BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13675_g1_i1 len=1132 path=[1:0-330 332:331-1131]

Length=1132
                                                                      Score     E

gb|KDO65126.1|  hypothetical protein CISIN_1g0004211mg                  707   0.0     
gb|KDO65123.1|  hypothetical protein CISIN_1g0004211mg                  706   0.0     
ref|XP_008337784.1|  PREDICTED: myosin-17-like                          716   0.0     
emb|CDP03119.1|  unnamed protein product                                738   0.0     
ref|XP_009801396.1|  PREDICTED: myosin-17-like                          732   0.0     
gb|ABJ53199.1|  myosin XI-K                                             732   0.0     Nicotiana benthamiana
ref|XP_006451554.1|  hypothetical protein CICLE_v10007325mg             716   0.0     
dbj|BAD72949.1|  myosin XI                                              731   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009588032.1|  PREDICTED: myosin-17-like                          731   0.0     
ref|XP_004144013.1|  PREDICTED: unconventional myosin-Va-like           729   0.0     
gb|KDP33878.1|  hypothetical protein JCGZ_07449                         730   0.0     
gb|EYU28356.1|  hypothetical protein MIMGU_mgv1a0001592mg               728   0.0     
gb|KGN66272.1|  hypothetical protein Csa_1G590280                       728   0.0     
ref|XP_010324023.1|  PREDICTED: myosin-17-like                          728   0.0     
ref|XP_008450897.1|  PREDICTED: myosin-17-like                          727   0.0     
ref|XP_010654512.1|  PREDICTED: myosin-17-like isoform X2               726   0.0     
ref|XP_010261996.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-17-like     724   0.0     
ref|XP_010654510.1|  PREDICTED: myosin-17-like isoform X1               726   0.0     
ref|XP_010656157.1|  PREDICTED: myosin-17-like isoform X2               723   0.0     
ref|XP_006342344.1|  PREDICTED: myosin-17-like                          724   0.0     
ref|XP_007203980.1|  hypothetical protein PRUPE_ppa000198mg             723   0.0     
ref|XP_007203981.1|  hypothetical protein PRUPE_ppa000198mg             723   0.0     
ref|XP_008242188.1|  PREDICTED: myosin-17-like                          724   0.0     
gb|KDO43963.1|  hypothetical protein CISIN_1g000420mg                   721   0.0     
gb|KDO43964.1|  hypothetical protein CISIN_1g000420mg                   721   0.0     
emb|CBI35925.3|  unnamed protein product                                725   0.0     
gb|KDO43958.1|  hypothetical protein CISIN_1g000420mg                   722   0.0     
gb|KDO43959.1|  hypothetical protein CISIN_1g000420mg                   722   0.0     
ref|XP_010656156.1|  PREDICTED: myosin-17-like isoform X1               722   0.0     
ref|XP_007154613.1|  hypothetical protein PHAVU_003G133500g             722   0.0     
gb|AAB71527.1|  unconventional myosin                                   714   0.0     Helianthus annuus
gb|KDO43961.1|  hypothetical protein CISIN_1g000420mg                   721   0.0     
ref|XP_006475526.1|  PREDICTED: myosin-17-like isoform X4               719   0.0     
emb|CBI27864.3|  unnamed protein product                                722   0.0     
gb|KDO43960.1|  hypothetical protein CISIN_1g000420mg                   721   0.0     
ref|XP_008352378.1|  PREDICTED: myosin-17-like                          721   0.0     
ref|XP_009340465.1|  PREDICTED: myosin-17-like                          720   0.0     
ref|XP_006475525.1|  PREDICTED: myosin-17-like isoform X3               719   0.0     
ref|XP_006475523.1|  PREDICTED: myosin-17-like isoform X1               719   0.0     
ref|XP_006400612.1|  hypothetical protein EUTSA_v10012431mg             719   0.0     
gb|KFK26281.1|  hypothetical protein AALP_AA8G226900                    718   0.0     
ref|XP_009131798.1|  PREDICTED: myosin-17-like                          718   0.0     
emb|CDY66597.1|  BnaCnng51610D                                          717   0.0     
ref|XP_007024565.1|  Myosin family protein with Dil domain isoform 3    716   0.0     
ref|XP_002309201.1|  hypothetical protein POPTR_0006s14790g             717   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007024564.1|  Myosin family protein with Dil domain isoform 2    717   0.0     
ref|XP_007024563.1|  Myosin family protein with Dil domain isoform 1    717   0.0     
ref|XP_009361663.1|  PREDICTED: myosin-17-like                          717   0.0     
ref|XP_010535820.1|  PREDICTED: myosin-17                               717   0.0     
emb|CDX70927.1|  BnaC03g10110D                                          717   0.0     
gb|KHN07928.1|  Myosin-J heavy chain                                    717   0.0     
ref|XP_009126449.1|  PREDICTED: myosin-17                               717   0.0     
ref|XP_006593940.1|  PREDICTED: myosin-17-like                          716   0.0     
emb|CDY45087.1|  BnaA02g04890D                                          717   0.0     
ref|XP_008776054.1|  PREDICTED: myosin-17-like                          716   0.0     
ref|XP_011045952.1|  PREDICTED: myosin-17-like                          716   0.0     
ref|XP_008388505.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-17-like     716   0.0     
ref|XP_010937148.1|  PREDICTED: myosin-17-like                          715   0.0     
ref|XP_006600449.1|  PREDICTED: myosin-17-like                          715   0.0     
ref|XP_002514087.1|  myosin XI, putative                                715   0.0     Ricinus communis
ref|XP_010049440.1|  PREDICTED: myosin-17-like                          715   0.0     
gb|KCW82027.1|  hypothetical protein EUGRSUZ_C03404                     715   0.0     
ref|XP_010090105.1|  Myosin-J heavy chain                               715   0.0     
ref|XP_004507972.1|  PREDICTED: unconventional myosin-Va-like           714   0.0     
gb|KCW82028.1|  hypothetical protein EUGRSUZ_C03404                     714   0.0     
gb|AAB71529.1|  unconventional myosin                                   713   0.0     Helianthus annuus
ref|XP_011007728.1|  PREDICTED: myosin-17-like isoform X1               713   0.0     
ref|XP_011007729.1|  PREDICTED: myosin-17-like isoform X2               713   0.0     
ref|XP_004287596.1|  PREDICTED: unconventional myosin-Vb-like           713   0.0     
gb|KEH32467.1|  DIL domain myosin family protein                        712   0.0     
ref|XP_006369283.1|  plant myosin MYS1 family protein                   712   0.0     
emb|CDY51846.1|  BnaA03g56130D                                          713   0.0     
ref|XP_010925047.1|  PREDICTED: myosin-17-like isoform X3               710   0.0     
gb|KHF99916.1|  Myosin-J heavy chain                                    710   0.0     
ref|XP_010925048.1|  PREDICTED: myosin-17-like isoform X4               710   0.0     
ref|XP_006286886.1|  hypothetical protein CARUB_v10000031mg             710   0.0     
ref|XP_010925046.1|  PREDICTED: myosin-17-like isoform X2               710   0.0     
ref|XP_010925045.1|  PREDICTED: myosin-17-like isoform X1               710   0.0     
ref|XP_007012726.1|  Myosin family protein with Dil domain isoform 3    704   0.0     
ref|XP_010537575.1|  PREDICTED: myosin-5                                707   0.0     
ref|XP_007012725.1|  Myosin family protein with Dil domain isoform 2    703   0.0     
ref|XP_006843171.1|  hypothetical protein AMTR_s00146p00059560          709   0.0     
ref|NP_001154724.1|  Myosin XI K                                        706   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420885.1|  PREDICTED: myosin-17 isoform X1                    706   0.0     
gb|KHG24999.1|  Myosin-J heavy chain                                    708   0.0     
ref|XP_010033758.1|  PREDICTED: myosin-17 isoform X1                    706   0.0     
ref|XP_010493154.1|  PREDICTED: myosin-17-like                          706   0.0     
ref|XP_008808271.1|  PREDICTED: myosin-17-like                          705   0.0     
ref|XP_010454349.1|  PREDICTED: myosin-17-like                          704   0.0     
sp|F4K5J1.2|MYO17_ARATH  RecName: Full=Myosin-17; AltName: Full=M...    704   0.0     
ref|NP_197549.3|  Myosin XI K                                           704   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHG16924.1|  Myosin-J heavy chain                                    702   0.0     
ref|XP_007012724.1|  Myosin family protein with Dil domain isoform 1    703   0.0     
ref|XP_002873998.1|  predicted protein                                  702   0.0     
gb|KHG19111.1|  Myosin-J heavy chain                                    701   0.0     
ref|XP_004969407.1|  PREDICTED: unconventional myosin-Vb-like iso...    698   0.0     
ref|XP_004969408.1|  PREDICTED: unconventional myosin-Vb-like iso...    697   0.0     
ref|XP_010685344.1|  PREDICTED: myosin-17-like                          697   0.0     
ref|XP_009400528.1|  PREDICTED: myosin-17-like                          696   0.0     
gb|EMS54666.1|  Myosin-2 heavy chain                                    663   0.0     
ref|XP_006844844.1|  hypothetical protein AMTR_s00058p00085120          695   0.0     
gb|KDO65127.1|  hypothetical protein CISIN_1g0004211mg                  654   0.0     
tpg|DAA58705.1|  TPA: hypothetical protein ZEAMMB73_629283              691   0.0     
ref|XP_002458046.1|  hypothetical protein SORBIDRAFT_03g026110          691   0.0     Sorghum bicolor [broomcorn]
emb|CDX91798.1|  BnaC08g07170D                                          656   0.0     
ref|XP_010087698.1|  Myosin-J heavy chain                               690   0.0     
ref|XP_010696561.1|  PREDICTED: myosin-17-like                          689   0.0     
ref|XP_004170464.1|  PREDICTED: myosin-2 heavy chain-like               655   0.0     
ref|XP_006416687.1|  hypothetical protein EUTSA_v10006551mg             685   0.0     
ref|XP_009415341.1|  PREDICTED: myosin-17-like isoform X2               685   0.0     
ref|XP_009415340.1|  PREDICTED: myosin-17-like isoform X1               685   0.0     
ref|NP_001104925.1|  myosin1                                            685   0.0     Zea mays [maize]
gb|KGN44700.1|  hypothetical protein Csa_7G372940                       651   0.0     
ref|XP_011078051.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-17-like     684   0.0     
emb|CDX81833.1|  BnaC08g37680D                                          682   0.0     
ref|XP_006426607.1|  hypothetical protein CICLE_v10024696mg             683   0.0     
ref|XP_006300645.1|  hypothetical protein CARUB_v10019655mg             680   0.0     
ref|XP_011080292.1|  PREDICTED: myosin-11-like                          681   0.0     
ref|XP_010414902.1|  PREDICTED: myosin-11                               681   0.0     
ref|XP_009117656.1|  PREDICTED: myosin-5 isoform X2                     680   0.0     
ref|XP_009117654.1|  PREDICTED: myosin-5 isoform X1                     680   0.0     
emb|CDY21744.1|  BnaA09g44950D                                          680   0.0     
ref|XP_009628316.1|  PREDICTED: myosin-9-like isoform X4                676   0.0     
ref|XP_010274858.1|  PREDICTED: myosin-9-like                           680   0.0     
ref|XP_009763175.1|  PREDICTED: myosin-9-like                           679   0.0     
ref|XP_010096435.1|  Myosin-J heavy chain                               679   0.0     
ref|XP_010470351.1|  PREDICTED: myosin-11-like                          679   0.0     
gb|EEC75961.1|  hypothetical protein OsI_13067                          681   0.0     Oryza sativa Indica Group [Indian rice]
ref|NP_001057670.1|  Os06g0488200                                       679   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010511196.1|  PREDICTED: myosin-11-like                          679   0.0     
ref|XP_008785355.1|  PREDICTED: myosin-11-like                          679   0.0     
gb|AER51968.1|  myosin XIK                                              678   0.0     
ref|XP_009411029.1|  PREDICTED: myosin-9-like isoform X2                677   0.0     
ref|XP_007030493.1|  Myosin family protein with Dil domain              679   0.0     
gb|EEE59719.1|  hypothetical protein OsJ_12150                          680   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411028.1|  PREDICTED: myosin-9-like isoform X1                676   0.0     
ref|XP_010694808.1|  PREDICTED: myosin-11-like                          677   0.0     
ref|XP_006417653.1|  hypothetical protein EUTSA_v10006560mg             676   0.0     
ref|XP_009628315.1|  PREDICTED: myosin-9-like isoform X3                676   0.0     
ref|XP_006392515.1|  hypothetical protein EUTSA_v10023213mg             677   0.0     
ref|NP_175858.1|  Myosin family protein with Dil domain                 677   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KFK43939.1|  hypothetical protein AALP_AA1G194000                    676   0.0     
ref|XP_009113429.1|  PREDICTED: myosin-11                               674   0.0     
emb|CDY42350.1|  BnaA09g15850D                                          675   0.0     
ref|XP_006606471.1|  PREDICTED: myosin-11-like                          676   0.0     
ref|XP_009628313.1|  PREDICTED: myosin-9-like isoform X1                676   0.0     
ref|XP_009628314.1|  PREDICTED: myosin-9-like isoform X2                676   0.0     
gb|EPS61697.1|  hypothetical protein M569_13097                         650   0.0     
ref|XP_010476915.1|  PREDICTED: myosin-5                                675   0.0     
gb|KFK43186.1|  hypothetical protein AALP_AA1G091000                    675   0.0     
ref|XP_010498125.1|  PREDICTED: myosin-5-like isoform X2                674   0.0     
ref|XP_006589199.1|  PREDICTED: myosin-11-like                          675   0.0     
ref|XP_010660140.1|  PREDICTED: myosin-9                                675   0.0     
ref|XP_009591029.1|  PREDICTED: myosin-9-like isoform X4                661   0.0     
ref|XP_010498124.1|  PREDICTED: myosin-5-like isoform X1                674   0.0     
ref|XP_002890235.1|  hypothetical protein ARALYDRAFT_889165             674   0.0     
ref|XP_009591028.1|  PREDICTED: myosin-9-like isoform X3                661   0.0     
gb|EEC80642.1|  hypothetical protein OsI_23028                          679   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_010498126.1|  PREDICTED: myosin-5-like isoform X3                674   0.0     
ref|XP_010923044.1|  PREDICTED: myosin-11-like                          674   0.0     
ref|XP_006442753.1|  hypothetical protein CICLE_v10018485mg             672   0.0     
emb|CAN71597.1|  hypothetical protein VITISV_019007                     675   0.0     Vitis vinifera
ref|XP_010475685.1|  PREDICTED: myosin-9                                674   0.0     
ref|XP_010553755.1|  PREDICTED: myosin-11                               673   0.0     
gb|EPS64096.1|  hypothetical protein M569_10684                         673   0.0     
ref|XP_006656811.1|  PREDICTED: myosin-11-like                          674   0.0     
ref|XP_010321831.1|  PREDICTED: myosin-9-like                           673   0.0     
ref|XP_008456307.1|  PREDICTED: myosin-11 isoform X1                    673   0.0     
emb|CBI35200.3|  unnamed protein product                                675   0.0     
ref|XP_008456315.1|  PREDICTED: myosin-11 isoform X2                    672   0.0     
ref|XP_009110876.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-9-like      672   0.0     
ref|NP_173201.2|  myosin 1                                              672   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147198.1|  hypothetical protein PHAVU_006G103900g             672   0.0     
ref|XP_010679211.1|  PREDICTED: myosin-9-like isoform X3                669   0.0     
ref|XP_010531810.1|  PREDICTED: myosin-11-like                          672   0.0     
ref|XP_008218295.1|  PREDICTED: myosin-11                               671   0.0     
emb|CDX95235.1|  BnaC09g16350D                                          671   0.0     
ref|XP_010679210.1|  PREDICTED: myosin-9-like isoform X2                669   0.0     
ref|XP_009777808.1|  PREDICTED: myosin-9-like                           660   0.0     
ref|XP_009591027.1|  PREDICTED: myosin-9-like isoform X2                659   0.0     
ref|XP_009591022.1|  PREDICTED: myosin-9-like isoform X1                659   0.0     
ref|XP_010458123.1|  PREDICTED: myosin-9-like                           670   0.0     
ref|NP_172349.2|  myosin class XI                                       671   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447239.1|  PREDICTED: myosin-11 isoform X1                    657   0.0     
gb|EYU46481.1|  hypothetical protein MIMGU_mgv1a018273mg                670   0.0     
ref|XP_007144848.1|  hypothetical protein PHAVU_007G189300g             669   0.0     
ref|XP_002319092.2|  hypothetical protein POPTR_0013s04110g             669   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010679209.1|  PREDICTED: myosin-9-like isoform X1                669   0.0     
ref|XP_003520844.2|  PREDICTED: myosin-9-like                           669   0.0     
ref|XP_002521953.1|  myosin XI, putative                                669   0.0     Ricinus communis
ref|XP_008388696.1|  PREDICTED: myosin-11                               668   0.0     
ref|XP_009364462.1|  PREDICTED: myosin-11                               668   0.0     
ref|XP_009148126.1|  PREDICTED: myosin-9                                668   0.0     
ref|XP_009800534.1|  PREDICTED: myosin-9-like isoform X3                664   0.0     
ref|XP_011038539.1|  PREDICTED: myosin-9                                667   0.0     
ref|XP_010227822.1|  PREDICTED: myosin-11-like isoform X2               667   0.0     
ref|XP_010227821.1|  PREDICTED: myosin-11-like isoform X1               667   0.0     
ref|XP_010233428.1|  PREDICTED: myosin-17                               684   0.0     
ref|XP_006303672.1|  hypothetical protein CARUB_v10011741mg             666   0.0     
ref|XP_004966839.1|  PREDICTED: myosin-H heavy chain-like               667   0.0     
ref|XP_009395618.1|  PREDICTED: myosin-11-like                          667   0.0     
ref|XP_004304760.1|  PREDICTED: unconventional myosin-Vc-like           666   0.0     
ref|XP_006370974.1|  hypothetical protein POPTR_0019s02280g             666   0.0     
ref|XP_006303742.1|  hypothetical protein CARUB_v10011892mg             666   0.0     
ref|XP_004139250.1|  PREDICTED: unconventional myosin-Vc-like           666   0.0     
ref|XP_004150341.1|  PREDICTED: myosin-J heavy chain-like               654   0.0     
ref|XP_006365902.1|  PREDICTED: myosin-11-like                          665   0.0     
gb|KEH24572.1|  DIL domain myosin family protein                        665   0.0     
ref|XP_004156476.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    665   0.0     
ref|XP_010652356.1|  PREDICTED: myosin-9-like                           655   0.0     
ref|XP_009597756.1|  PREDICTED: myosin-9-like isoform X3                662   0.0     
emb|CDO99965.1|  unnamed protein product                                667   0.0     
ref|XP_010033759.1|  PREDICTED: myosin-17 isoform X2                    661   0.0     
ref|XP_004495594.1|  PREDICTED: myosin-J heavy chain-like isoform X1    652   0.0     
ref|XP_009372154.1|  PREDICTED: myosin-9                                664   0.0     
ref|XP_009396405.1|  PREDICTED: myosin-11-like                          665   0.0     
ref|XP_009800533.1|  PREDICTED: myosin-11-like isoform X2               663   0.0     
ref|XP_004495595.1|  PREDICTED: myosin-J heavy chain-like isoform X2    650   0.0     
ref|XP_010323140.1|  PREDICTED: myosin-9-like                           653   0.0     
ref|XP_006352745.1|  PREDICTED: myosin-9-like                           653   0.0     
gb|EPS63247.1|  hypothetical protein M569_11538                         645   0.0     
ref|XP_009800532.1|  PREDICTED: myosin-11-like isoform X1               663   0.0     
ref|XP_004494720.1|  PREDICTED: myosin-H heavy chain-like               663   0.0     
ref|XP_009597755.1|  PREDICTED: myosin-11-like isoform X2               661   0.0     
ref|XP_008370724.1|  PREDICTED: myosin-9                                662   0.0     
ref|XP_008659087.1|  PREDICTED: myosin-11-like                          662   0.0     
ref|XP_011002934.1|  PREDICTED: myosin-11                               662   0.0     
ref|XP_011076889.1|  PREDICTED: myosin-11-like                          662   0.0     
ref|XP_002436758.1|  hypothetical protein SORBIDRAFT_10g008210          662   0.0     Sorghum bicolor [broomcorn]
ref|XP_009597754.1|  PREDICTED: myosin-11-like isoform X1               661   0.0     
ref|XP_011028769.1|  PREDICTED: myosin-16 isoform X6                    644   0.0     
ref|XP_002521016.1|  myosin XI, putative                                649   0.0     Ricinus communis
emb|CAN81284.1|  hypothetical protein VITISV_030944                     644   0.0     Vitis vinifera
gb|AAF79470.1|AC022492_14  F1L3.28                                      662   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN44988.1|  Myosin-J heavy chain                                    642   0.0     
gb|KDP23693.1|  hypothetical protein JCGZ_23526                         659   0.0     
ref|XP_011028766.1|  PREDICTED: myosin-9 isoform X3                     645   0.0     
ref|XP_004249919.2|  PREDICTED: myosin-11                               658   0.0     
ref|XP_010103104.1|  Myosin-2 heavy chain                               628   0.0     
ref|XP_002521165.1|  myosin XI, putative                                653   0.0     Ricinus communis
gb|EYU17905.1|  hypothetical protein MIMGU_mgv1a000381mg                649   0.0     
gb|EMT07574.1|  Myosin-2 heavy chain                                    662   0.0     
gb|AAC64896.1|  Strong similarity to F22O13.22 gi|3063460 myosin ...    658   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028765.1|  PREDICTED: myosin-9 isoform X2                     645   0.0     
ref|XP_011028764.1|  PREDICTED: myosin-9 isoform X1                     647   0.0     
