+  + GS TPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLHLAGYDSVTIEGIKQFRQWGSETPGHPENFETAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEG++ EA S A H  L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDATIVDHYTYVILGDGCNMEGISGEACSFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+ A+++A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVEDGNNDLAAIESAIAEAKKVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+++  +  L W     PF + P     M+ 
Sbjct  246   SMIKVTTTIGYGSPNKANTAGVHGAALGGDEIELTRNNLNWQ--YPPFELPPDAVNHMRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G T E EW+  L  Y  KYPQEA +F   ++G +  GW+  LP +  +D    TR 
Sbjct  304   AVERGATAEAEWNQALAEYTAKYPQEAAEFARFVSGKLPDGWDKVLPTYTPADKALPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA+V+P LIGGSADL  SN   + G+GDF++      RN+ +GVREH M  I
Sbjct  364   HSETCLNKLAQVLPELIGGSADLTHSNLTEIKGFGDFQKGQYAN-RNVHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSLAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DG ET+GAYKVAI  +    P+L+A SRQ +  N+ G+S +G
Sbjct  483   ETLASLRAIPNLTVIRPADGTETSGAYKVAIESSKAGNPTLLAFSRQNL-PNLAGSSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGYI+ D+ G   P+IILIGTG E+ LC  +A  L  EG++VRVVS+    LF+ Q 
Sbjct  542   VTKGGYILVDSQGT--PDIILIGTGSEVSLCVTAAEKLTAEGKKVRVVSMPSTDLFDAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V KRVSVEA    GW +Y+G EGV + +D FGAS P     +K+GF+ E
Sbjct  600   AAYRESVLPKAVTKRVSVEAACSFGWHKYIGTEGVAVSIDRFGASAPGNICLEKFGFSVE  659

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  660   NVFATAK  666



>ref|WP_029635364.1| transketolase [[Scytonema hofmanni] UTEX B 1581]
Length=670

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/669 (52%), Positives = 453/669 (68%), Gaps = 13/669 (2%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+L Y  L+L GF SV I+D+K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLLYALLYLTGFDSVSIEDIKQFRQWESKTPGHPENFMTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+ E HLA++FNKPD  IVDH TY I+GDGC+MEG++ EA S A H  L KL 
Sbjct  126   IANAVGLAMTEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGISGEACSFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V++   D+ A++ A+  A + T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVEDGNTDLVAIEKAIAEAKSVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K+ T+  H      D++   +  L W     PF V       M  
Sbjct  246   TMIKVTTTIGYGSPNKQNTAGIHGAALGGDEIALTRNNLEWT--YEPFVVPEDAKNHMGK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW++    Y+ KY +EA QF   ++G +  GW+  LP +   D    TR 
Sbjct  304   AVERGANYETEWNNTFADYKAKYAEEAAQFERYISGKLPDGWDKVLPTYTSEDKGLPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFE--QPDSPRGRNIRYGVREHAMA  902
             +S  CLN LAKV+P LIGGSADL  SN   + G GDF+  Q ++P   NI +GVREHAM 
Sbjct  364   HSENCLNKLAKVLPELIGGSADLTHSNLTEIKGTGDFQKGQYENP---NIHFGVREHAMG  420

Query  901   GISNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQ  722
              I NGIALH  GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQ
Sbjct  421   AICNGIALHQSGLIPYGATFLIFTDYMRAAIRLSALSRAGSIWVMTHDSIGQGEDGPTHQ  480

Query  721   PVEHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSA  548
             P+E LA LRAIP L V RP+DGNE +GAYKVAI  +  + P+L+A +RQ V  N+ GTS 
Sbjct  481   PIETLASLRAIPNLTVIRPADGNECSGAYKVAIEKSKENAPTLLAFTRQAV-PNLTGTSI  539

Query  547   DGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFER  368
             +GV KG Y + D+ G   PE+ILIGTG EL LC  +A  L +EG++VRVVS+  W LFE 
Sbjct  540   EGVTKGAYTVVDSQG--TPELILIGTGSELSLCVTAAEKLTSEGKKVRVVSMPSWELFEA  597

Query  367   QPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFT  188
             Q   YKE +LP  V KRVSVEA +  GW +YVG EG  + +D FGAS P     +K+GF+
Sbjct  598   QDAAYKESILPKAVTKRVSVEAAASFGWHKYVGMEGGCVSIDTFGASAPGGVCMEKFGFS  657

Query  187   EENVSKTAR  161
              ENV  TA+
Sbjct  658   VENVLATAK  666



>ref|WP_015113532.1| transketolase [Nostoc sp. PCC 7107]
 ref|YP_007050469.1| transketolase [Nostoc sp. PCC 7107]
 gb|AFY43319.1| transketolase [Nostoc sp. PCC 7107]
Length=670

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/667 (52%), Positives = 450/667 (67%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD ++ AK+GH G+ +G A + + L+   MR+NP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAVDAIEKAKSGHPGLPMGAAPMAFVLWDRFMRYNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHGS+LQY  L+L G+ SV I+D+K+  +  S+TPGHPEN +T G+EVTTGPLGQG
Sbjct  66    VLSAGHGSMLQYALLYLTGYDSVSIEDIKQFRQWESKTPGHPENFMTAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EAAS A H  L KL 
Sbjct  126   IANGVGLAIAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEAASFAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D+EA+  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLEAIHKAIAEAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T+  H      D+V   ++ L W++   PF +   +    + 
Sbjct  246   SMIKVTTTIGFGSPNKANTAGIHGAALGGDEVALTRKNLGWEH--EPFVIPQDVLNHTRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E EW+     Y+ KYPQEA +F   L+G +  GW+  LP +   D    TR 
Sbjct  304   AVERGAGYETEWNKTFADYKAKYPQEAAEFERYLSGKLADGWDKVLPTYTPEDKGLPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN +A  +P LIGGSADL  SN   + G GDF Q    +  NI +GVREHAM  I
Sbjct  364   HSETCLNKIAAALPELIGGSADLTHSNLTEIKGKGDF-QKGQYQNPNIHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQP+
Sbjct  423   CNGIALHGSGLIPYGATFLIFTDYMRAAIRLSALSQAGSIWVMTHDSIGQGEDGPTHQPI  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNET+GAYKVAI  + ++ P+L+  SRQ +  N+ GTS +G
Sbjct  483   ETLASLRAIPNLTVIRPADGNETSGAYKVAIERSKQNDPTLLVFSRQNL-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KGGY + D+ G   PE+I+IGTG EL L   +A  L  EG++VRVVSL  W LFE Q 
Sbjct  542   VTKGGYTVVDSEGT--PELIIIGTGSELSLAVTAAEKLIAEGKKVRVVSLAAWDLFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KR+ VEA S  GW +Y+G EG  + +D FGAS P     +K+GF+ +
Sbjct  600   AAYKESVLPKAVNKRLVVEAASSFGWHKYIGTEGDTVTIDRFGASAPGGVCLEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_008203199.1| transketolase [Microcystis sp. T1-4]
 emb|CCI33086.1| Transketolase (TK) [Microcystis sp. T1-4]
Length=668

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 462/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_004159434.1| transketolase [Microcystis aeruginosa]
 emb|CCH98487.1| Transketolase (TK) [Microcystis aeruginosa PCC 9717]
Length=668

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/665 (53%), Positives = 462/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W     PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWQ--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS +GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLEGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y I+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYTITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_002789441.1| transketolase [Microcystis aeruginosa]
 emb|CCI19429.1| Transketolase (TK) [Microcystis aeruginosa PCC 9807]
Length=668

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/665 (53%), Positives = 462/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W     PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWQ--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGTTAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++ + +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSEKKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG Y+I+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYVITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT +NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTLDNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_035156135.1| transketolase [Calothrix sp. 336/3]
 gb|KFB85157.1| transketolase [Calothrix sp. 336/3]
Length=670