ref|XP_002458397.1|  hypothetical protein SORBIDRAFT_03g032770          623   0.0     Sorghum bicolor [broomcorn]
ref|XP_006854437.1|  hypothetical protein AMTR_s00039p00219460          655   0.0     
ref|XP_006443695.1|  hypothetical protein CICLE_v10018480mg             652   0.0     
gb|EMT11775.1|  Myosin-J heavy chain                                    657   0.0     
ref|XP_006350947.1|  PREDICTED: myosin-11-like                          654   0.0     
ref|XP_008391289.1|  PREDICTED: myosin-7-like                           637   0.0     
gb|KCW61541.1|  hypothetical protein EUGRSUZ_H04260                     653   0.0     
ref|XP_010024976.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-9-like      653   0.0     
ref|XP_006594011.1|  PREDICTED: myosin-9-like                           642   0.0     
gb|EMS59156.1|  Myosin-J heavy chain                                    655   0.0     
gb|EYU20922.1|  hypothetical protein MIMGU_mgv1a0001602mg               619   0.0     
ref|XP_006443694.1|  hypothetical protein CICLE_v10018480mg             652   0.0     
gb|AES61248.2|  Dil domain myosin family protein                        640   0.0     
ref|XP_007050094.1|  Myosin 2 isoform 3                                 650   0.0     
ref|XP_010091844.1|  Myosin-J heavy chain                               652   0.0     
gb|EYU27171.1|  hypothetical protein MIMGU_mgv1a0258112mg               634   0.0     
ref|XP_006588668.1|  PREDICTED: myosin-16-like isoform X3               638   0.0     
ref|XP_006588666.1|  PREDICTED: myosin-16-like isoform X1               638   0.0     
gb|KDP26440.1|  hypothetical protein JCGZ_17598                         649   0.0     
ref|XP_007050092.1|  Myosin 2 isoform 1                                 650   0.0     
ref|XP_010263980.1|  PREDICTED: myosin-7 isoform X3                     644   0.0     
gb|KCW58111.1|  hypothetical protein EUGRSUZ_H00833                     640   0.0     
ref|XP_004247120.1|  PREDICTED: myosin-6-like                           648   0.0     
ref|XP_011083084.1|  PREDICTED: myosin-6-like                           648   0.0     
ref|XP_008358510.1|  PREDICTED: myosin-8-like                           620   0.0     
ref|XP_007199699.1|  hypothetical protein PRUPE_ppa000793mg             631   0.0     
ref|XP_010918867.1|  PREDICTED: myosin-6-like                           648   0.0     
ref|XP_002303100.1|  myosin heavy chain family protein                  647   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006480094.1|  PREDICTED: myosin-11-like                          637   0.0     
ref|XP_006364551.1|  PREDICTED: myosin-6-like isoform X1                643   0.0     
ref|XP_006443885.1|  hypothetical protein CICLE_v10024066mg             637   0.0     
gb|KHG01523.1|  Myosin-J heavy chain                                    648   0.0     
ref|XP_004495118.1|  PREDICTED: myosin-J heavy chain-like isoform X1    635   0.0     
ref|XP_004495119.1|  PREDICTED: myosin-J heavy chain-like isoform X2    635   0.0     
ref|XP_011024520.1|  PREDICTED: myosin-6-like                           647   0.0     
ref|XP_004166733.1|  PREDICTED: myosin-J heavy chain-like               614   0.0     
ref|XP_010243625.1|  PREDICTED: myosin-6-like                           646   0.0     
gb|AAK71565.1|AC087852_25  putative myosin heavy chain, 3'-partial      626   0.0     
ref|XP_011083016.1|  PREDICTED: myosin-9                                636   0.0     
ref|XP_006350284.1|  PREDICTED: myosin-6-like                           646   0.0     
ref|XP_009367715.1|  PREDICTED: myosin-11-like isoform X3               632   0.0     
ref|XP_007199700.1|  hypothetical protein PRUPE_ppa000793mg             631   0.0     
ref|XP_009367714.1|  PREDICTED: myosin-11-like isoform X2               632   0.0     
ref|XP_006364552.1|  PREDICTED: myosin-6-like isoform X2                644   0.0     
ref|XP_006364553.1|  PREDICTED: myosin-6-like isoform X3                643   0.0     
emb|CDP03822.1|  unnamed protein product                                645   0.0     
ref|XP_004290008.1|  PREDICTED: unconventional myosin-Va-like           645   0.0     
tpg|DAA57887.1|  TPA: hypothetical protein ZEAMMB73_998910              620   0.0     
ref|XP_010504774.1|  PREDICTED: myosin-16-like isoform X6               632   0.0     
ref|XP_010650198.1|  PREDICTED: myosin-6-like isoform X1                644   0.0     
ref|XP_002285579.1|  PREDICTED: myosin-6-like isoform X2                644   0.0     
ref|XP_004157575.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-H hea...    642   0.0     
ref|XP_010516463.1|  PREDICTED: myosin-16                               635   0.0     
ref|XP_008235721.1|  PREDICTED: myosin-11-like                          631   0.0     
gb|ABJ53197.1|  myosin XI-2                                             643   0.0     
ref|XP_008231403.1|  PREDICTED: myosin-12                               626   0.0     
ref|XP_009367713.1|  PREDICTED: myosin-11-like isoform X1               631   0.0     
gb|AFW83738.1|  hypothetical protein ZEAMMB73_244974                    619   0.0     
ref|XP_004140584.1|  PREDICTED: myosin-H heavy chain-like               642   0.0     
ref|XP_010522522.1|  PREDICTED: myosin-6                                642   0.0     
gb|KEH42578.1|  myosin motor domain protein and Dil domain protein      628   0.0     
ref|XP_010257689.1|  PREDICTED: myosin-12-like                          643   0.0     
ref|XP_010276386.1|  PREDICTED: myosin-12-like isoform X2               640   0.0     
ref|XP_008807963.1|  PREDICTED: myosin-6-like                           642   0.0     
ref|XP_002889711.1|  predicted protein                                  660   0.0     
ref|XP_003590997.1|  Myosin XI                                          639   0.0     
gb|EPS72869.1|  hypothetical protein M569_01887                         641   0.0     
ref|XP_009795639.1|  PREDICTED: myosin-6-like                           641   0.0     
ref|XP_006604524.1|  PREDICTED: myosin-6-like isoform X2                641   0.0     
ref|XP_010504773.1|  PREDICTED: myosin-16-like isoform X5               632   0.0     
ref|XP_008235555.1|  PREDICTED: myosin-6-like                           641   0.0     
ref|XP_006604523.1|  PREDICTED: myosin-6-like isoform X1                641   0.0     
ref|XP_007201768.1|  hypothetical protein PRUPE_ppa000180mg             641   0.0     
ref|XP_009104124.1|  PREDICTED: myosin-16-like isoform X4               627   0.0     
ref|XP_006648114.1|  PREDICTED: myosin-6-like                           641   0.0     
gb|KEH42579.1|  myosin motor domain protein and Dil domain protein      627   0.0     
ref|XP_011086747.1|  PREDICTED: myosin-12                               642   0.0     
ref|XP_009343402.1|  PREDICTED: myosin-6                                640   0.0     
emb|CBI33312.3|  unnamed protein product                                644   0.0     
ref|XP_008459985.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-6-like      640   0.0     
ref|XP_010111887.1|  Myosin-J heavy chain                               627   0.0     
ref|XP_009616366.1|  PREDICTED: myosin-6-like                           640   0.0     
gb|AFW67631.1|  hypothetical protein ZEAMMB73_547815                    624   0.0     
ref|XP_010263979.1|  PREDICTED: myosin-6 isoform X2                     642   0.0     
ref|NP_001048517.2|  Os02g0816900                                       639   0.0     
ref|XP_009370872.1|  PREDICTED: myosin-6-like isoform X3                639   0.0     
dbj|BAD21517.1|  putative myosin subfamily XI heavy chain               640   0.0     
ref|XP_010263978.1|  PREDICTED: myosin-6 isoform X1                     642   0.0     
ref|XP_011080138.1|  PREDICTED: myosin-6-like                           639   0.0     
ref|XP_009354916.1|  PREDICTED: myosin-9-like isoform X2                626   0.0     
ref|XP_004240471.1|  PREDICTED: myosin-6-like isoform X3                639   0.0     
ref|XP_009370864.1|  PREDICTED: myosin-6-like isoform X2                639   0.0     
ref|XP_010069689.1|  PREDICTED: myosin-6-like                           639   0.0     
ref|XP_010524046.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-16          627   0.0     
ref|XP_009354915.1|  PREDICTED: myosin-9-like isoform X1                626   0.0     
ref|XP_009354917.1|  PREDICTED: myosin-9-like isoform X3                627   0.0     
ref|XP_010504771.1|  PREDICTED: myosin-16-like isoform X3               632   0.0     
ref|XP_010321809.1|  PREDICTED: myosin-6-like isoform X4                639   0.0     
ref|XP_006402803.1|  hypothetical protein EUTSA_v10006411mg             632   0.0     
ref|XP_009104123.1|  PREDICTED: myosin-16-like isoform X3               627   0.0     
ref|XP_002876459.1|  hypothetical protein ARALYDRAFT_907290             632   0.0     
ref|XP_010504772.1|  PREDICTED: myosin-16-like isoform X4               631   0.0     
ref|XP_009370851.1|  PREDICTED: myosin-6-like isoform X1                639   0.0     
gb|KEH42580.1|  myosin motor domain protein and Dil domain protein      628   0.0     
ref|XP_010276385.1|  PREDICTED: myosin-12-like isoform X1               639   0.0     
ref|XP_010504770.1|  PREDICTED: myosin-16-like isoform X2               631   0.0     
ref|XP_009792541.1|  PREDICTED: myosin-6-like isoform X2                634   0.0     
ref|XP_010504769.1|  PREDICTED: myosin-16-like isoform X1               631   0.0     
ref|XP_004954374.1|  PREDICTED: unconventional myosin-Va-like           638   0.0     
ref|XP_006418159.1|  hypothetical protein EUTSA_v10006554mg             637   0.0     
ref|XP_009138978.1|  PREDICTED: myosin-16 isoform X6                    625   0.0     
ref|XP_007162642.1|  hypothetical protein PHAVU_001G167900g             637   0.0     
gb|KHN14710.1|  Myosin-J heavy chain                                    636   0.0     
ref|XP_006303136.1|  hypothetical protein CARUB_v10008089mg             637   0.0     
ref|XP_009104122.1|  PREDICTED: myosin-16-like isoform X2               627   0.0     
ref|XP_010936111.1|  PREDICTED: myosin-6-like                           637   0.0     
ref|XP_009104121.1|  PREDICTED: myosin-16-like isoform X1               627   0.0     
ref|XP_008364330.1|  PREDICTED: myosin-6-like isoform X2                637   0.0     
ref|XP_002440148.1|  hypothetical protein SORBIDRAFT_09g026840          608   0.0     
ref|XP_009365058.1|  PREDICTED: myosin-12 isoform X3                    634   0.0     
ref|XP_008364328.1|  PREDICTED: myosin-6-like isoform X1                637   0.0     
ref|XP_006576975.1|  PREDICTED: myosin-6-like isoform X2                637   0.0     
ref|XP_006576974.1|  PREDICTED: myosin-6-like isoform X1                637   0.0     
ref|XP_010540938.1|  PREDICTED: myosin-14 isoform X2                    634   0.0     
gb|KHN02440.1|  Myosin-J heavy chain                                    639   0.0     
ref|XP_004495120.1|  PREDICTED: myosin-J heavy chain-like isoform X3    625   0.0     
ref|XP_010526481.1|  PREDICTED: myosin-14                               636   0.0     
gb|AAD32282.1|  putative unconventional myosin                          636   0.0     
gb|AAW83512.1|  myosin XI B                                             636   0.0     
ref|XP_007034553.1|  Myosin XI B isoform 1                              636   0.0     
ref|XP_010469656.1|  PREDICTED: myosin-12-like isoform X2               637   0.0     
ref|XP_004495037.1|  PREDICTED: myosin-H heavy chain-like               636   0.0     
ref|XP_006585385.1|  PREDICTED: myosin-12-like                          639   0.0     
ref|XP_010940663.1|  PREDICTED: myosin-8-like                           636   0.0     
ref|XP_010510140.1|  PREDICTED: myosin-12 isoform X2                    637   0.0     
ref|XP_010510138.1|  PREDICTED: myosin-12 isoform X1                    637   0.0     
ref|XP_009392807.1|  PREDICTED: myosin-6-like isoform X2                635   0.0     
gb|AAT85070.1|  myosin heavy chain class XI E3 protein, putative        635   0.0     
ref|XP_009392805.1|  PREDICTED: myosin-6-like isoform X1                635   0.0     
ref|XP_009365492.1|  PREDICTED: myosin-6-like isoform X1                633   0.0     
ref|XP_009612617.1|  PREDICTED: myosin-6 isoform X3                     631   0.0     
emb|CDX67724.1|  BnaA07g17640D                                          627   0.0     
ref|XP_010475059.1|  PREDICTED: myosin-8                                635   0.0     
ref|XP_002512209.1|  myosin XI, putative                                635   0.0     
ref|NP_191375.1|  Class XI myosin                                       627   0.0     
ref|XP_004493849.1|  PREDICTED: myosin-H heavy chain-like               634   0.0     
ref|XP_010469655.1|  PREDICTED: myosin-12-like isoform X1               637   0.0     
emb|CDY64313.1|  BnaC09g51820D                                          635   0.0     
ref|XP_009608429.1|  PREDICTED: myosin-12 isoform X2                    636   0.0     
ref|XP_010659614.1|  PREDICTED: myosin-12 isoform X2                    635   0.0     
ref|XP_009365493.1|  PREDICTED: myosin-8-like isoform X2                633   0.0     
ref|NP_180749.2|  myosin-like protein XIF                               635   0.0     
ref|XP_009772079.1|  PREDICTED: myosin-12 isoform X2                    635   0.0     
ref|XP_009772072.1|  PREDICTED: myosin-12 isoform X1                    635   0.0     
ref|XP_009608428.1|  PREDICTED: myosin-12 isoform X1                    635   0.0     
ref|XP_010229966.1|  PREDICTED: myosin-12 isoform X2                    634   0.0     
ref|XP_009138975.1|  PREDICTED: myosin-16 isoform X3                    625   0.0     
emb|CDX98274.1|  BnaC06g16350D                                          627   0.0     
ref|XP_009138976.1|  PREDICTED: myosin-16 isoform X4                    624   0.0     
ref|XP_010540936.1|  PREDICTED: myosin-14 isoform X1                    634   0.0     
emb|CDY31130.1|  BnaA08g26800D                                          635   0.0     
ref|XP_002881204.1|  hypothetical protein ARALYDRAFT_482115             635   0.0     
emb|CBI18667.3|  unnamed protein product                                635   0.0     
gb|ABF98865.1|  myosin family protein, putative, expressed              630   0.0     
ref|XP_009792540.1|  PREDICTED: myosin-6-like isoform X1                633   0.0     
ref|XP_009138973.1|  PREDICTED: myosin-16 isoform X1                    624   0.0     
ref|XP_010323458.1|  PREDICTED: myosin-12 isoform X4                    635   0.0     
gb|AAF99762.1|AC003981_12  F22O13.20                                    652   0.0     
ref|XP_010414067.1|  PREDICTED: myosin-12-like isoform X2               634   0.0     
ref|XP_010414065.1|  PREDICTED: myosin-12-like isoform X1               634   0.0     
ref|XP_009138974.1|  PREDICTED: myosin-16 isoform X2                    624   0.0     
ref|XP_010323455.1|  PREDICTED: myosin-12 isoform X3                    634   0.0     
ref|XP_010323450.1|  PREDICTED: myosin-12 isoform X2                    634   0.0     
ref|XP_006403166.1|  hypothetical protein EUTSA_v10003130mg             633   0.0     
ref|XP_010323448.1|  PREDICTED: myosin-12 isoform X1                    634   0.0     
ref|XP_009138977.1|  PREDICTED: myosin-16 isoform X5                    622   0.0     
ref|XP_009792542.1|  PREDICTED: myosin-6-like isoform X3                633   0.0     
ref|XP_010659613.1|  PREDICTED: myosin-12 isoform X1                    635   0.0     
ref|XP_008797334.1|  PREDICTED: myosin-12 isoform X2                    631   0.0     
ref|XP_008804754.1|  PREDICTED: myosin-6-like                           633   0.0     
ref|XP_010229962.1|  PREDICTED: myosin-12 isoform X1                    634   0.0     
ref|XP_009132825.1|  PREDICTED: myosin-12 isoform X2                    634   0.0     
gb|EYU17957.1|  hypothetical protein MIMGU_mgv1a000177mg                632   0.0     
ref|XP_009132823.1|  PREDICTED: myosin-12 isoform X1                    634   0.0     
emb|CAN60836.1|  hypothetical protein VITISV_033822                     595   0.0     
ref|XP_006359125.1|  PREDICTED: myosin-12-like isoform X5               634   0.0     
ref|XP_006359123.1|  PREDICTED: myosin-12-like isoform X3               634   0.0     
ref|XP_007149143.1|  hypothetical protein PHAVU_005G044900g             635   0.0     
ref|XP_007225474.1|  hypothetical protein PRUPE_ppa000189mg             632   0.0     
ref|XP_006359124.1|  PREDICTED: myosin-12-like isoform X4               634   0.0     
ref|XP_006359122.1|  PREDICTED: myosin-12-like isoform X2               634   0.0     
gb|KEH42601.1|  myosin motor domain protein and Dil domain protein      617   0.0     
ref|XP_006359121.1|  PREDICTED: myosin-12-like isoform X1               634   0.0     
ref|XP_009365056.1|  PREDICTED: myosin-12 isoform X1                    633   0.0     
gb|ABJ53198.1|  myosin XI-F                                             634   0.0     
gb|EYU46375.1|  hypothetical protein MIMGU_mgv1a000172mg                632   0.0     
ref|XP_009365057.1|  PREDICTED: myosin-12 isoform X2                    633   0.0     
ref|XP_010684809.1|  PREDICTED: myosin-6                                632   0.0     
ref|XP_006594067.1|  PREDICTED: myosin-6-like                           632   0.0     
emb|CDY32922.1|  BnaA09g16710D                                          632   0.0     
ref|XP_008350311.1|  PREDICTED: myosin-12 isoform X3                    632   0.0     
ref|XP_010321808.1|  PREDICTED: myosin-6-like isoform X2                632   0.0     
ref|XP_010321807.1|  PREDICTED: myosin-6-like isoform X1                632   0.0     
ref|NP_001051263.1|  Os03g0747900                                       630   0.0     
ref|XP_008350308.1|  PREDICTED: myosin-12 isoform X2                    632   0.0     
ref|XP_006588714.1|  PREDICTED: myosin-6-like                           631   0.0     
ref|XP_008350302.1|  PREDICTED: myosin-12 isoform X1                    632   0.0     
ref|XP_009612616.1|  PREDICTED: myosin-6 isoform X2                     631   0.0     
ref|XP_009113971.1|  PREDICTED: myosin-6-like                           631   0.0     
ref|XP_009612615.1|  PREDICTED: myosin-6 isoform X1                     631   0.0     
ref|XP_004297927.1|  PREDICTED: myosin-H heavy chain-like               630   0.0     
gb|ABF98866.1|  myosin family protein, putative, expressed              630   0.0     
ref|XP_009394265.1|  PREDICTED: myosin-12-like                          632   0.0     
ref|XP_006410322.1|  hypothetical protein EUTSA_v10016137mg             632   0.0     
ref|XP_006598231.1|  PREDICTED: myosin-12                               632   0.0     
emb|CDX84752.1|  BnaA03g14780D                                          632   0.0     
ref|XP_010111563.1|  Myosin-J heavy chain                               633   0.0     
emb|CDP07639.1|  unnamed protein product                                632   0.0     
gb|KHN05898.1|  Myosin-J heavy chain                                    631   0.0     
emb|CDX79446.1|  BnaC03g17820D                                          631   0.0     
emb|CAN64632.1|  hypothetical protein VITISV_040993                     629   0.0     
ref|XP_006279893.1|  hypothetical protein CARUB_v10025740mg             630   0.0     
ref|XP_007144426.1|  hypothetical protein PHAVU_007G155000g             630   0.0     
ref|XP_010522266.1|  PREDICTED: myosin-12 isoform X1                    631   0.0     
ref|XP_007050368.1|  Myosin family protein with Dil domain, putative    621   0.0     
gb|AAQ87016.1|  myosin heavy chain class XI E3 protein                  630   0.0     
ref|XP_008800587.1|  PREDICTED: myosin-6-like isoform X2                630   0.0     
emb|CDX88973.1|  BnaA04g02130D                                          620   0.0     
ref|XP_008800586.1|  PREDICTED: myosin-6-like isoform X1                630   0.0     
ref|XP_010522267.1|  PREDICTED: myosin-12 isoform X2                    631   0.0     
ref|XP_010481807.1|  PREDICTED: myosin-6-like isoform X2                629   0.0     
ref|XP_010481806.1|  PREDICTED: myosin-6-like isoform X1                629   0.0     
ref|XP_006826292.1|  hypothetical protein AMTR_s00004p00062410          632   0.0     
ref|XP_008797333.1|  PREDICTED: myosin-12 isoform X1                    630   0.0     
gb|KCW60150.1|  hypothetical protein EUGRSUZ_H02875                     629   0.0     
gb|AAL58953.1|AC091811_2  putative myosin                               630   0.0     
ref|XP_007220854.1|  hypothetical protein PRUPE_ppa020929mg             629   0.0     
ref|XP_008342552.1|  PREDICTED: myosin-8                                629   0.0     
ref|XP_010023779.1|  PREDICTED: myosin-6                                629   0.0     
ref|XP_004167020.1|  PREDICTED: myosin-H heavy chain-like               629   0.0     
emb|CBI37226.3|  unnamed protein product                                630   0.0     
gb|AAQ87014.1|  myosin heavy chain class XI E1 protein                  630   0.0     
emb|CDX93542.1|  BnaA06g05060D                                          634   0.0     
ref|XP_002268099.2|  PREDICTED: myosin-6                                629   0.0     
ref|XP_002889516.1|  hypothetical protein ARALYDRAFT_887631             634   0.0     
ref|XP_011015422.1|  PREDICTED: myosin-12-like                          630   0.0     
ref|XP_011041977.1|  PREDICTED: myosin-12                               630   0.0     
ref|XP_010441966.1|  PREDICTED: myosin-6 isoform X2                     629   0.0     
gb|AAQ87015.1|  myosin heavy chain class XI E2 protein                  630   0.0     
ref|XP_008646432.1|  PREDICTED: myosin-6-like                           629   0.0     
ref|XP_010441964.1|  PREDICTED: myosin-6 isoform X1                     629   0.0     
gb|KHG04465.1|  Myosin-J heavy chain                                    617   0.0     
ref|XP_010494377.1|  PREDICTED: myosin-6-like                           628   0.0     
ref|XP_008461219.1|  PREDICTED: myosin-12                               630   0.0     
ref|XP_006650582.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-12-like     629   0.0     



>gb|KDO65126.1| hypothetical protein CISIN_1g0004211mg, partial [Citrus sinensis]
Length=471

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  77    MMEQYKGAAFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  136

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  137   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  196

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+  KYKLG+PKSFHYLNQSNCYELDGV+D
Sbjct  197   TYLLERSRVCQISDPERNYHCFYLLCAAPHEDIAKYKLGSPKSFHYLNQSNCYELDGVSD  256

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQE IFRVVAAILHLGNI+FAKG+EIDSSVIKDEKSRFHLN
Sbjct  257   AHEYLATRRAMDIVGISDQEQEAIFRVVAAILHLGNIDFAKGKEIDSSVIKDEKSRFHLN  316

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEEVITRTLDP +A+ SRDALAKT+YSRLFDWIV+K
Sbjct  317   MTAELLRCDAQSLEDALIKRVMVTPEEVITRTLDPVNAVASRDALAKTIYSRLFDWIVEK  376

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDP+SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  377   INISIGQDPDSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  436

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEF+DNQDV
Sbjct  437   REEINWSYIEFIDNQDV  453



>gb|KDO65123.1| hypothetical protein CISIN_1g0004211mg, partial [Citrus sinensis]
 gb|KDO65124.1| hypothetical protein CISIN_1g0004211mg, partial [Citrus sinensis]
 gb|KDO65125.1| hypothetical protein CISIN_1g0004211mg, partial [Citrus sinensis]
Length=510

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+  KYKLG+PKSFHYLNQSNCYELDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPHEDIAKYKLGSPKSFHYLNQSNCYELDGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQE IFRVVAAILHLGNI+FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGISDQEQEAIFRVVAAILHLGNIDFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEEVITRTLDP +A+ SRDALAKT+YSRLFDWIV+K
Sbjct  356   MTAELLRCDAQSLEDALIKRVMVTPEEVITRTLDPVNAVASRDALAKTIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDP+SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPDSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEF+DNQDV
Sbjct  476   REEINWSYIEFIDNQDV  492



>ref|XP_008337784.1| PREDICTED: myosin-17-like [Malus domestica]
Length=825

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEER+K+KLG+PK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEERDKFKLGDPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEYLATRRAMDIVGISEEEQ+ IF VVAAILHLGN+EFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   GEEYLATRRAMDIVGISEEEQDAIFMVVAAILHLGNVEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP SAL SRDALAKTVYSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEIITRTLDPVSALASRDALAKTVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK++IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKALIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>emb|CDP03119.1| unnamed protein product [Coffea canephora]
Length=1623

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/377 (94%), Positives = 370/377 (98%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG  FGELSPHVFA+ADV+YR MINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  197   MMEQYKGTGFGELSPHVFAIADVSYRQMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  256

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  257   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  316

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQISTPERNYHCFYLLCAAPPEE+E+YKLGNPK FHYLNQSNCYELDGVND
Sbjct  317   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEKERYKLGNPKIFHYLNQSNCYELDGVND  376

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEY+ATRRAMDIVGI+EEEQE IFRVVAAILHLGN++FAKGQEIDSSVIKDEKSRFHL+
Sbjct  377   GEEYVATRRAMDIVGINEEEQEAIFRVVAAILHLGNVDFAKGQEIDSSVIKDEKSRFHLD  436

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALIKRVMVTPEEVITRTLDPE+A GSRDALAKT+YSRLFDWIV+K
Sbjct  437   VTAELLKCDAKSLEDALIKRVMVTPEEVITRTLDPEAATGSRDALAKTIYSRLFDWIVEK  496

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  497   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  556

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  557   KEQINWSYIEFVDNQDV  573



>ref|XP_009801396.1| PREDICTED: myosin-17-like [Nicotiana sylvestris]
Length=1529

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/377 (94%), Positives = 367/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKLGNPKSFHYLNQS CY LDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEIERYKLGNPKSFHYLNQSKCYALDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   ADEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVMVTPEEVITRTLDPE+ALGSRDALAKTVYSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMVTPEEVITRTLDPEAALGSRDALAKTVYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  475   KEKINWSYIEFVDNQDV  491



>gb|ABJ53199.1| myosin XI-K [Nicotiana benthamiana]
Length=1529

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/377 (95%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQS CY LDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEIEKYKLGNPKSFHYLNQSKCYALDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILH GN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   AEEYLATRRAMDIVGISEEEQDAIFRVVAAILHPGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVMVTPEEVITRTLDPE+ALGSRDALAKTVYSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMVTPEEVITRTLDPEAALGSRDALAKTVYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  475   KEKINWSYIEFVDNQDV  491



>ref|XP_006451554.1| hypothetical protein CICLE_v10007325mg [Citrus clementina]
 gb|ESR64794.1| hypothetical protein CICLE_v10007325mg [Citrus clementina]
Length=1031

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  142   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  201

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  202   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  261

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  262   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  321

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  322   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  381

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+ SRDALAKTVYSRLFDW+V K
Sbjct  382   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVSSRDALAKTVYSRLFDWLVDK  441

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  442   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  501

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  502   KEEINWSYIEFVDNQDV  518



>dbj|BAD72949.1| myosin XI [Nicotiana tabacum]
Length=1529

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/377 (94%), Positives = 367/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKLGNPKSFHYLNQS CY LDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEIERYKLGNPKSFHYLNQSKCYALDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   ADEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVMVTPEE+ITRTLDPE+ALGSRDALAKTVYSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMVTPEEIITRTLDPEAALGSRDALAKTVYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  475   KEKINWSYIEFVDNQDV  491



>ref|XP_009588032.1| PREDICTED: myosin-17-like [Nicotiana tomentosiformis]
Length=1529

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/377 (94%), Positives = 367/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKLGNPKSFHYLNQS CY LDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEIERYKLGNPKSFHYLNQSKCYALDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   ADEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVMVTPEE+ITRTLDPE+ALGSRDALAKTVYSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMVTPEEIITRTLDPEAALGSRDALAKTVYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  475   KEKINWSYIEFVDNQDV  491



>ref|XP_004144013.1| PREDICTED: unconventional myosin-Va-like [Cucumis sativus]
 ref|XP_004161103.1| PREDICTED: unconventional myosin-Va-like [Cucumis sativus]
Length=1463

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/377 (93%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG  FGELSPHVFAVA+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGTGFGELSPHVFAVAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKL +PKSFHYLNQS C+ELDGVND
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLADPKSFHYLNQSKCFELDGVND  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMD+VGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKDEKSRFHLN
Sbjct  230   AHEYLATRRAMDVVGISEEEQEAIFRVVAAILHLGNIEFAKGEEIDSSVIKDEKSRFHLN  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDW+V+K
Sbjct  290   TTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWLVEK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INNSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  410   KEQINWSYIEFVDNQDV  426



>gb|KDP33878.1| hypothetical protein JCGZ_07449 [Jatropha curcas]
Length=1531

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/377 (94%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLC APPEERE+YKLGNPKSFHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCKAPPEERERYKLGNPKSFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVVAAILHLGNIEFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKC+A+SLEDALIKRVMVTPEEVITRTLDP SA+ SRDALAKTVYSRLFDW+V K
Sbjct  356   MTAELLKCNAQSLEDALIKRVMVTPEEVITRTLDPHSAVASRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|EYU28356.1| hypothetical protein MIMGU_mgv1a0001592mg, partial [Erythranthe 
guttata]
Length=1486

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 369/377 (98%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAA GELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  72    MMEQYKGAALGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  131

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  132   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  191

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKLG+P+S+HYLNQS CY+LDGV+D
Sbjct  192   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLGSPESYHYLNQSKCYKLDGVSD  251

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IF+VVAAILHLGNIEFAKG+EIDSSVIKDEKSRFHLN
Sbjct  252   AEEYLATRRAMDIVGISEEEQDAIFKVVAAILHLGNIEFAKGEEIDSSVIKDEKSRFHLN  311

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD K+LEDALIKRVMVTPEE+ITRTLDPE+ALGS+DA AKT+YSRLFDWIV+K
Sbjct  312   TTAELLKCDPKNLEDALIKRVMVTPEEIITRTLDPEAALGSKDAFAKTIYSRLFDWIVEK  371

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+YE
Sbjct  372   INISIGQDPNSKAIIGVLDIYGFESFKHNSFEQFCINFTNEKLQQHFNQHVFKMEQEDYE  431

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  432   KEQINWSYIEFVDNQDV  448



>gb|KGN66272.1| hypothetical protein Csa_1G590280 [Cucumis sativus]
Length=1529

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/377 (93%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG  FGELSPHVFAVA+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGTGFGELSPHVFAVAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKL +PKSFHYLNQS C+ELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLADPKSFHYLNQSKCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMD+VGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDVVGISEEEQEAIFRVVAAILHLGNIEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_010324023.1| PREDICTED: myosin-17-like [Solanum lycopersicum]
Length=1529

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/377 (94%), Positives = 367/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKLGNPKSFHYLNQS  YELDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEVERYKLGNPKSFHYLNQSKYYELDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   AEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVMVTPEEVITRTLDPE+ALGSRDALAKT+YSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMVTPEEVITRTLDPEAALGSRDALAKTIYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  475   KEEINWSYIEFVDNQDV  491



>ref|XP_008450897.1| PREDICTED: myosin-17-like [Cucumis melo]
 ref|XP_008450898.1| PREDICTED: myosin-17-like [Cucumis melo]
Length=1529

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/377 (93%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVA+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKL +PKSFHYLNQS C+ELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLADPKSFHYLNQSKCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMD+VGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKD+KSRFHLN
Sbjct  296   AHEYLATRRAMDVVGISEEEQEAIFRVVAAILHLGNIEFAKGEEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +A+GSRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPVAAVGSRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_010654512.1| PREDICTED: myosin-17-like isoform X2 [Vitis vinifera]
Length=1478