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/667 (53%), Positives = 448/667 (67%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A + + L+   MRFNP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLFDQFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  L+L G+ SV I+D+K+  +  SRTPGHPEN  T G+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLYLTGYDSVTIEDIKQFRQWNSRTPGHPENFETAGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA++FNKPD  IVDH TY I+GDGC+MEGV+ EA SLA H+ L KL 
Sbjct  126   IANAVGLAMAEAHLAAKFNKPDATIVDHYTYVILGDGCNMEGVSGEACSLAGHYGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V     D+ A+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVPEGNTDLAAIAKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             T I+V T IG  S  K+ T+  H      D++   +Q L W+    PF V   +   M  
Sbjct  246   TMIKVTTTIGYGSPNKQNTAGVHGAALGADEIALTRQNLNWE--YEPFVVPQDVLSHMGK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G + E EW+     Y+ KY  +A  F  L++G +  GW+  LP +   D    TR 
Sbjct  304   AVERGASYEAEWNKTYADYKAKYADDAAVFERLVSGKLPDGWDKVLPTYTAEDKALPTRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+P LIGGSADL  SN   + GYGDF Q    + RN+ +GVREHAM  I
Sbjct  364   HSETCLNKLAAVLPELIGGSADLTHSNLTEIKGYGDF-QKGQYQNRNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ +IRLSALS AG I++MTHDSIG GEDGPTHQPV
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSQAGSIWVMTHDSIGQGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DG E +GAYKVAI  A  + PSL+A SRQ +  N+ GTS +G
Sbjct  483   ETLASLRAIPNLTVLRPADGTECSGAYKVAIARAKENAPSLLAFSRQNL-PNLAGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y + D  G   P+IILIGTG EL LC  +A  L  EG++VRVVS+    LFE Q 
Sbjct  542   VTKGAYAVVDCQGT--PDIILIGTGSELSLCVTAAEKLTAEGKKVRVVSMPSVDLFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               Y+E VLP  V KRVSVEAG   GW +Y+G EG  + +D FGAS P     +K+GFT E
Sbjct  600   AAYQESVLPKAVTKRVSVEAGVSFGWHKYIGIEGATVSIDRFGASAPGGTCMEKFGFTVE  659

Query  181   NVSKTAR  161
             NV  TA+
Sbjct  660   NVLATAK  666



>ref|WP_023067697.1| transketolase [Lyngbya aestuarii]
 gb|ERT06060.1| transketolase [Lyngbya aestuarii BL J]
Length=673

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/669 (53%), Positives = 457/669 (68%), Gaps = 10/669 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + +++ C++++R L +D VQ A +GH G+ +G A + + L+   M+FNP+ P WFNRDRF
Sbjct  6     QSLEQLCINSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDRFMQFNPKNPTWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +L Y  LHL G+ SV +D++K+  +  S+TPGHPEN +T GIEVTTGPLGQG
Sbjct  66    VLSAGHGCMLLYSLLHLTGYDSVPLDEIKQFRQWDSKTPGHPENHVTSGIEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLALAE HLA+ FNKPD  +VDH TY IMGDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANAVGLALAEAHLAATFNKPDCQLVDHYTYVIMGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
               YDDNH +IDG TD++ +ED++ARFEA GW+   V +   D+E +  A+  A   T KP
Sbjct  186   AFYDDNHISIDGHTDISFTEDVAARFEAYGWHVQHVTDGNTDLEGIAAAIQKAKEVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K  T   H     +D+V+  ++ L W+     F +        + 
Sbjct  246   SLIKVTTIIGYGSPNKADTHDVHGAALGKDEVQATREHLGWEYPE--FEIPEDALNHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T EQEW+  L  Y++KYPQEA  F  +L+G +  GW  +LP++      +ATR 
Sbjct  304   AIDKGATAEQEWNKTLDQYKSKYPQEAATFERMLSGKLPEGWADALPKYTPESKADATRN  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              SG  LN LA V+P LIGGSADL  SN+  L G GDF Q  S + RN+R+GVREH M  I
Sbjct  364   QSGATLNALASVLPELIGGSADLAPSNKTLLKGLGDF-QKGSYQNRNVRFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIA HG GLIP+ ATFLVF+DYM+NSIRLSAL+  GVI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIARHGSGLIPYGATFLVFTDYMRNSIRLSALAETGVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI----ANRDKPSLMALSRQKVAANMDGTSA  548
             EH+  LRAIP+L+V RP+DGNET+GAYKVA+    A     +L+A SRQ +  N++G+S 
Sbjct  483   EHIMSLRAIPQLIVIRPADGNETSGAYKVAVEKAKAAHPAATLLAFSRQNL-PNLEGSSI  541