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/377 (93%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQISTPERNYHCFYLLCAAPPEE E+YKLGNP++FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEIERYKLGNPRTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDE+SRFHLN
Sbjct  296   GHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEQSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDA+SLEDALIKRVMVTPEE+ITRTLDP +A+GSRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLKCDAQSLEDALIKRVMVTPEEIITRTLDPVNAIGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010261996.1| PREDICTED: LOW QUALITY PROTEIN: myosin-17-like [Nelumbo nucifera]
Length=1466

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSG+EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  110   LGGRSGIEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFY+LCAAPPE+ EKYKLG+PKSFHYLNQSNCY LDGVND
Sbjct  170   TYLLERSRVCQISDPERNYHCFYMLCAAPPEDTEKYKLGSPKSFHYLNQSNCYVLDGVND  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNI FAKG+EIDSSV+KDEKSRFHL 
Sbjct  230   AHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNINFAKGKEIDSSVVKDEKSRFHLK  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDA+SLEDALIKRVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDWIV+K
Sbjct  290   MTAELLKCDAQSLEDALIKRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWIVEK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INISIGQDPNSKSLIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_010654510.1| PREDICTED: myosin-17-like isoform X1 [Vitis vinifera]
 ref|XP_010654511.1| PREDICTED: myosin-17-like isoform X1 [Vitis vinifera]
Length=1530

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/377 (93%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQISTPERNYHCFYLLCAAPPEE E+YKLGNP++FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEIERYKLGNPRTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDE+SRFHLN
Sbjct  296   GHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEQSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDA+SLEDALIKRVMVTPEE+ITRTLDP +A+GSRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLKCDAQSLEDALIKRVMVTPEEIITRTLDPVNAIGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010656157.1| PREDICTED: myosin-17-like isoform X2 [Vitis vinifera]
Length=1441

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVA+RAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  28    MMEQYKGATFGELSPHVFAVADVAFRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  87

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  88    LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  147

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND
Sbjct  148   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  207

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EY ATRRAMD+VGISEEEQE IFRVVAA+LHLGNIEFAKG++IDSS+IKDE+SRFHLN
Sbjct  208   AHEYHATRRAMDVVGISEEEQEAIFRVVAAVLHLGNIEFAKGKDIDSSIIKDEESRFHLN  267

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDA+IKRVMVTPEEVITR LDP+SALGSRDALAKT+YSRLFDW+V K
Sbjct  268   MTAELLNCDAKGLEDAMIKRVMVTPEEVITRPLDPDSALGSRDALAKTIYSRLFDWLVNK  327

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  328   INDSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  387

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  388   KEEINWSYIEFVDNQDV  404



>ref|XP_006342344.1| PREDICTED: myosin-17-like [Solanum tuberosum]
Length=1529

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/377 (94%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  115   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  175   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKL NPKSFHYLNQS  YELDGVND
Sbjct  235   TYLLERSRVCQISNPERNYHCFYLLCAAPAEEVERYKLQNPKSFHYLNQSKYYELDGVND  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSVIKDE+SRFHLN
Sbjct  295   AEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGEEIDSSVIKDEQSRFHLN  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI RVM+TPEEVITRTLDPE+ALGSRDALAKT+YSRLFDWIV+K
Sbjct  355   MTAELLKCDAKSLEDALITRVMITPEEVITRTLDPEAALGSRDALAKTIYSRLFDWIVEK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE
Sbjct  415   INISIGQDPNSKSIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYE  474

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  475   KEEINWSYIEFVDNQDV  491



>ref|XP_007203980.1| hypothetical protein PRUPE_ppa000198mg [Prunus persica]
 gb|EMJ05179.1| hypothetical protein PRUPE_ppa000198mg [Prunus persica]
Length=1464

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 368/377 (98%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAAFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEEREK+KLGNPK FHYLNQS+CYELDG++D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCASPPEEREKFKLGNPKQFHYLNQSSCYELDGIDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G+EYLATRRAMD+VGISEEEQ+ IF VVAAILHLGN+EFAKG+++DSSVIKDEKSRFHL+
Sbjct  230   GQEYLATRRAMDVVGISEEEQDAIFMVVAAILHLGNVEFAKGEDVDSSVIKDEKSRFHLS  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLE+ALIKRVMVTPEE+ITRTLDP SAL SRDALAKT+YSRLFDW+V+K
Sbjct  290   TTAELLKCDPKSLEEALIKRVMVTPEEIITRTLDPVSALASRDALAKTIYSRLFDWLVEK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INISIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_007203981.1| hypothetical protein PRUPE_ppa000198mg [Prunus persica]
 gb|EMJ05180.1| hypothetical protein PRUPE_ppa000198mg [Prunus persica]
Length=1477

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 368/377 (98%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAAFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEEREK+KLGNPK FHYLNQS+CYELDG++D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCASPPEEREKFKLGNPKQFHYLNQSSCYELDGIDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G+EYLATRRAMD+VGISEEEQ+ IF VVAAILHLGN+EFAKG+++DSSVIKDEKSRFHL+
Sbjct  230   GQEYLATRRAMDVVGISEEEQDAIFMVVAAILHLGNVEFAKGEDVDSSVIKDEKSRFHLS  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLE+ALIKRVMVTPEE+ITRTLDP SAL SRDALAKT+YSRLFDW+V+K
Sbjct  290   TTAELLKCDPKSLEEALIKRVMVTPEEIITRTLDPVSALASRDALAKTIYSRLFDWLVEK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INISIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_008242188.1| PREDICTED: myosin-17-like [Prunus mume]
Length=1530

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 368/377 (98%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEEREK+KLGNPK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEEREKFKLGNPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G+EYLATRRAMDIVGISEEEQ+ IF VVAAILHLGN+EFAKG++IDSSVIKDEKSRFHL+
Sbjct  296   GQEYLATRRAMDIVGISEEEQDAIFMVVAAILHLGNVEFAKGEDIDSSVIKDEKSRFHLS  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLE+ALIKRVMVTPEE+ITRTLDP SAL SRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEEALIKRVMVTPEEIITRTLDPVSALASRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|KDO43963.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1464

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  230   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  290   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>gb|KDO43964.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1473

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>emb|CBI35925.3| unnamed protein product [Vitis vinifera]
Length=1610

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/377 (93%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  196   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  255

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  256   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  315

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQISTPERNYHCFYLLCAAPPEE E+YKLGNP++FHYLNQSNCYELDGVND
Sbjct  316   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEIERYKLGNPRTFHYLNQSNCYELDGVND  375

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             G EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDE+SRFHLN
Sbjct  376   GHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEQSRFHLN  435

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDA+SLEDALIKRVMVTPEE+ITRTLDP +A+GSRDALAKT+YSRLFDW+V K
Sbjct  436   MTAELLKCDAQSLEDALIKRVMVTPEEIITRTLDPVNAIGSRDALAKTIYSRLFDWLVDK  495

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  496   INNSIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  555

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  556   KEEINWSYIEFVDNQDV  572



>gb|KDO43958.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1509

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|KDO43959.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1513

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010656156.1| PREDICTED: myosin-17-like isoform X1 [Vitis vinifera]
Length=1529

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVA+RAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGATFGELSPHVFAVADVAFRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EY ATRRAMD+VGISEEEQE IFRVVAA+LHLGNIEFAKG++IDSS+IKDE+SRFHLN
Sbjct  296   AHEYHATRRAMDVVGISEEEQEAIFRVVAAVLHLGNIEFAKGKDIDSSIIKDEESRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDA+IKRVMVTPEEVITR LDP+SALGSRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLNCDAKGLEDAMIKRVMVTPEEVITRPLDPDSALGSRDALAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INDSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_007154613.1| hypothetical protein PHAVU_003G133500g [Phaseolus vulgaris]
 gb|ESW26607.1| hypothetical protein PHAVU_003G133500g [Phaseolus vulgaris]
Length=1530

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE+EKYKLG+P SFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQLSDPERNYHCFYLLCAAPAEEKEKYKLGSPSSFHYLNQSNCYSLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRV+AA+LHLGNIEFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVIAAVLHLGNIEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP +ALGSRDALAKTVYSRLFDW+V+K
Sbjct  356   VTAELLKCDCKSLEDALIKRVMVTPEEIITRTLDPVAALGSRDALAKTVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|AAB71527.1| unconventional myosin [Helianthus annuus]
Length=1260

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+REK+KL +P+S+HYLNQS  +EL+GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDREKFKLESPQSYHYLNQSKSFELEGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+EIDSSV+KD KSRFHLN
Sbjct  296   AHEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEIDSSVLKDGKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAKSLEDALIKRVMVTPEEVITRTLDPE+ALGSRDALAKT+YSRLFDWIV+K
Sbjct  356   VTAELLMCDAKSLEDALIKRVMVTPEEVITRTLDPEAALGSRDALAKTIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTN+KLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKHNSFEQFCINFTNQKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>gb|KDO43961.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
 gb|KDO43962.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1530

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_006475526.1| PREDICTED: myosin-17-like isoform X4 [Citrus sinensis]
Length=1464

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  230   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+ SRDALAKTVYSRLFDW+V K
Sbjct  290   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVSSRDALAKTVYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>emb|CBI27864.3| unnamed protein product [Vitis vinifera]
Length=1547

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVA+RAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  134   MMEQYKGATFGELSPHVFAVADVAFRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  193

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  194   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  253

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND
Sbjct  254   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  313

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EY ATRRAMD+VGISEEEQE IFRVVAA+LHLGNIEFAKG++IDSS+IKDE+SRFHLN
Sbjct  314   AHEYHATRRAMDVVGISEEEQEAIFRVVAAVLHLGNIEFAKGKDIDSSIIKDEESRFHLN  373

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDA+IKRVMVTPEEVITR LDP+SALGSRDALAKT+YSRLFDW+V K
Sbjct  374   MTAELLNCDAKGLEDAMIKRVMVTPEEVITRPLDPDSALGSRDALAKTIYSRLFDWLVNK  433

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  434   INDSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  493

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  494   KEEINWSYIEFVDNQDV  510



>gb|KDO43960.1| hypothetical protein CISIN_1g000420mg [Citrus sinensis]
Length=1527

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+GSRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVGSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_008352378.1| PREDICTED: myosin-17-like [Malus domestica]
Length=1530

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEER+K+KLG+PK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEERDKFKLGDPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEYLATRRAMDIVGISEEEQ+ IF VVAAILHLGN+EFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   GEEYLATRRAMDIVGISEEEQDAIFMVVAAILHLGNVEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP SAL SRDALAKTVYSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEIITRTLDPVSALASRDALAKTVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK++IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKALIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_009340465.1| PREDICTED: myosin-17-like [Pyrus x bretschneideri]
Length=1530

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEER+K+KLG+PK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEERDKFKLGDPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEYLATRRAMDIVG+SEEEQ+ IF VVAAILHLGN+EFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   GEEYLATRRAMDIVGMSEEEQDAIFMVVAAILHLGNVEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP SAL SRDALAKTVYSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEIITRTLDPVSALASRDALAKTVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK++IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKALIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             K+EINWSYIEFVDNQDV
Sbjct  476   KQEINWSYIEFVDNQDV  492



>ref|XP_006475525.1| PREDICTED: myosin-17-like isoform X3 [Citrus sinensis]
Length=1527

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVSSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_006475523.1| PREDICTED: myosin-17-like isoform X1 [Citrus sinensis]
 ref|XP_006475524.1| PREDICTED: myosin-17-like isoform X2 [Citrus sinensis]
Length=1530

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGNIEFAKG+E DSSVIKDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNIEFAKGEEADSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI RVMVTPEEVITRTLDP +A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   TTAELLKCDAKSLEDALINRVMVTPEEVITRTLDPVAAVSSRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNS++IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSRTIIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_006400612.1| hypothetical protein EUTSA_v10012431mg [Eutrema salsugineum]
 gb|ESQ42065.1| hypothetical protein EUTSA_v10012431mg [Eutrema salsugineum]
Length=1531

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KD+KSRFHL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDDKSRFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   ATAELLRCDAKSLEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>gb|KFK26281.1| hypothetical protein AALP_AA8G226900 [Arabis alpina]
Length=1531

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KD+KSRFHL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDDKSRFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VTAELLRCDAKSLEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|XP_009131798.1| PREDICTED: myosin-17-like [Brassica rapa]
Length=1533

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/377 (91%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFY+LCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYMLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KD+KSRFHL+
Sbjct  296   TEEYLATRRAMDVVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDDKSRFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   ATAELLRCDAKSLEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>emb|CDY66597.1| BnaCnng51610D, partial [Brassica napus]
Length=1522

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  111   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  170

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD+SGRISGAAVR
Sbjct  171   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDRSGRISGAAVR  230

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  231   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  290

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KDEKSRFHL+
Sbjct  291   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDEKSRFHLD  350

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKR MVTPEE+IT+TLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  351   ATAELLRCDAKSLEDALIKRAMVTPEEIITKTLDPDSATGSRDALAKTIYSRLFDWLVDK  410

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  411   INNSIGQDPNSKTIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  470

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  471   KEEINWSYIEFVDNKDV  487



>ref|XP_007024565.1| Myosin family protein with Dil domain isoform 3 [Theobroma cacao]
 gb|EOY27187.1| Myosin family protein with Dil domain isoform 3 [Theobroma cacao]
Length=1467

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ E+YKLG+PK+FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEDIERYKLGSPKTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI+++EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGINDQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   MTAELLRCDAQSLEDALIKRVMVTPEEIITRTLDPENAVASRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_002309201.1| hypothetical protein POPTR_0006s14790g [Populus trichocarpa]
 gb|EEE92724.1| hypothetical protein POPTR_0006s14790g [Populus trichocarpa]
Length=1539

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/377 (92%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYR MINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  125   MMEQYKGAAFGELSPHVFAVADVAYRQMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  184

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  185   MGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  244

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EERE+YKL NPKSFHYLNQ+NCY+LDGVND
Sbjct  245   TYLLERSRVCQVSDPERNYHCFYLLCAAPLEERERYKLENPKSFHYLNQTNCYKLDGVND  304

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKD+KSRFHLN
Sbjct  305   AEEYLATRRAMDIVGISEEEQEAIFRVVAAILHLGNIEFAKGEEIDSSVIKDQKSRFHLN  364

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +A+ SRDALAKT+YSRLFDW+V K
Sbjct  365   MTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPLAAVLSRDALAKTIYSRLFDWLVDK  424

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  425   INNSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  484

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  485   KEEINWSYIEFVDNQDV  501



>ref|XP_007024564.1| Myosin family protein with Dil domain isoform 2 [Theobroma cacao]
 gb|EOY27186.1| Myosin family protein with Dil domain isoform 2 [Theobroma cacao]
Length=1520

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ E+YKLG+PK+FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEDIERYKLGSPKTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI+++EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGINDQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   MTAELLRCDAQSLEDALIKRVMVTPEEIITRTLDPENAVASRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_007024563.1| Myosin family protein with Dil domain isoform 1 [Theobroma cacao]
 gb|EOY27185.1| Myosin family protein with Dil domain isoform 1 [Theobroma cacao]
Length=1524

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ E+YKLG+PK+FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEDIERYKLGSPKTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI+++EQE IFRVVAAILHLGNI FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGINDQEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   MTAELLRCDAQSLEDALIKRVMVTPEEIITRTLDPENAVASRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_009361663.1| PREDICTED: myosin-17-like [Pyrus x bretschneideri]
Length=1530

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 366/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRTGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEER+K+KLG+PK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEERDKFKLGDPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEYLATRRAMD+VGISEEEQ+ IF VVAAILHLGN+EFAKG++IDSSVIKDEKSRFHL 
Sbjct  296   GEEYLATRRAMDVVGISEEEQDAIFLVVAAILHLGNVEFAKGEDIDSSVIKDEKSRFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP SAL SRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEIITRTLDPVSALASRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK++IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKTLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010535820.1| PREDICTED: myosin-17 [Tarenaya hassleriana]
Length=1527

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/377 (92%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VA+RAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAFRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+P+S+HYLNQS  Y+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPQSYHYLNQSKYYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG E+DSSV+KDEKSRFHLN
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGPEVDSSVLKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD KSLEDALIKRVMVTPEEVITRTLDP+SALGSRDALAKT YSRLFDW+V+K
Sbjct  356   TVAELLKCDVKSLEDALIKRVMVTPEEVITRTLDPDSALGSRDALAKTTYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>emb|CDX70927.1| BnaC03g10110D [Brassica napus]
Length=1556

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/377 (91%), Positives = 367/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  135   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  194

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFDKSGRISGAAVR
Sbjct  195   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDKSGRISGAAVR  254

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS C++LDGV+D
Sbjct  255   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCFKLDGVDD  314

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQ+ IFRVVAA+LHLGN+EFAKG+EIDSSV+KD+KSRFHL+
Sbjct  315   TEEYLATRRAMDVVGISEEEQDAIFRVVAAVLHLGNVEFAKGKEIDSSVLKDDKSRFHLD  374

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CDAKSLEDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  375   TTAELLRCDAKSLEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  434

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  435   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  494

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  495   KEEINWSYIEFVDNKDV  511



>gb|KHN07928.1| Myosin-J heavy chain [Glycine soja]
Length=1545

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  131   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  190

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  191   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  250

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE+EKYKLG+P SFHYLNQS CY LDGV+D
Sbjct  251   TYLLERSRVCQLSDPERNYHCFYLLCAAPAEEKEKYKLGSPSSFHYLNQSKCYALDGVDD  310

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRV+AAILHLGNIEFAKG+EIDSSVI+DEKSRFHLN
Sbjct  311   AEEYLATRRAMDVVGISEEEQEAIFRVIAAILHLGNIEFAKGEEIDSSVIRDEKSRFHLN  370

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDW+V+K
Sbjct  371   VTAELLKCDCKSLEDALIKRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWLVEK  430

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  431   INNSIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  490

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  491   KEEIDWSYIEFVDNQDV  507



>ref|XP_009126449.1| PREDICTED: myosin-17 [Brassica rapa]
 ref|XP_009126450.1| PREDICTED: myosin-17 [Brassica rapa]
Length=1531

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD+SGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDRSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KDEKSRFHL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDEKSRFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKR MVTPEE+IT+TLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   ATAELLRCDAKSLEDALIKRAMVTPEEIITKTLDPDSATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|XP_006593940.1| PREDICTED: myosin-17-like [Glycine max]
Length=1530

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE+EKYKLG+P SFHYLNQS CY LDGV+D
Sbjct  236   TYLLERSRVCQLSDPERNYHCFYLLCAAPAEEKEKYKLGSPSSFHYLNQSKCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRV+AAILHLGNIEFAKG+EIDSSVI+DEKSRFHLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVIAAILHLGNIEFAKGEEIDSSVIRDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDW+V+K
Sbjct  356   VTAELLKCDCKSLEDALIKRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>emb|CDY45087.1| BnaA02g04890D [Brassica napus]
Length=1549

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  138   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  197

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD+SGRISGAAVR
Sbjct  198   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDRSGRISGAAVR  257

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+D
Sbjct  258   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVDD  317

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KDEKSRFHL+
Sbjct  318   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDEKSRFHLD  377

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDAKSLEDALIKR MVTPEE+IT+TLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  378   ATAELLRCDAKSLEDALIKRAMVTPEEIITKTLDPDSATGSRDALAKTIYSRLFDWLVDK  437

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  438   INNSIGQDPNSKTIIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  497

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  498   KEEINWSYIEFVDNKDV  514



>ref|XP_008776054.1| PREDICTED: myosin-17-like [Phoenix dactylifera]
Length=1530

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTIRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  KYKLGNP+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIAKYKLGNPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNIEFAKG EIDSSVIKDEKSRFHLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNIEFAKGPEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDALIKRVMVTPEEVITR+LDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLVCDAKGLEDALIKRVMVTPEEVITRSLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_011045952.1| PREDICTED: myosin-17-like [Populus euphratica]
Length=1530

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 364/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYR MINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRQMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   MGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EERE+YKL +PKSFHYLNQ+NCY+LDGVND
Sbjct  236   TYLLERSRVCQVSEPERNYHCFYLLCAAPLEERERYKLEDPKSFHYLNQTNCYKLDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQE IFRVVAAILHLGNIEFAKG+EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYLATRRAMDIVGISEEEQEAIFRVVAAILHLGNIEFAKGEEIDSSVIKDQKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +A+ SRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPLAAVLSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_008388505.1| PREDICTED: LOW QUALITY PROTEIN: myosin-17-like [Malus domestica]
Length=1530

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 365/377 (97%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAQFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRXGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCA+PPEER+K+KLG+PK FHYLNQS+CYELDG++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCASPPEERDKFKLGDPKQFHYLNQSSCYELDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
             GEEYLATRRAMD+VGISEEEQ+ IF VVAAILHLGN+EFAKG++IDSSVIKDEKSRFHL 
Sbjct  296   GEEYLATRRAMDVVGISEEEQDAIFLVVAAILHLGNVEFAKGEDIDSSVIKDEKSRFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP SAL SRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEIITRTLDPLSALASRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK++IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKTLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010937148.1| PREDICTED: myosin-17-like [Elaeis guineensis]
Length=1530

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTIRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  KYKLGNP+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIAKYKLGNPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVAAILHLGNIEFAKG EIDSSVIKDEKSRFHLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNIEFAKGPEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDALIKRVMVTPEEVITR+LDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLVCDAKGLEDALIKRVMVTPEEVITRSLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_006600449.1| PREDICTED: myosin-17-like [Glycine max]
Length=1530

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/377 (92%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE+EKYKLG+P SFHYLNQS  Y LDGV+D
Sbjct  236   TYLLERSRVCQLSDPERNYHCFYLLCAAPAEEKEKYKLGSPSSFHYLNQSKSYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRV+AAILHLGN+EFAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVIAAILHLGNVEFAKGEEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP +ALGSRDALAKT+YSRLFDW+V+K
Sbjct  356   VTAELLKCDCKSLEDALIKRVMVTPEEVITRTLDPVAALGSRDALAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_002514087.1| myosin XI, putative [Ricinus communis]
 gb|EEF48041.1| myosin XI, putative [Ricinus communis]
Length=1534

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/377 (93%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  120   MMEQYKGAGFGELSPHVFAVADVAYRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  179

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  180   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  239

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EER KYKL +PKSFHYLNQSNCY LDGV+D
Sbjct  240   TYLLERSRVCQISDPERNYHCFYLLCAAPLEERAKYKLEDPKSFHYLNQSNCYALDGVDD  299

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEY+ATRRAMDIVGISEEEQE IFRVVAA+LHLGNIEFAKG+EIDSSVIKDE+SRFHLN
Sbjct  300   AEEYIATRRAMDIVGISEEEQEAIFRVVAAVLHLGNIEFAKGKEIDSSVIKDERSRFHLN  359

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALIKRVMVTPEEVITRTLDP  AL SRDALAKT+YSRLFDW+V K
Sbjct  360   TTAELLKCDAKSLEDALIKRVMVTPEEVITRTLDPVGALVSRDALAKTIYSRLFDWLVDK  419

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  420   INNSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  479

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  480   KEEINWSYIEFVDNQDV  496



>ref|XP_010049440.1| PREDICTED: myosin-17-like [Eucalyptus grandis]
 gb|KCW82026.1| hypothetical protein EUGRSUZ_C03404 [Eucalyptus grandis]
Length=1528

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EERE+YKLG+P+SFH+LNQS+CYEL+G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEERERYKLGDPRSFHFLNQSSCYELNGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRVVAA+LHLGN+EFAKG EIDSSVIKDEKSR HLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVVAAVLHLGNVEFAKGPEIDSSVIKDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CD KSLEDA+IKRVMVTPEE+ITR LDP +ALGSRDALAKT+YSRLFDW+V K
Sbjct  356   TTAELLRCDVKSLEDAMIKRVMVTPEEIITRPLDPVAALGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|KCW82027.1| hypothetical protein EUGRSUZ_C03404 [Eucalyptus grandis]
Length=1529

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EERE+YKLG+P+SFH+LNQS+CYEL+G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEERERYKLGDPRSFHFLNQSSCYELNGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRVVAA+LHLGN+EFAKG EIDSSVIKDEKSR HLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVVAAVLHLGNVEFAKGPEIDSSVIKDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CD KSLEDA+IKRVMVTPEE+ITR LDP +ALGSRDALAKT+YSRLFDW+V K
Sbjct  356   TTAELLRCDVKSLEDAMIKRVMVTPEEIITRPLDPVAALGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010090105.1| Myosin-J heavy chain [Morus notabilis]
 gb|EXB38902.1| Myosin-J heavy chain [Morus notabilis]
Length=1565

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/377 (93%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  151   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  210

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  211   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  270

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+REKYKLGN K FHYLNQS+CYELDGV+D
Sbjct  271   TYLLERSRVCQISDPERNYHCFYLLCAAPHEDREKYKLGNRKEFHYLNQSSCYELDGVDD  330

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVAAILHLGN+ FAKG+EIDSSVIKDEKSRFHLN
Sbjct  331   AHEYLATRRAMDIVGISEQEQEAIFRVVAAILHLGNVNFAKGEEIDSSVIKDEKSRFHLN  390

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP +A+ SRDALAKTVYSRLFDW+V K
Sbjct  391   MTAELLKCDVKSLEDALIKRVMVTPEEVITRTLDPVAAVISRDALAKTVYSRLFDWLVDK  450

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  451   INISIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  510

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  511   KEEINWSYIEFVDNQDV  527



>ref|XP_004507972.1| PREDICTED: unconventional myosin-Va-like [Cicer arietinum]
Length=1530

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE+EKYKLG+P SFHYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPAEEKEKYKLGSPSSFHYLNQSNCYGLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQE IFRVVAA+LHLGN+EFAKG+EIDSSV+KDEKSRFHLN
Sbjct  296   AEEYLATRRAMDIVGISEEEQEAIFRVVAAVLHLGNVEFAKGEEIDSSVLKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP +A+ S+DA AKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDVKSLEDALIKRVMVTPEEVITRTLDPVAAISSKDAFAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|KCW82028.1| hypothetical protein EUGRSUZ_C03404 [Eucalyptus grandis]
Length=1561

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EERE+YKLG+P+SFH+LNQS+CYEL+G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEERERYKLGDPRSFHFLNQSSCYELNGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQE IFRVVAA+LHLGN+EFAKG EIDSSVIKDEKSR HLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQEAIFRVVAAVLHLGNVEFAKGPEIDSSVIKDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CD KSLEDA+IKRVMVTPEE+ITR LDP +ALGSRDALAKT+YSRLFDW+V K
Sbjct  356   TTAELLRCDVKSLEDAMIKRVMVTPEEIITRPLDPVAALGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|AAB71529.1| unconventional myosin [Helianthus annuus]
Length=1528

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+REK+KL +P+S+HYLNQS  + L+GVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDREKFKLESPQSYHYLNQSKSFALEGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI EEEQE IFRVVAAILHLGN+EFAKG+EIDSSV+KDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGIGEEEQEAIFRVVAAILHLGNVEFAKGKEIDSSVLKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAKSLEDALIKRVMVTPEEVITRTLDPE+ALGSRDALAKT+YSRLFDWIV+K
Sbjct  356   VTAELLMCDAKSLEDALIKRVMVTPEEVITRTLDPEAALGSRDALAKTIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKSLIGVLDIYGFESFKHNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>ref|XP_011007728.1| PREDICTED: myosin-17-like isoform X1 [Populus euphratica]
Length=1530

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ E+YKLG+PKSFHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPHEDIERYKLGSPKSFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQEGIFRVVAAILHLGN+ FAKGQEIDSSVIKDEKSRFHL+
Sbjct  296   SHEYLATRRAMDIVGISDQEQEGIFRVVAAILHLGNVNFAKGQEIDSSVIKDEKSRFHLS  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL+CDAKSLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKT+YSRLFDW+V K
Sbjct  356   ITSELLRCDAKSLEDALIKRVMVTPEEIITRTLDPENAVSSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDLNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_011007729.1| PREDICTED: myosin-17-like isoform X2 [Populus euphratica]
Length=1530

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ E+YKLG+PKSFHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPHEDIERYKLGSPKSFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQEGIFRVVAAILHLGN+ FAKGQEIDSSVIKDEKSRFHL+
Sbjct  296   SHEYLATRRAMDIVGISDQEQEGIFRVVAAILHLGNVNFAKGQEIDSSVIKDEKSRFHLS  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL+CDAKSLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKT+YSRLFDW+V K
Sbjct  356   ITSELLRCDAKSLEDALIKRVMVTPEEIITRTLDPENAVSSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDLNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_004287596.1| PREDICTED: unconventional myosin-Vb-like [Fragaria vesca subsp. 
vesca]
Length=1529

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/377 (91%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAPPE+REK+KLGNPK +HYLNQS+CY LDG++D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPPEDREKFKLGNPKEYHYLNQSSCYVLDGIDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEY ATRRAMD+VGIS+EEQ+ IF VVAAILHLGN+EFAKG+EIDSSVIKDEKSRFHL+
Sbjct  296   SEEYAATRRAMDVVGISDEEQDAIFMVVAAILHLGNVEFAKGEEIDSSVIKDEKSRFHLS  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCD KSLEDALIKRVMVTPEEVITRTLDP SAL SRDALAKTVYSRLFDW+V+K
Sbjct  356   TTAELLKCDPKSLEDALIKRVMVTPEEVITRTLDPASALASRDALAKTVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKSLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|KEH32467.1| DIL domain myosin family protein [Medicago truncatula]
Length=1530

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EEREK+KLGNP SFHYLNQS CY LDGV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPAEEREKFKLGNPSSFHYLNQSKCYLLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGISEEEQ+ IFRVVAA+LHLGNIEFAKG+EIDSSV+KDE SRFHLN
Sbjct  296   AEEYLATRRAMDVVGISEEEQDAIFRVVAAVLHLGNIEFAKGEEIDSSVVKDENSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LLKCDAKSLEDALI+RVMVTPEEVITRTLDP +AL SRDALAKT+YSRLFDW+V+K
Sbjct  356   TTAELLKCDAKSLEDALIQRVMVTPEEVITRTLDPVAALSSRDALAKTMYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPTSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_006369283.1| plant myosin MYS1 family protein [Populus trichocarpa]
 gb|ERP65852.1| plant myosin MYS1 family protein [Populus trichocarpa]
Length=1530

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/377 (92%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ E+YKLG+PKSFHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPLEDIERYKLGSPKSFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQEGIFRVVAAILHLGN+ FAKGQEIDSSVIKDEKSRFHL+
Sbjct  296   SHEYLATRRAMDIVGISDQEQEGIFRVVAAILHLGNVNFAKGQEIDSSVIKDEKSRFHLS  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL+CDAKSLEDALIKRVMVTPEE+ITRTLDPE+A+ SRDALAKT+YSRLFDW+V K
Sbjct  356   FTSELLRCDAKSLEDALIKRVMVTPEEIITRTLDPENAVSSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDLNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>emb|CDY51846.1| BnaA03g56130D [Brassica napus]
Length=1581

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/378 (90%), Positives = 366/378 (97%), Gaps = 1/378 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAY-RAMINEGKSNSILVSGESGAGKTETTKMLMRYLA  955
             MMEQYKGA FGELSPHVFA+A+VAY RAMINEGKSNSILVSGESGAGKTETTKMLMRYLA
Sbjct  160   MMEQYKGAGFGELSPHVFAIAEVAYSRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA  219

Query  954   YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAV  775
             YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFDKSGRISGAAV
Sbjct  220   YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDKSGRISGAAV  279

Query  774   RTYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVN  595
             RTYLLERSRVCQIS PERNYHCFY+LCAAPPEEREK+KLG+PKSFHYLNQS CY+LDGV+
Sbjct  280   RTYLLERSRVCQISDPERNYHCFYMLCAAPPEEREKFKLGDPKSFHYLNQSKCYKLDGVD  339

Query  594   DGEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHL  415
             D EEYLATRRAMD+VGISEEEQ+ IFRVVAAILHLGN+EFAKG+EIDSSV+KD+KSRFHL
Sbjct  340   DTEEYLATRRAMDVVGISEEEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDDKSRFHL  399

Query  414   NTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQ  235
             + TA+LL+CDAKSLEDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V 
Sbjct  400   DATAELLRCDAKSLEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVD  459

Query  234   KINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeey  55
             KIN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y
Sbjct  460   KINNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDY  519

Query  54    ekeEINWSYIEFVDNQDV  1
              KEEINWSYIEFVDN+DV
Sbjct  520   TKEEINWSYIEFVDNKDV  537



>ref|XP_010925047.1| PREDICTED: myosin-17-like isoform X3 [Elaeis guineensis]
Length=1531

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             L GRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LCGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  +YKLG+P+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIARYKLGSPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVA+ILHLGNIEFAKGQEIDSSVI+DEKSR HLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVASILHLGNIEFAKGQEIDSSVIRDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDAK LEDALIKRVMVTPEEVITRTLDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDAKGLEDALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFECNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>gb|KHF99916.1| Myosin-J heavy chain [Gossypium arboreum]
Length=1526

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/377 (91%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQS+CY LDGV+D
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSSCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLAT RAMD+VGISEEEQEGIF VVAAILHLGNI+F+KG E+DSSVIKDEKSRFHLN
Sbjct  296   AQEYLATIRAMDVVGISEEEQEGIFSVVAAILHLGNIDFSKGAEVDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CD KSLE+ALIKRVMVTPEE+ITR LDP +A+GSRDALAKT+YSRLFDW+V K
Sbjct  356   TTAELLQCDVKSLENALIKRVMVTPEEIITRALDPVAAVGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010925048.1| PREDICTED: myosin-17-like isoform X4 [Elaeis guineensis]
Length=1530

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             L GRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LCGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  +YKLG+P+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIARYKLGSPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVA+ILHLGNIEFAKGQEIDSSVI+DEKSR HLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVASILHLGNIEFAKGQEIDSSVIRDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDAK LEDALIKRVMVTPEEVITRTLDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDAKGLEDALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFECNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_006286886.1| hypothetical protein CARUB_v10000031mg [Capsella rubella]
 gb|EOA19784.1| hypothetical protein CARUB_v10000031mg [Capsella rubella]
Length=1531

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/377 (90%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KDEKSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDEKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDPESA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPESATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INISIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|XP_010925046.1| PREDICTED: myosin-17-like isoform X2 [Elaeis guineensis]
Length=1559

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             L GRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LCGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  +YKLG+P+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIARYKLGSPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVA+ILHLGNIEFAKGQEIDSSVI+DEKSR HLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVASILHLGNIEFAKGQEIDSSVIRDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDAK LEDALIKRVMVTPEEVITRTLDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDAKGLEDALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFECNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010925045.1| PREDICTED: myosin-17-like isoform X1 [Elaeis guineensis]
Length=1560

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/377 (91%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             L GRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LCGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  +YKLG+P+SFHYLNQSNC+ELDGVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIARYKLGSPRSFHYLNQSNCFELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVA+ILHLGNIEFAKGQEIDSSVI+DEKSR HLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVASILHLGNIEFAKGQEIDSSVIRDEKSRLHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDAK LEDALIKRVMVTPEEVITRTLDP SA+ SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDAKGLEDALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFECNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_007012726.1| Myosin family protein with Dil domain isoform 3 [Theobroma cacao]
 gb|EOY30345.1| Myosin family protein with Dil domain isoform 3 [Theobroma cacao]
Length=1345

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAM+NE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAGFGELSPHVFAVADVAYRAMMNEEKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  110   LGGRQGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG PKS+HYLNQSNCY LDGV+D
Sbjct  170   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVREKFKLGEPKSYHYLNQSNCYALDGVDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLAT RAMDIVGISEEEQE IF VVAAILHLGNIEFAKG ++DSSVIKDEKSRFHLN
Sbjct  230   TQEYLATIRAMDIVGISEEEQEAIFGVVAAILHLGNIEFAKGADVDSSVIKDEKSRFHLN  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP +A+ SRDALAKT+YSRLFDW+V K
Sbjct  290   VTAELLKCDVKSLEDALIKRVMVTPEEIITRTLDPVAAVSSRDALAKTIYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INFSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_010537575.1| PREDICTED: myosin-5 [Tarenaya hassleriana]
Length=1523