Query  547   DGVGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFER  368
             D V KG YI+SDNS +  P+IILIGTG E   C E+A  LR EG++VRVVS+  W LFE 
Sbjct  542   DVVAKGAYILSDNS-DGTPDIILIGTGGETYQCVEAAVKLREEGKKVRVVSMPSWELFEE  600

Query  367   QPREYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFT  188
             Q   YKE V P  V+KR++VEAG  LGW  YV DEG  I +D FGAS P   V +K+GFT
Sbjct  601   QDAAYKESVFPKGVKKRLAVEAGISLGWCRYVTDEGATISVDTFGASAPGEVVLEKFGFT  660

Query  187   EENVSKTAR  161
              +N+   A+
Sbjct  661   VDNIVAQAK  669



>ref|WP_004162374.1| transketolase [Microcystis aeruginosa]
 emb|CCI26900.1| Transketolase (TK) [Microcystis aeruginosa PCC 9808]
Length=668

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/665 (53%), Positives = 461/665 (69%), Gaps = 7/665 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++ VR L VD V+ AK+GH G+ +G A + + L+   +RFNP+ P+W NRDRF
Sbjct  6     QSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWVNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  ++L G+ SV ++++K+  +  S+TPGHPEN +TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+RFNKPD  I+DH TY I+GDGC+MEG++ EA SLA HW L KL 
Sbjct  126   IANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+   V+N   D++A+ NA+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I++ T IG  S  K  T+  H       +++  ++ L W+    PF V   +    + 
Sbjct  246   SMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWE--YEPFVVPDEVLNRFRQ  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               ++G T E +W+     YQ KYP EA  F  L  G +  GWE +LP +   D   A+R 
Sbjct  304   AVDKGTTAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALASRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S  CLN LA V+PGLIGGSADL  SN   L  +G+F Q  S + RN+ +GVREHAM  I
Sbjct  364   HSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNF-QKGSYQERNVHFGVREHAMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALH  GLIP+ ATFL+F+DYM+NSIRLSALS   VI++MTHDSI LGEDGPTHQPV
Sbjct  423   CNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAIANRDKPSLMALSRQKVAANMDGTSADGVG  536
             EH+A LRAIP LLV RP DG ET+GAYKVA++   +P+L+ALSRQ +  N+ GTS  GV 
Sbjct  483   EHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNL-PNLAGTSLAGVA  541

Query  535   KGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQPRE  356
             KG YII+D  G   P++ILIGTG EL LC+++A VL+  G + RVVS+ CW LFE Q  E
Sbjct  542   KGAYIITDCEGT--PDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAE  599

Query  355   YKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEENV  176
             YKE VLP  V+KR++VEAGS +GW  Y+ DEG V+G+D FGAS P   + +K+GFT  NV
Sbjct  600   YKESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVNNV  659

Query  175   SKTAR  161
                A+
Sbjct  660   VAKAK  664



>ref|WP_009543323.1| MULTISPECIES: transketolase [Cyanothece]
 ref|YP_001806041.1| transketolase [Cyanothece sp. ATCC 51142]
 gb|ACB53975.1| transketolase [Cyanothece sp. ATCC 51142]
Length=670