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG A GELSPHVFAVAD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGVALGELSPHVFAVADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKYKLGNP+SFHYLNQSNCY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYKLGNPQSFHYLNQSNCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI +EEQE IFRVVAAILHLGNI FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGIGDEEQEAIFRVVAAILHLGNINFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               ADLL CD++SLEDALIKRVMVTPEE+ITRTLDP++A+GSRDALAKT+YSRLFDWIV K
Sbjct  356   LAADLLMCDSQSLEDALIKRVMVTPEEIITRTLDPDNAIGSRDALAKTIYSRLFDWIVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INTSIGQDPSSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  476   KEEIDWSYIEFIDNQDV  492



>ref|XP_007012725.1| Myosin family protein with Dil domain isoform 2 [Theobroma cacao]
 gb|EOY30344.1| Myosin family protein with Dil domain isoform 2 [Theobroma cacao]
Length=1362

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAM+NE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAGFGELSPHVFAVADVAYRAMMNEEKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  110   LGGRQGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG PKS+HYLNQSNCY LDGV+D
Sbjct  170   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVREKFKLGEPKSYHYLNQSNCYALDGVDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLAT RAMDIVGISEEEQE IF VVAAILHLGNIEFAKG ++DSSVIKDEKSRFHLN
Sbjct  230   TQEYLATIRAMDIVGISEEEQEAIFGVVAAILHLGNIEFAKGADVDSSVIKDEKSRFHLN  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP +A+ SRDALAKT+YSRLFDW+V K
Sbjct  290   VTAELLKCDVKSLEDALIKRVMVTPEEIITRTLDPVAAVSSRDALAKTIYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INFSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_006843171.1| hypothetical protein AMTR_s00146p00059560 [Amborella trichopoda]
 gb|ERN04846.1| hypothetical protein AMTR_s00146p00059560 [Amborella trichopoda]
Length=1562

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/377 (91%), Positives = 358/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  149   MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  208

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSG EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR
Sbjct  209   LGGRSGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  268

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLC+APPE+ EKYKLGNP+SFHYLNQSNCY+LDGVND
Sbjct  269   TYLLERSRVCQISDPERNYHCFYLLCSAPPEDIEKYKLGNPRSFHYLNQSNCYQLDGVND  328

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE EQE IFRVVAAILHLGNIEFAKG+EIDSSV+KDEKSRFHL 
Sbjct  329   AHEYLATRRAMDIVGISEPEQEAIFRVVAAILHLGNIEFAKGKEIDSSVLKDEKSRFHLK  388

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD KSLEDAL +RVMVTPEEVITR LDP +A+ SRD LAKT+YSRLFDW+V K
Sbjct  389   MTAELLMCDEKSLEDALCRRVMVTPEEVITRDLDPVAAMISRDGLAKTIYSRLFDWLVDK  448

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  449   INVSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  508

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEF+DNQDV
Sbjct  509   KEEINWSYIEFIDNQDV  525



>ref|NP_001154724.1| Myosin XI K [Arabidopsis thaliana]
 gb|AED92852.1| Myosin XI K [Arabidopsis thaliana]
Length=1465

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  110   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KDEKSR+HL+
Sbjct  230   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDEKSRYHLD  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  290   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  350   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  410   KEEINWSYIEFVDNKDV  426



>ref|XP_010420885.1| PREDICTED: myosin-17 isoform X1 [Camelina sativa]
Length=1531

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/377 (89%), Positives = 361/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KD+KSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDDKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INISIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>gb|KHG24999.1| Myosin-J heavy chain [Gossypium arboreum]
Length=1606

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 362/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGATFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ E+YKLG+PK+F YLNQS+CYELDGVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIERYKLGSPKTFRYLNQSSCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI++EEQE IFRVVAAILHLGNI FAKG+EIDSSV+KDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGINDEEQESIFRVVAAILHLGNINFAKGKEIDSSVVKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEE+ITR+LDPE+A+ SRDALAKTVYSRLFDW+V K
Sbjct  356   MTAELLRCDAQSLEDALIKRVMVTPEEIITRSLDPENAVASRDALAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010033758.1| PREDICTED: myosin-17 isoform X1 [Eucalyptus grandis]
Length=1531

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/377 (90%), Positives = 363/377 (96%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHVFAVGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+  +YKLG+PKSFHYLNQS+CYEL+GVND
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPEEDIARYKLGSPKSFHYLNQSSCYELEGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGI+EEEQE IFRVVAAILHLGNI+FAKG+EIDSSVIKDEKSRFHLN
Sbjct  296   AHEYLATRRAMDIVGINEEEQEAIFRVVAAILHLGNIDFAKGKEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CDA+SLEDALIKRVMVTPEEVITRTLDP +A+GSRDALAKT+YSRLFDWIV+K
Sbjct  356   TTAELLRCDAQSLEDALIKRVMVTPEEVITRTLDPVNAIGSRDALAKTLYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INLSIGQDPTSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYS  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  476   KEEIDWSYIEFIDNQDV  492



>ref|XP_010493154.1| PREDICTED: myosin-17-like [Camelina sativa]
Length=1530

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG  FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGTGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KD+KSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDDKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INISIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|XP_008808271.1| PREDICTED: myosin-17-like [Phoenix dactylifera]
Length=1530

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/377 (91%), Positives = 359/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPHVFAVADVAYRAM NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELSPHVFAVADVAYRAMRNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             L GRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LCGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAPPE+  KYKL NP+SFHYLNQSNC+EL+GVND
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPPEDIAKYKLTNPRSFHYLNQSNCFELNGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGISE+EQE IFRVVAA+LHLGN+EFAKG EIDSSVIKDEKSRFHLN
Sbjct  296   SHEYLATRRAMDIVGISEQEQEAIFRVVAAVLHLGNVEFAKGPEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDAK LEDALIKRVMVTPEEVITRTLDP SA+ SRD LAKT+YSRLFDW+V+K
Sbjct  356   MTAELLMCDAKGLEDALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTLYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_010454349.1| PREDICTED: myosin-17-like [Camelina sativa]
Length=1531

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KD+KSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDDKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDA  +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VCAELLRCDANKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INISIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>sp|F4K5J1.2|MYO17_ARATH RecName: Full=Myosin-17; AltName: Full=Myosin XI K; Short=AtXIK 
[Arabidopsis thaliana]
 gb|ADV74830.1| myosin XI-K [Arabidopsis thaliana]
Length=1531

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KDEKSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDEKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  356   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|NP_197549.3| Myosin XI K [Arabidopsis thaliana]
 gb|AED92851.1| Myosin XI K [Arabidopsis thaliana]
Length=1545

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  130   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  189

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  190   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  249

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  250   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  309

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KDEKSR+HL+
Sbjct  310   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDEKSRYHLD  369

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  370   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  429

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  430   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  489

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  490   KEEINWSYIEFVDNKDV  506



>gb|KHG16924.1| Myosin-J heavy chain [Gossypium arboreum]
Length=1477

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/377 (89%), Positives = 359/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGEL+PHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAAFGELNPHVFAVADVAYRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDKSGRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKSGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE +EK+KLG+PKSFHYLNQS+CY LDGV+D
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVKEKFKLGDPKSFHYLNQSDCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+AT RAMD+VGISEEEQE IF VVAAILHLGN++FAKG E+DSSVIKDEKSRFHLN
Sbjct  296   AQEYIATIRAMDVVGISEEEQEAIFGVVAAILHLGNVDFAKGSEVDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDAL+KRVMVTPEE+I R LDP +A+GSRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLKCDVKSLEDALVKRVMVTPEEIIKRPLDPVAAVGSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_007012724.1| Myosin family protein with Dil domain isoform 1 [Theobroma cacao]
 gb|EOY30343.1| Myosin family protein with Dil domain isoform 1 [Theobroma cacao]
Length=1530

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAM+NE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYRAMMNEEKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR GVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  176   LGGRQGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG PKS+HYLNQSNCY LDGV+D
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVREKFKLGEPKSYHYLNQSNCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLAT RAMDIVGISEEEQE IF VVAAILHLGNIEFAKG ++DSSVIKDEKSRFHLN
Sbjct  296   TQEYLATIRAMDIVGISEEEQEAIFGVVAAILHLGNIEFAKGADVDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLEDALIKRVMVTPEE+ITRTLDP +A+ SRDALAKT+YSRLFDW+V K
Sbjct  356   VTAELLKCDVKSLEDALIKRVMVTPEEIITRTLDPVAAVSSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKQLIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_002873998.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50257.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1539

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/377 (89%), Positives = 360/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  129   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  188

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  189   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  248

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  249   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  308

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KD+KSR+HL+
Sbjct  309   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDDKSRYHLD  368

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAKT+YSRLFDW+V K
Sbjct  369   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDK  428

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  429   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  488

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  489   KEEINWSYIEFVDNKDV  505



>gb|KHG19111.1| Myosin-J heavy chain [Gossypium arboreum]
Length=1550

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/377 (90%), Positives = 358/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAY+AM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAVADVAYKAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE REK+KLG+PKSFHYLNQS+CY LDGV+D
Sbjct  236   TYLLERSRVCQISNPERNYHCFYLLCAAPPEVREKFKLGDPKSFHYLNQSSCYALDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYL T RAMDIVGISEEEQE IF VVAAILHLGNIEFAKG ++DSSVIKDEKSRFHLN
Sbjct  296   AQEYLTTIRAMDIVGISEEEQEAIFCVVAAILHLGNIEFAKGADVDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LLKCD KSLE++LIKRVMVTPEE+ITRTLDP +A GSRDAL+KT+YSRLFDW+V K
Sbjct  356   MTAELLKCDIKSLENSLIKRVMVTPEEIITRTLDPVAAFGSRDALSKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDPNSKQLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_004969407.1| PREDICTED: unconventional myosin-Vb-like isoform X1 [Setaria 
italica]
Length=1529

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/377 (88%), Positives = 358/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL +PKSFHYLNQS+C E+DG+ND
Sbjct  236   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDIQRYKLSDPKSFHYLNQSSCIEVDGIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LHLGNI+FAKG EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHLGNIDFAKGTEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD+K+LE  LI RV+VTPEE+ITRTLDP SA+ SRDALAKTVYSRLFDWIV+K
Sbjct  356   TAAELLKCDSKNLEKTLITRVIVTPEEIITRTLDPASAIASRDALAKTVYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +E INWSYIEFVDNQDV
Sbjct  476   REAINWSYIEFVDNQDV  492



>ref|XP_004969408.1| PREDICTED: unconventional myosin-Vb-like isoform X2 [Setaria 
italica]
Length=1527

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/377 (88%), Positives = 358/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL +PKSFHYLNQS+C E+DG+ND
Sbjct  236   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDIQRYKLSDPKSFHYLNQSSCIEVDGIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LHLGNI+FAKG EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHLGNIDFAKGTEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD+K+LE  LI RV+VTPEE+ITRTLDP SA+ SRDALAKTVYSRLFDWIV+K
Sbjct  356   TAAELLKCDSKNLEKTLITRVIVTPEEIITRTLDPASAIASRDALAKTVYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +E INWSYIEFVDNQDV
Sbjct  476   REAINWSYIEFVDNQDV  492



>ref|XP_010685344.1| PREDICTED: myosin-17-like [Beta vulgaris subsp. vulgaris]
Length=1525

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/377 (90%), Positives = 354/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA+ GELSPHVFAV DVAYRAMINEG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGASLGELSPHVFAVGDVAYRAMINEGRSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKL N KSFHYLNQS+CYEL+GVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPAEEIEKYKLRNRKSFHYLNQSSCYELEGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL  RRAMDIVGI+EEEQE IFRVVAAILHLGNI F KG EIDSS IKDE SRFHLN
Sbjct  296   AHEYLELRRAMDIVGINEEEQEAIFRVVAAILHLGNINFVKGDEIDSSAIKDENSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CDA+SLEDALIKRVMVTPEEVIT TLDP +AL SRDALAKT+YSRLFDWIV+K
Sbjct  356   VTAELLRCDAQSLEDALIKRVMVTPEEVITMTLDPVNALASRDALAKTIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INISIGQDPNSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYS  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_009400528.1| PREDICTED: myosin-17-like [Musa acuminata subsp. malaccensis]
Length=1530

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/377 (89%), Positives = 358/377 (95%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGATFGELSPHVFAVADVAYRAMINEAKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSG+EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRSGIEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP ++ E+YKLGNPKSFHYLNQSNC++LDGV+D
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPNKDIERYKLGNPKSFHYLNQSNCFKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEY+ATRRAMDIVGIS +EQE IFRVVAAILHLGNI+FAKG EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYIATRRAMDIVGISVQEQEAIFRVVAAILHLGNIDFAKGPEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDA+SLE+ALIKRVMVTPEEVITRTLDP SA+ SRD  +KT+YSRLFDW+V K
Sbjct  356   MTAELLMCDAQSLENALIKRVMVTPEEVITRTLDPASAIVSRDGFSKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKHLIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQD+
Sbjct  476   KEEINWSYIEFVDNQDM  492



>gb|EMS54666.1| Myosin-2 heavy chain [Triticum urartu]
Length=542

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/377 (84%), Positives = 352/377 (93%), Gaps = 3/377 (1%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYR MINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  155   MMEQYKGADFGELSPHVFAIADVAYREMINEGKNNSILVSGESGAGKTETTKMLMRYLAH  214

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQ   SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  215   LGGRSGVEGRTVEQQ---SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  271

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL + +SFHYLNQS+C E++G+ND
Sbjct  272   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDTQRYKLADARSFHYLNQSSCIEVEGIND  331

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LH+GNI FAKG+E+DSSVI+D+ SRFHLN
Sbjct  332   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHIGNINFAKGKEVDSSVIQDDNSRFHLN  391

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T ++LL+CD  +LE ALI R +VTPEE+ITRTLDPESAL SRDALAKT+YSRLFDWIV+K
Sbjct  392   TASELLECDCNNLEKALITREIVTPEEIITRTLDPESALASRDALAKTIYSRLFDWIVEK  451

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  452   INVSIGQDPNSKQLIGVLDIYGFESFKINSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  511

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  512   REEINWSYIEFVDNQDV  528



>ref|XP_006844844.1| hypothetical protein AMTR_s00058p00085120 [Amborella trichopoda]
 gb|ERN06519.1| hypothetical protein AMTR_s00058p00085120 [Amborella trichopoda]
Length=1534

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/377 (88%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   MGGRTGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKYKLGNPKSFHYLNQSNCY+L GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDTEKYKLGNPKSFHYLNQSNCYDLAGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQ+ IFRV+AAILHLGNI+FAKG+EIDSSV+KD+KSRFHL 
Sbjct  296   AHEYLATRRAMDIVGISQQEQDAIFRVIAAILHLGNIDFAKGEEIDSSVLKDDKSRFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDA++LEDAL KRVM+TPEEVITRTLDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDAQALEDALCKRVMITPEEVITRTLDPLGATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDQNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|KDO65127.1| hypothetical protein CISIN_1g0004211mg, partial [Citrus sinensis]
Length=368

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/350 (91%), Positives = 338/350 (97%), Gaps = 0/350 (0%)
 Frame = -2

Query  1050  MINEGKSNSILVSGESGAGKTETTKMLMRYLAYLGGRSGVEGRTVEQQVLESNPVLEAFG  871
             MINEGKSNSILVSGESGAGKTETTKMLMRYLAYLGGRSGVEGRTVEQQVLESNPVLEAFG
Sbjct  1     MINEGKSNSILVSGESGAGKTETTKMLMRYLAYLGGRSGVEGRTVEQQVLESNPVLEAFG  60

Query  870   NAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVRTYLLERSRVCQISTPERNYHCFYLLCA  691
             NAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+RTYLLERSRVCQIS PERNYHCFYLLCA
Sbjct  61    NAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIRTYLLERSRVCQISDPERNYHCFYLLCA  120

Query  690   APPEEREKYKLGNPKSFHYLNQSNCYELDGVNDGEEYLATRRAMDIVGISEEEQEGIFRV  511
             AP E+  KYKLG+PKSFHYLNQSNCYELDGV+D  EYLATRRAMDIVGIS++EQE IFRV
Sbjct  121   APHEDIAKYKLGSPKSFHYLNQSNCYELDGVSDAHEYLATRRAMDIVGISDQEQEAIFRV  180

Query  510   VAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLNTTADLLKCDAKSLEDALIKRVMVTPEE  331
             VAAILHLGNI+FAKG+EIDSSVIKDEKSRFHLN TA+LL+CDA+SLEDALIKRVMVTPEE
Sbjct  181   VAAILHLGNIDFAKGKEIDSSVIKDEKSRFHLNMTAELLRCDAQSLEDALIKRVMVTPEE  240

Query  330   VITRTLDPESALGSRDALAKTVYSRLFDWIVQKINISIGQDPNSKSIIGVLDIYGFESFK  151
             VITRTLDP +A+ SRDALAKT+YSRLFDWIV+KINISIGQDP+SKSIIGVLDIYGFESFK
Sbjct  241   VITRTLDPVNAVASRDALAKTIYSRLFDWIVEKINISIGQDPDSKSIIGVLDIYGFESFK  300

Query  150   QNSFEQFCINFTNEKLQQHFNQHVFKMeqeeyekeEINWSYIEFVDNQDV  1
              NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY +EEINWSYIEF+DNQDV
Sbjct  301   CNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYTREEINWSYIEFIDNQDV  350



>tpg|DAA58705.1| TPA: hypothetical protein ZEAMMB73_629283 [Zea mays]
Length=1529

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/377 (87%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHVFAIADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI++PERNYHCFY LCAAPPE  ++YKL +P+SFHYLNQS+C E+DG+ND
Sbjct  236   TYLLERSRVCQINSPERNYHCFYFLCAAPPEYTQRYKLSDPRSFHYLNQSSCIEVDGIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQEGIFRVVAA+LHLGNI FAKG EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYLATRRAMDIVGINEEEQEGIFRVVAAVLHLGNINFAKGTEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LLKCD ++LE ALI RV+VTPEEVITRTLDP SA+ SRDALAK +YSRLFDWIV+K
Sbjct  356   IAAELLKCDCQNLEKALITRVIVTPEEVITRTLDPASAVASRDALAKIIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  476   REEINWSYIEFVDNQDV  492



>ref|XP_002458046.1| hypothetical protein SORBIDRAFT_03g026110 [Sorghum bicolor]
 gb|EES03166.1| hypothetical protein SORBIDRAFT_03g026110 [Sorghum bicolor]
Length=1529