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/667 (54%), Positives = 449/667 (67%), Gaps = 9/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L VD V+ AK+GH G+ +G A + Y L+   MRFNP+ PKWFNRDRF
Sbjct  6     QSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAYVLWDKFMRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             +LSAGHG +LQY  L+L G+ SV I+D+K+  + GS+TPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    ILSAGHGCMLQYALLYLTGYDSVTIEDIKQFRQWGSKTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +AN VGLALAE HLA+ FNKPD  IVDH TY I+GDGC+MEGV +EA S A HW L KL 
Sbjct  126   IANGVGLALAEAHLAATFNKPDATIVDHYTYVILGDGCNMEGVASEACSAAGHWGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD+  +ED+S RFEA GW+ + V+N   D++ +  A+  A   T KP
Sbjct  186   ALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLDGIAKAIEEAKKVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             + I+V T IG  S  K+ T+  H      D+V   +  L WD+   PF V   +   M  
Sbjct  246   SMIKVTTTIGYGSPNKQNTAGVHGAALGPDEVALTRHNLGWDH--EPFVVPQDVLSHMNK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G   E+EW+    +Y+ KYP EA +F   L+G +  GWE  LP +   D   ATR 
Sbjct  304   AIERGANYEEEWNKAFETYKAKYPAEAAEFERYLSGQLREGWEKELPTFTPDDAANATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
             +S   LN LA V+P LIGGSADL  SN   L   GDF Q      RN+ +GVREH M  I
Sbjct  364   HSAAILNKLAPVIPELIGGSADLTHSNLTELKVSGDF-QKGQYGNRNVHFGVREHGMGAI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NG+ALHG GLIP+ ATFL+F+DYM+ SIRLSALS AGVI++MTHDSIG GEDGPTHQPV
Sbjct  423   CNGMALHGSGLIPYGATFLIFTDYMRASIRLSALSQAGVIWVMTHDSIGQGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E LA LRAIP L V RP+DGNE +GAYK+AI  A ++ P+LMA +RQ V  N+ GTS +G
Sbjct  483   EVLASLRAIPNLTVIRPADGNECSGAYKIAIEKAKQNAPTLMAFTRQNV-PNLPGTSIEG  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
             V KG Y I D  G   P+IILIGTG E+ LC  +A  L  EG++VRVVS+  W LFE Q 
Sbjct  542   VTKGAYTIVDCDG--TPDIILIGTGSEVSLCVTAAEKLTAEGKKVRVVSMPSWELFEAQD  599

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
               YKE VLP  V KRVSVEAG   GW +YVG EG  + +D FGAS P     +K+GF+ +
Sbjct  600   EAYKESVLPKAVTKRVSVEAGVSFGWAKYVGTEGDTVSIDTFGASAPGATCMEKFGFSVD  659

Query  181   NVSKTAR  161
             NV   A+
Sbjct  660   NVLAKAK  666



>ref|WP_017739732.1| transketolase [Scytonema hofmanni]
Length=671

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/667 (52%), Positives = 457/667 (69%), Gaps = 8/667 (1%)
 Frame = -3

Query  2152  EMVDRRCVDNVRMLIVDCVQHAKAGHGGMALGLAEVGYFLYRHVMRFNPQTPKWFNRDRF  1973
             + ++  C++++R L +D V+ AK+GH G+ +G A + + L+   +RFNP+ PKWFNRDRF
Sbjct  6     QTLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFLRFNPKNPKWFNRDRF  65

Query  1972  VLSAGHGSLLQYVCLHLAGFQSVQIDDLKRLCKLGSRTPGHPENVITEGIEVTTGPLGQG  1793
             VLSAGHG +LQY  LHL G+ SV IDD+K+  + GS+TPGHPEN  TEG+EVTTGPLGQG
Sbjct  66    VLSAGHGCMLQYALLHLTGYDSVTIDDIKQFRQWGSKTPGHPENFETEGVEVTTGPLGQG  125