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/377 (87%), Positives = 355/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  167   MMEQYKGADFGELSPHVFAIADTAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  226

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  227   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  286

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI++PERNYHCFY LCAAPPEE ++YKL +P+SFHYLNQS+C E+DG+ND
Sbjct  287   TYLLERSRVCQINSPERNYHCFYFLCAAPPEETQRYKLSDPRSFHYLNQSSCIEVDGIND  346

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LHLGNI FAKG EIDSSVIKD+KSRFHLN
Sbjct  347   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHLGNINFAKGTEIDSSVIKDDKSRFHLN  406

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD ++LE ALI RV+VTPEEVITRTLDP SAL SRDALAK +Y RLFDWIV+K
Sbjct  407   TAAELLKCDCQNLEKALITRVIVTPEEVITRTLDPASALASRDALAKIIYCRLFDWIVEK  466

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  467   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  526

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  527   REEINWSYIEFVDNQDV  543



>emb|CDX91798.1| BnaC08g07170D [Brassica napus]
Length=504

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/375 (85%), Positives = 343/375 (91%), Gaps = 0/375 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  123   MMQQYKGAPFGELNPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  182

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  183   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  242

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL G++D
Sbjct  243   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCYELVGISD  302

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE EQE IFRVVAAILH+GN+EF KG+E+DSSV KD+K++FHL 
Sbjct  303   AHDYLATRRAMDIVGISENEQEAIFRVVAAILHIGNVEFTKGKEVDSSVPKDDKAKFHLK  362

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL K VMV PEEVI R+LDPESA+ SRD LAKTVYSRLFDW+V K
Sbjct  363   TAAELLMCDLKALEDALCKLVMVRPEEVIKRSLDPESAVTSRDGLAKTVYSRLFDWLVNK  422

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  423   INNSIGQDANSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  482

Query  51    keEINWSYIEFVDNQ  7
             KE I+WSYIEFVDN+
Sbjct  483   KEAIDWSYIEFVDNK  497



>ref|XP_010087698.1| Myosin-J heavy chain [Morus notabilis]
 gb|EXB29686.1| Myosin-J heavy chain [Morus notabilis]
Length=1544

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/377 (88%), Positives = 356/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAV D AYRAMINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  173   MMEQYKGAPFGELSPHVFAVGDAAYRAMINEGKNNSILVSGESGAGKTETTKMLMRYLAF  232

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG SGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD+ GRISGAA+R
Sbjct  233   LGGHSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDEKGRISGAAIR  292

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ E+YKLG+P+ FHYLNQSNCYELDGVND
Sbjct  293   TYLLERSRVCQISDPERNYHCFYLLCAAPQEDIERYKLGSPRLFHYLNQSNCYELDGVND  352

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDI+GISEEEQE IFR+VAAILHLGNI+F+KG+EIDSSVIKD++SRFHLN
Sbjct  353   SHEYLATRRAMDIIGISEEEQESIFRIVAAILHLGNIDFSKGEEIDSSVIKDDESRFHLN  412

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDA+SLE+ALIKRVMVTPEEVIT+TLDP +A  SRDALAKT+YSRLFDW+V K
Sbjct  413   MTAELLGCDAQSLEEALIKRVMVTPEEVITKTLDPLNATASRDALAKTIYSRLFDWLVDK  472

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDPNSKS IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  473   INISIGQDPNSKSTIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  532

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  533   KEEIDWSYIEFVDNQDV  549



>ref|XP_010696561.1| PREDICTED: myosin-17-like [Beta vulgaris subsp. vulgaris]
Length=1561

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/377 (88%), Positives = 355/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA FGELSPHVFA+AD +YRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMGQYKGAGFGELSPHVFAIADASYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK G+ISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKHGKISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S+PERNYHCFYLLCAAP E REKYKL NP+ FHYLNQ++CY+LDGV+D
Sbjct  236   TYLLERSRVCQVSSPERNYHCFYLLCAAPQEVREKYKLDNPEKFHYLNQTDCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGIS E+QE IFRVVAAILH+GN+ F+KG E+DSSV+KDEKSRFHL+
Sbjct  296   TEEYLATRRAMDVVGISAEDQEAIFRVVAAILHIGNVNFSKGTEVDSSVLKDEKSRFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL+CD KSLEDALIKRVMVTPEEVITRTLDP+SA  SRDALAKT+YSRLFDW+V K
Sbjct  356   MTAELLRCDVKSLEDALIKRVMVTPEEVITRTLDPDSATVSRDALAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPTSKSIIGVLDIYGFESFKFNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_004170464.1| PREDICTED: myosin-2 heavy chain-like, partial [Cucumis sativus]
Length=528

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA  GEL PHVFA+ADVAYRAMIN GKSNSILVSGESGAGKTETTKMLM YLA+
Sbjct  146   VMEKYKGAPIGELKPHVFAIADVAYRAMINYGKSNSILVSGESGAGKTETTKMLMCYLAF  205

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG +  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  206   LGGHAASEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKKGRISGAAIR  265

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPP+ERE+YKLGNPKSFHYLNQSNCYEL GVND
Sbjct  266   TYLLERSRVCQISDPERNYHCFYLLCAAPPQERERYKLGNPKSFHYLNQSNCYELAGVND  325

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLAT+RAMDIVGI E+EQ+ IFRVVAAILHLGNIEFAKG+E DSS +KDE+S+FHL+
Sbjct  326   AHDYLATKRAMDIVGIGEQEQDAIFRVVAAILHLGNIEFAKGEESDSSFVKDEESKFHLH  385

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KR+MVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  386   MTAELLMCDPNALEDALCKRMMVTPEEVIKRSLDPHGATVSRDGLAKTIYSRLFDWLVDK  445

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESF+ NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  446   INVSIGQDPCSKYLIGVLDIYGFESFQTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYV  505

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  506   KEEIDWSYIEFVDNQDV  522



>ref|XP_006416687.1| hypothetical protein EUTSA_v10006551mg [Eutrema salsugineum]
 gb|ESQ35040.1| hypothetical protein EUTSA_v10006551mg [Eutrema salsugineum]
Length=1510

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/377 (87%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG   GELSPHVFA+ D AYRAMINEGK+NSILVSGESGAGKTETTKMLMRYLAY
Sbjct  113   MMEQYKGIGLGELSPHVFAIGDAAYRAMINEGKNNSILVSGESGAGKTETTKMLMRYLAY  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+LGNP+SFHYLNQS CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLGNPRSFHYLNQSTCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F KG+EIDSSVIKDE SRFHLN
Sbjct  293   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDENSRFHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+ITRTLDPE+A+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCNAQSLEDALIRRVMVTPEEIITRTLDPENAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_009415341.1| PREDICTED: myosin-17-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=1529

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/377 (88%), Positives = 354/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQY+GAAFGELSPHVFAVADVAYRAMINEGK NSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYQGAAFGELSPHVFAVADVAYRAMINEGKRNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSG+EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD +GRISGAA+R
Sbjct  176   LGGRSGIEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP  E EKYKLG+P+SFHYLNQS C++LDGV++
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPHVEIEKYKLGSPQSFHYLNQSKCFKLDGVDE  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYL+TRRAMDIVGISE EQE IF+VVAAILH+GNI+FAKG EIDSSVIKDEKSRFHLN
Sbjct  296   AQEYLSTRRAMDIVGISEHEQEAIFKVVAAILHIGNIDFAKGPEIDSSVIKDEKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CD K LE+ALIKRVMVTPEEVITRTLDP SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   MAAELLMCDVKGLENALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKCNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_009415340.1| PREDICTED: myosin-17-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=1530

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/377 (88%), Positives = 354/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQY+GAAFGELSPHVFAVADVAYRAMINEGK NSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEQYQGAAFGELSPHVFAVADVAYRAMINEGKRNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSG+EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD +GRISGAA+R
Sbjct  177   LGGRSGIEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDNNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP  E EKYKLG+P+SFHYLNQS C++LDGV++
Sbjct  237   TYLLERSRVCQINDPERNYHCFYLLCAAPHVEIEKYKLGSPQSFHYLNQSKCFKLDGVDE  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYL+TRRAMDIVGISE EQE IF+VVAAILH+GNI+FAKG EIDSSVIKDEKSRFHLN
Sbjct  297   AQEYLSTRRAMDIVGISEHEQEAIFKVVAAILHIGNIDFAKGPEIDSSVIKDEKSRFHLN  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CD K LE+ALIKRVMVTPEEVITRTLDP SA+ SRD LAKTVYSRLFDW+V K
Sbjct  357   MAAELLMCDVKGLENALIKRVMVTPEEVITRTLDPASAIVSRDGLAKTVYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPNSKSLIGVLDIYGFESFKCNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  477   KEEINWSYIEFVDNQDV  493



>ref|NP_001104925.1| myosin1 [Zea mays]
 gb|AAD17931.2| unconventional myosin heavy chain [Zea mays]
Length=1529

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 354/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPH FA+ADVAYRAM NEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHDFAIADVAYRAMDNEGKSNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI++PERNYHCFY LCAAPPE  ++YKL +P+SFHYLNQS+C E+DG+ND
Sbjct  236   TYLLERSRVCQINSPERNYHCFYFLCAAPPEYTQRYKLSDPRSFHYLNQSSCIEVDGIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQEGIFRVVAA+LHLGNI FAKG EIDSSVIKD+KSRFHLN
Sbjct  296   AEEYLATRRAMDIVGINEEEQEGIFRVVAAVLHLGNINFAKGTEIDSSVIKDDKSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LLKCD ++LE ALI RV+VTPEEVITRTLDP SA+ SRDALAK +YSRLFDWIV+K
Sbjct  356   IAAELLKCDCQNLEKALITRVIVTPEEVITRTLDPASAVASRDALAKIIYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  476   REEINWSYIEFVDNQDV  492



>gb|KGN44700.1| hypothetical protein Csa_7G372940 [Cucumis sativus]
Length=528

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA  GEL PHVFA+ADVAYRAMIN GKSNSILVSGESGAGKTETTKMLM YLA+
Sbjct  116   VMEKYKGAPIGELKPHVFAIADVAYRAMINYGKSNSILVSGESGAGKTETTKMLMCYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG +  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHAASEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS  ERNYHCFYLLCAAPP+ERE+YKLGNPKSFHYLNQSNCYEL GVND
Sbjct  236   TYLLERSRVCQISDLERNYHCFYLLCAAPPQERERYKLGNPKSFHYLNQSNCYELAGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLAT+RAMDIVGI E+EQ+ IFRVVAAILHLGNIEFAKG+E DSS +KDE+S+FHL+
Sbjct  296   AHDYLATKRAMDIVGIGEQEQDAIFRVVAAILHLGNIEFAKGEESDSSFVKDEESKFHLH  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KR+MVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDPNALEDALCKRMMVTPEEVIKRSLDPHGATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESF+ NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPCSKYLIGVLDIYGFESFQTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYV  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_011078051.1| PREDICTED: LOW QUALITY PROTEIN: myosin-17-like [Sesamum indicum]
Length=1535

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/384 (89%), Positives = 356/384 (93%), Gaps = 8/384 (2%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVS---GESGAGKTETTKMLMRY  961
             MMEQYKGAA GELSPHVFA+ADVAYR  + +  +N   +S   GESGAGKTETTKMLMRY
Sbjct  116   MMEQYKGAALGELSPHVFAIADVAYRXYLMK-HANYFCLSFPFGESGAGKTETTKMLMRY  174

Query  960   LAYLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGA  781
             LA+LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGA
Sbjct  175   LAHLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGA  234

Query  780   AVRTYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDG  601
             AVRTYLLERSRVCQIS PERNYHCFYLLCAAP EEREKYKLG+P+SFHYLNQS  Y LDG
Sbjct  235   AVRTYLLERSRVCQISDPERNYHCFYLLCAAPAEEREKYKLGSPESFHYLNQSKYYTLDG  294

Query  600   VNDGEEYLATRRAMDIVGISEEEQ----EGIFRVVAAILHLGNIEFAKGQEIDSSVIKDE  433
             V+D EEYLATRRAMDIVGISEE      E IFRVVAAILHLGNIEFAKG+EIDSSVIKDE
Sbjct  295   VSDAEEYLATRRAMDIVGISEEXXXXFPEAIFRVVAAILHLGNIEFAKGKEIDSSVIKDE  354

Query  432   KSRFHLNTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRL  253
             KSRFHLNTTA+LLKCD KSLEDALIKRVMVTPEEVITRTLDPE ALGSRDALAKT+YSRL
Sbjct  355   KSRFHLNTTAELLKCDPKSLEDALIKRVMVTPEEVITRTLDPEGALGSRDALAKTIYSRL  414

Query  252   FDWIVQKINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFK  73
             FDWIV KINISIGQDPNSK+IIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFK
Sbjct  415   FDWIVDKINISIGQDPNSKAIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFK  474

Query  72    MeqeeyekeEINWSYIEFVDNQDV  1
             MEQE+YEKE+INWSYIEFVDNQDV
Sbjct  475   MEQEDYEKEQINWSYIEFVDNQDV  498



>emb|CDX81833.1| BnaC08g37680D [Brassica napus]
Length=1465

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG   GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  124   MMEQYKGIGLGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  183

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  184   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKHGRISGAAIR  243

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKLGNP+SFHYLNQS+CYELDGV+D
Sbjct  244   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLGNPQSFHYLNQSSCYELDGVDD  303

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F  G+EIDSSVIKDE SRFHLN
Sbjct  304   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGLGEEIDSSVIKDENSRFHLN  363

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+AKSLEDALI+RVMVTPEE+IT+TLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  364   LAAELLMCNAKSLEDALIRRVMVTPEEIITKTLDPDNAIASRDTLAKTIYSHLFDWIVNK  423

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  424   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  483

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  484   KEEIDWSYIEFIDNQDV  500



>ref|XP_006426607.1| hypothetical protein CICLE_v10024696mg [Citrus clementina]
 gb|ESR39847.1| hypothetical protein CICLE_v10024696mg [Citrus clementina]
Length=1531

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/378 (88%), Positives = 355/378 (94%), Gaps = 1/378 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAM-INEGKSNSILVSGESGAGKTETTKMLMRYLA  955
             MMEQYKGAAFGELSPHVFAV D AYRA  + + K+     SGESGAGKTETTKMLMRYLA
Sbjct  116   MMEQYKGAAFGELSPHVFAVGDAAYRANDLMKAKATLFWFSGESGAGKTETTKMLMRYLA  175

Query  954   YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAV  775
             YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+
Sbjct  176   YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAI  235

Query  774   RTYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVN  595
             RTYLLERSRVCQIS PERNYHCFYLLCAAP E+  KYKLG+PKSFHYLNQSNCYELDGV+
Sbjct  236   RTYLLERSRVCQISDPERNYHCFYLLCAAPHEDIAKYKLGSPKSFHYLNQSNCYELDGVS  295

Query  594   DGEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHL  415
             D  EYLATRRAMDIVGIS++EQE IFRVVAAILHLGNI+FAKG+EIDSSVIKDEKSRFHL
Sbjct  296   DAHEYLATRRAMDIVGISDQEQEAIFRVVAAILHLGNIDFAKGKEIDSSVIKDEKSRFHL  355

Query  414   NTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQ  235
             N TA+LL+CDA+SLEDALIKRVMVTPEEVITRTLDP +A+ SRDALAKT+YSRLFDWIV+
Sbjct  356   NMTAELLRCDAQSLEDALIKRVMVTPEEVITRTLDPVNAVASRDALAKTIYSRLFDWIVE  415

Query  234   KINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeey  55
             KINISIGQDP+SKSIIGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY
Sbjct  416   KINISIGQDPDSKSIIGVLDIYGFESFQCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEY  475

Query  54    ekeEINWSYIEFVDNQDV  1
              +EEINWSYIEF+DNQDV
Sbjct  476   TREEINWSYIEFIDNQDV  493



>ref|XP_006300645.1| hypothetical protein CARUB_v10019655mg [Capsella rubella]
 gb|EOA33543.1| hypothetical protein CARUB_v10019655mg [Capsella rubella]
Length=1470

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  60    MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  119

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  120   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  179

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  180   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  239

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVG+SE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KDEKS+FHLN
Sbjct  240   AHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDEKSKFHLN  299

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V+K
Sbjct  300   TVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEK  359

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  360   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  419

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  420   KEAIDWSYIEFVDNQDV  436



>ref|XP_011080292.1| PREDICTED: myosin-11-like [Sesamum indicum]
Length=1512

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 353/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+AD+AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEQYKGAPFGELSPHVFAIADMAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  177   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLGNPKTFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS++EQ+ IFRVVA+ILH+GNIEFAKG+EIDSSV+K+++S+FHL 
Sbjct  297   AHDYLATRRAMDVVGISQKEQDAIFRVVASILHIGNIEFAKGKEIDSSVLKNDQSKFHLK  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL+KRVMVTPEEVI R+LDP+ AL SRD LAKTVYSRLFDW+V K
Sbjct  357   TVAELLMCDPVALEDALLKRVMVTPEEVIKRSLDPDGALVSRDGLAKTVYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPNSKCLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             +EEI+WSYIEFVDNQDV
Sbjct  477   REEIDWSYIEFVDNQDV  493



>ref|XP_010414902.1| PREDICTED: myosin-11 [Camelina sativa]
Length=1526

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVG+SE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KDEK++FHLN
Sbjct  296   AHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDEKAKFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V+K
Sbjct  356   TVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>ref|XP_009117656.1| PREDICTED: myosin-5 isoform X2 [Brassica rapa]
Length=1512

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG   GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKGIGLGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKHGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKLGNP+SFHYLNQS+CYELDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLGNPQSFHYLNQSSCYELDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F  G+EIDSSVIKDE SRFHLN
Sbjct  293   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGLGEEIDSSVIKDENSRFHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+IT+TLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCNAQSLEDALIRRVMVTPEEIITKTLDPDNAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_009117654.1| PREDICTED: myosin-5 isoform X1 [Brassica rapa]
Length=1513

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG   GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  114   MMEQYKGIGLGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  173

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  174   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKHGRISGAAIR  233

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKLGNP+SFHYLNQS+CYELDGV+D
Sbjct  234   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLGNPQSFHYLNQSSCYELDGVDD  293