Query  1792  VANAVGLALAEVHLASRFNKPDIPIVDHRTYCIMGDGCSMEGVTNEAASLAAHWKLNKLT  1613
             +ANAVGLA+AE HLA +FNKPD  +VDH TY I+GDGC+MEGV+ EA SLA H  L KL 
Sbjct  126   IANAVGLAIAEAHLAGKFNKPDTTLVDHYTYVIVGDGCNMEGVSGEACSLAGHLGLGKLI  185

Query  1612  LLYDDNHNTIDGTTDLTVSEDISARFEALGWNTITVDNTQGDMEALKNALNSAHTETQKP  1433
              LYDDNH +IDG+TD++ +ED+  RFEA GW+   V +   D+EA+  A+ +A   T KP
Sbjct  186   ALYDDNHISIDGSTDVSFTEDVGKRFEAYGWHVQHVQDGNSDLEAIAKAIEAAKAVTDKP  245

Query  1432  TFIRVKTCIGKLS-KKEGTSKAHHGTFEEDDVKQMKQKLRWDNGRGPFHVIPMLYREMKL  1256
             +FI++ T IG  S  K+ T+  H      D++K  ++ L W++   PF V     +  + 
Sbjct  246   SFIKITTTIGYGSPNKQNTAGVHGAALGADEIKLTRENLGWEH--EPFVVPEDALKHFRK  303

Query  1255  QAEQGETLEQEWHSKLYSYQNKYPQEAKQFIALLNGGIVPGWETSLPRWLMSDPVEATRG  1076
               E+G  LE +W+     Y+ KY ++A +F  LL+  +  GWE +LP +   D   ATR 
Sbjct  304   AVERGAQLETDWNKIWADYKAKYAEDAAEFERLLSNKLPEGWEKTLPIYKAEDKAVATRK  363

Query  1075  YSGKCLNHLAKVVPGLIGGSADLVSSNQAYLHGYGDFEQPDSPRGRNIRYGVREHAMAGI  896
              S   LN LA  +P LIGGSADL  SN  YL   GDF Q      RN+R+GVREH M  I
Sbjct  364   TSEVTLNALAPALPELIGGSADLTHSNLTYLKVSGDF-QKGQYHNRNLRFGVREHGMGSI  422

Query  895   SNGIALHGGGLIPFAATFLVFSDYMKNSIRLSALSHAGVIYIMTHDSIGLGEDGPTHQPV  716
              NGIALHG GLIP+ ATFLVF+DYM+ +IRLSALS AGVIY+MTHDS+ LGEDGPTHQPV
Sbjct  423   CNGIALHGSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSLALGEDGPTHQPV  482

Query  715   EHLAGLRAIPRLLVFRPSDGNETAGAYKVAI--ANRDKPSLMALSRQKVAANMDGTSADG  542
             E +A LRAIP L+V+RP+DGNET+GAYKVA+  AN+ +P+L+A SRQ +   + G+S + 
Sbjct  483   ETIASLRAIPNLIVYRPADGNETSGAYKVAVEQANQHRPTLLAFSRQNL-PQLPGSSIEK  541

Query  541   VGKGGYIISDNSGEELPEIILIGTGWELCLCEESAGVLRNEGRRVRVVSLVCWRLFERQP  362
               KGGYI+ D    E P+IILIGTG E+ LC E+A  LR  G++VRVVSL  W +FE QP
Sbjct  542   TAKGGYIV-DGDENETPDIILIGTGSEVHLCVEAAQKLREAGKKVRVVSLPSWEIFEEQP  600

Query  361   REYKEVVLPSTVRKRVSVEAGSPLGWREYVGDEGVVIGMDEFGASGPDTHVFKKYGFTEE  182
              +Y+E VLP  + KR++VEA S  GW  Y+  EG +I ++ FG S P     +K+G+T +
Sbjct  601   ADYRESVLPKAITKRLAVEAASSFGWARYLSSEGAMISVERFGVSAPGGIAMEKFGYTVD  660

Query  181   NVSKTAR  161
             NV   A+
Sbjct  661   NVLAKAK  667



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7748493778112