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F  G+EIDSSVIKDE SRFHLN
Sbjct  294   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGLGEEIDSSVIKDENSRFHLN  353

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+IT+TLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  354   LAAELLMCNAQSLEDALIRRVMVTPEEIITKTLDPDNAIASRDTLAKTIYSHLFDWIVNK  413

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  414   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  473

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  474   KEEIDWSYIEFIDNQDV  490



>emb|CDY21744.1| BnaA09g44950D [Brassica napus]
Length=1516

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG   GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  121   MMEQYKGIGLGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  180

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  181   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKHGRISGAAIR  240

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKLGNP+SFHYLNQS+CYELDGV+D
Sbjct  241   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLGNPQSFHYLNQSSCYELDGVDD  300

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F  G+EIDSSVIKDE SRFHLN
Sbjct  301   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGLGEEIDSSVIKDENSRFHLN  360

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+IT+TLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  361   LAAELLMCNAQSLEDALIRRVMVTPEEIITKTLDPDNAIASRDTLAKTIYSHLFDWIVNK  420

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  421   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  480

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  481   KEEIDWSYIEFIDNQDV  497



>ref|XP_009628316.1| PREDICTED: myosin-9-like isoform X4 [Nicotiana tomentosiformis]
Length=1398

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  117   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  177   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLENPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGISE+EQE IFRVVA++LHLGNI F+KGQEIDSSV+KD+KS FHL 
Sbjct  297   AQDYLATRRAMDIVGISEKEQEAIFRVVASVLHLGNINFSKGQEIDSSVLKDDKSNFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD   LEDAL+KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TVAELLACDLNDLEDALLKRVMVTPEEVIKRSLDPNAAAVSRDGLAKTIYSRLFDWLVNK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_010274858.1| PREDICTED: myosin-9-like [Nelumbo nucifera]
Length=1530

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK GRISGAAVR
Sbjct  176   LGGRAGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKHGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E  EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEVTEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGISE++Q+ IF+V+AAILHLGNI+F+KG+E+DSSV+KD+KS+FHL 
Sbjct  296   AHDYLATRRAMDVVGISEKDQDAIFKVIAAILHLGNIDFSKGKEVDSSVLKDDKSKFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD+ +LEDAL KRVMVTPEEVI R+LDP++A  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDSHALEDALCKRVMVTPEEVIKRSLDPQAATISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN +IGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFAIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I WSYIEFVDNQDV
Sbjct  476   KEQIEWSYIEFVDNQDV  492



>ref|XP_009763175.1| PREDICTED: myosin-9-like [Nicotiana sylvestris]
Length=1529

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  116   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGISE+EQE IFRVVA++LHLGNI F+KGQEIDSSV+KD+KS+FHL 
Sbjct  296   AQDYLATRRAMDIVGISEKEQEAIFRVVASVLHLGNINFSKGQEIDSSVLKDDKSKFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD   LEDAL+KRVMVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TVAELLACDLNDLEDALLKRVMVTPEEVIKRSLDPNGAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_010096435.1| Myosin-J heavy chain [Morus notabilis]
 gb|EXB64106.1| Myosin-J heavy chain [Morus notabilis]
Length=1531

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/377 (88%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVAAILH+GNI+F KG+EIDSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAKEQEAIFRVVAAILHIGNIKFTKGKEIDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDA +LEDAL KRVM+TPEEVI RTLDPESA  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDADALEDALCKRVMITPEEVIKRTLDPESAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INFSIGQDANSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_010470351.1| PREDICTED: myosin-11-like [Camelina sativa]
Length=1526

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVG+SE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHLN
Sbjct  296   AHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V+K
Sbjct  356   TVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>gb|EEC75961.1| hypothetical protein OsI_13067 [Oryza sativa Indica Group]
Length=1613

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/377 (87%), Positives = 353/377 (94%), Gaps = 3/377 (1%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  120   MMEQYKGADFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  179

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQ   SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  180   LGGRSGVEGRTVEQQ---SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL + +SFHYLNQS+C E++G+ND
Sbjct  237   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDTQRYKLADARSFHYLNQSSCIEVEGIND  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAAILHLGNI FAKG EIDSSVIKD+KSRFHLN
Sbjct  297   AEEYLATRRAMDIVGINEEEQEAIFRVVAAILHLGNINFAKGTEIDSSVIKDDKSRFHLN  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD  +LE ALI RV+VTPEE+ITRTLDP SAL SRDALAKT+YSRLFDWIV+K
Sbjct  357   TAAELLKCDCDNLEKALITRVIVTPEEIITRTLDPASALVSRDALAKTIYSRLFDWIVEK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPNSKQLIGVLDIYGFESFKINSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  477   REEINWSYIEFVDNQDV  493



>ref|NP_001057670.1| Os06g0488200 [Oryza sativa Japonica Group]
 dbj|BAD37694.1| putative myosin heavy chain PCR43 [Oryza sativa Japonica Group]
 dbj|BAF19584.1| Os06g0488200 [Oryza sativa Japonica Group]
Length=1529

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI+EGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMIHEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGNPKTFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E+DSSV+KD+KS+FHL+
Sbjct  296   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEVDSSVLKDDKSKFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD+ +L DAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDSGALGDALCKRVMVTPEEVIKRSLDPYNATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_010511196.1| PREDICTED: myosin-11-like [Camelina sativa]
 ref|XP_010511197.1| PREDICTED: myosin-11-like [Camelina sativa]
 ref|XP_010511198.1| PREDICTED: myosin-11-like [Camelina sativa]
 ref|XP_010511199.1| PREDICTED: myosin-11-like [Camelina sativa]
Length=1526

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVG+SE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHLN
Sbjct  296   AHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V+K
Sbjct  356   TVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>ref|XP_008785355.1| PREDICTED: myosin-11-like [Phoenix dactylifera]
Length=1527

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+ IFRVVAAILHLGNI+FAKG+EIDSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAQEQDAIFRVVAAILHLGNIDFAKGKEIDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD + LEDAL KRVMVTPEEVI R+LDP  A  SRD LAKT+YSRLFDWIV K
Sbjct  356   MTAELLMCDPQELEDALCKRVMVTPEEVIKRSLDPLGATVSRDGLAKTIYSRLFDWIVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP S S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPTSSSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>gb|AER51968.1| myosin XIK [Arabidopsis thaliana]
Length=1531

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/377 (87%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+A+VAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEQYKGAGFGELSPHVFAIAEVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVE+QFD  GRISGAAVR
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPEEREK+KLG+PK FHYLNQS CY+LDGV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEEREKFKLGDPKLFHYLNQSKCYKLDGVDD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGISEEEQ+ IFRVVAAILHLGN+ FAKG+EIDSSV+KDEKSR+HL+
Sbjct  296   TEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGKEIDSSVLKDEKSRYHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL+CDAK +EDALIKRVMVTPEEVITRTLDP+SA GSRDALAK         +V K
Sbjct  356   VCAELLRCDAKKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKLSIHAWLIGLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK+IIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQE+Y 
Sbjct  416   INNSIGQDPNSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDN+DV
Sbjct  476   KEEINWSYIEFVDNKDV  492



>ref|XP_009411029.1| PREDICTED: myosin-9-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=1464

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA  GELSPHVFAVADVAYRAMINEGK NSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMTQYKGAPLGELSPHVFAVADVAYRAMINEGKRNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQF++ G+ISGAA+R
Sbjct  110   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFNRQGKISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAPPEE EKYKLG PKSFHYLNQSNCYEL GV+D
Sbjct  170   TYLLERSRVCQVSDPERNYHCFYLLCAAPPEEIEKYKLGPPKSFHYLNQSNCYELVGVSD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+ IFRVVAAILHLGNI+FAKG+EIDSSV+KD+KS+FHL 
Sbjct  230   AHDYLATRRAMDIVGISAQEQDAIFRVVAAILHLGNIDFAKGKEIDSSVLKDDKSKFHLK  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TADLL CD+++LEDAL KRVM+TPEEVI R LDP +A  SRD LAKT+YSRLFDWIV K
Sbjct  290   MTADLLMCDSEALEDALCKRVMITPEEVIKRPLDPLAATVSRDGLAKTIYSRLFDWIVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INVSIGQDPTSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_007030493.1| Myosin family protein with Dil domain [Theobroma cacao]
 gb|EOY10995.1| Myosin family protein with Dil domain [Theobroma cacao]
Length=1544

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  133   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  192

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  193   LGGRVATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  252

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE E+YKLGNPK+FHYLNQS CYEL GV+D
Sbjct  253   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIERYKLGNPKTFHYLNQSRCYELVGVSD  312

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVA+ILHLGNI+FAKG+E+DSSV K+E+++FHL 
Sbjct  313   AHDYLATRRAMDIVGISEKEQEAIFRVVASILHLGNIDFAKGKEVDSSVPKNEQAKFHLK  372

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDAK+LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  373   TTAELLMCDAKALEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVNK  432

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  433   INKSIGQDPNSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  492

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  493   KEQIDWSYIEFVDNQDV  509



>gb|EEE59719.1| hypothetical protein OsJ_12150 [Oryza sativa Japonica Group]
Length=1614

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/377 (87%), Positives = 353/377 (94%), Gaps = 3/377 (1%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  131   MMEQYKGADFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAH  190

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQ   SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  191   LGGRSGVEGRTVEQQ---SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  247

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL + +SFHYLNQS+C E++G+ND
Sbjct  248   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDTQRYKLADARSFHYLNQSSCIEVEGIND  307

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAAILHLGNI FAKG EIDSSVIKD+KSRFHLN
Sbjct  308   AEEYLATRRAMDIVGINEEEQEAIFRVVAAILHLGNINFAKGTEIDSSVIKDDKSRFHLN  367

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD  +LE ALI RV+VTPEE+ITRTLDP SAL SRDALAKT+YSRLFDWIV+K
Sbjct  368   TAAELLKCDCDNLEKALITRVIVTPEEIITRTLDPASALVSRDALAKTIYSRLFDWIVEK  427

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  428   INVSIGQDPNSKQLIGVLDIYGFESFKINSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  487

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  488   REEINWSYIEFVDNQDV  504



>ref|XP_009411028.1| PREDICTED: myosin-9-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=1473

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA  GELSPHVFAVADVAYRAMINEGK NSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMTQYKGAPLGELSPHVFAVADVAYRAMINEGKRNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQF++ G+ISGAA+R
Sbjct  110   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFNRQGKISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAPPEE EKYKLG PKSFHYLNQSNCYEL GV+D
Sbjct  170   TYLLERSRVCQVSDPERNYHCFYLLCAAPPEEIEKYKLGPPKSFHYLNQSNCYELVGVSD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+ IFRVVAAILHLGNI+FAKG+EIDSSV+KD+KS+FHL 
Sbjct  230   AHDYLATRRAMDIVGISAQEQDAIFRVVAAILHLGNIDFAKGKEIDSSVLKDDKSKFHLK  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TADLL CD+++LEDAL KRVM+TPEEVI R LDP +A  SRD LAKT+YSRLFDWIV K
Sbjct  290   MTADLLMCDSEALEDALCKRVMITPEEVIKRPLDPLAATVSRDGLAKTIYSRLFDWIVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INVSIGQDPTSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  410   KEEINWSYIEFVDNQDV  426



>ref|XP_010694808.1| PREDICTED: myosin-11-like [Beta vulgaris subsp. vulgaris]
Length=1530

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA  GELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPLGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRS  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRSATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKRGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C++L GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGSPKTFHYLNQSKCFDLVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE++QE IFRVVAAILHLGNI+FAKG+EIDSSVIKDE SRFHLN
Sbjct  296   AHDYLATRRAMDIVGISEKDQEAIFRVVAAILHLGNIDFAKGEEIDSSVIKDENSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               ++LL CDA++LEDAL+KRVM+TPEEVI ++LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   IVSELLMCDAQALEDALLKRVMITPEEVIKKSLDPLNATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKHNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYI+FVDNQDV
Sbjct  476   KEKIDWSYIQFVDNQDV  492



>ref|XP_006417653.1| hypothetical protein EUTSA_v10006560mg [Eutrema salsugineum]
 gb|ESQ36006.1| hypothetical protein EUTSA_v10006560mg [Eutrema salsugineum]
Length=1464

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  50    MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  110   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL G++D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCYELVGISD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KDEK++FHL 
Sbjct  230   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDEKAKFHLK  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKT+YSRLFDW+V K
Sbjct  290   TAAELLMCDLKALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTIYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  350   INKSIGQDANSRSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  409

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  410   KEAIDWSYIEFVDNQDV  426



>ref|XP_009628315.1| PREDICTED: myosin-9-like isoform X3 [Nicotiana tomentosiformis]
Length=1472

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  117   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  177   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLENPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGISE+EQE IFRVVA++LHLGNI F+KGQEIDSSV+KD+KS FHL 
Sbjct  297   AQDYLATRRAMDIVGISEKEQEAIFRVVASVLHLGNINFSKGQEIDSSVLKDDKSNFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD   LEDAL+KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TVAELLACDLNDLEDALLKRVMVTPEEVIKRSLDPNAAAVSRDGLAKTIYSRLFDWLVNK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_006392515.1| hypothetical protein EUTSA_v10023213mg [Eutrema salsugineum]
 gb|ESQ29801.1| hypothetical protein EUTSA_v10023213mg [Eutrema salsugineum]
Length=1526

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEELEKYKLGHPKTFHYLNQSKCFELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHLN
Sbjct  296   AHDYIATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL KRVMVTPEEVI R+LDP+SA+ SRD LAKT+YSRLFDW+V+K
Sbjct  356   TVAELLMCDLKDLEDALCKRVMVTPEEVIKRSLDPQSAVISRDGLAKTIYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>ref|NP_175858.1| Myosin family protein with Dil domain [Arabidopsis thaliana]
 sp|F4HWY6.1|MYO11_ARATH RecName: Full=Myosin-11; AltName: Full=Myosin XI E; Short=AtXIE 
[Arabidopsis thaliana]
 gb|AEE33118.1| Myosin family protein with Dil domain [Arabidopsis thaliana]
Length=1529

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  119   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  178

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  179   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  238

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  239   TYLLERSRVCQISDPERNYHCFYLLCAAPQEELEKYKLGHPKTFHYLNQSKCFELVGISD  298

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVG+SE+EQE IFRVVAAILHLGN+EF KG+E+DSSV KD+KS+FHLN
Sbjct  299   AHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHLGNVEFTKGKEVDSSVPKDDKSKFHLN  358

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V+K
Sbjct  359   TVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEK  418

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD  S+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  419   INVSIGQDATSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  478

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  479   KEAIDWSYIEFVDNQDV  495



>gb|KFK43939.1| hypothetical protein AALP_AA1G194000 [Arabis alpina]
Length=1513

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YKG   G LSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEEYKGTGLGVLSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ EKYKLGNP+SFHYLNQS+CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPTEDIEKYKLGNPQSFHYLNQSSCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGN++F KG+EIDSSVIK EKSRFHLN
Sbjct  293   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNVDFGKGEEIDSSVIKGEKSRFHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+ITRTLDPE+A+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCNAQSLEDALIRRVMVTPEEIITRTLDPENAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_009113429.1| PREDICTED: myosin-11 [Brassica rapa]
Length=1469

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  60    MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  119

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  120   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  179

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  180   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  239

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+++DSSV KD+K++FHLN
Sbjct  240   AHDYIATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKDVDSSVPKDDKAKFHLN  299

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL KRVMVTPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+VQK
Sbjct  300   TVAELLMCDVKELEDALCKRVMVTPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVQK  359

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  360   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  419

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDN+DV
Sbjct  420   KEAIDWSYIEFVDNKDV  436



>emb|CDY42350.1| BnaA09g15850D [Brassica napus]
Length=1503

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  94    MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  153

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  154   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  213

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  214   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  273

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+++DSSV KD+K++FHLN
Sbjct  274   AHDYIATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKDVDSSVPKDDKAKFHLN  333

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL KRVMVTPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+VQK
Sbjct  334   TVAELLMCDVKELEDALCKRVMVTPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVQK  393

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  394   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  453

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDN+DV
Sbjct  454   KEAIDWSYIEFVDNKDV  470



>ref|XP_006606471.1| PREDICTED: myosin-11-like [Glycine max]
Length=1533

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEKKSNSILVSGESGAGKTETTKMLMQYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQS CYEL  V+D
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSKCYELADVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS+++QE IFRVVA+ILH+GNIEF KG+E+DSSV KD+KS+FHL 
Sbjct  296   AHEYLATRRAMDIVGISQKDQEAIFRVVASILHIGNIEFTKGKEVDSSVPKDDKSKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDADALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_009628313.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
Length=1530

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  117   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  177   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLENPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGISE+EQE IFRVVA++LHLGNI F+KGQEIDSSV+KD+KS FHL 
Sbjct  297   AQDYLATRRAMDIVGISEKEQEAIFRVVASVLHLGNINFSKGQEIDSSVLKDDKSNFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD   LEDAL+KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TVAELLACDLNDLEDALLKRVMVTPEEVIKRSLDPNAAAVSRDGLAKTIYSRLFDWLVNK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_009628314.1| PREDICTED: myosin-9-like isoform X2 [Nicotiana tomentosiformis]
Length=1529

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  116   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRKGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLENPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGISE+EQE IFRVVA++LHLGNI F+KGQEIDSSV+KD+KS FHL 
Sbjct  296   AQDYLATRRAMDIVGISEKEQEAIFRVVASVLHLGNINFSKGQEIDSSVLKDDKSNFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD   LEDAL+KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TVAELLACDLNDLEDALLKRVMVTPEEVIKRSLDPNAAAVSRDGLAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|EPS61697.1| hypothetical protein M569_13097, partial [Genlisea aurea]
Length=713

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA+FGELSPHVFAVADVAYRAM+ E KSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  115   MMQQYKGASFGELSPHVFAVADVAYRAMVTEKKSNSILVSGESGAGKTETTKMLMRYLAF  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  175   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKY L +PKSFHYLNQS C+EL GV+D
Sbjct  235   TYLLERSRVCQISDPERNYHCFYLLCAAPKEEIEKYYLDHPKSFHYLNQSKCFELVGVSD  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS+ EQE IFRVVAAILH+GNI+F KG+EIDSSV KD+ +RFHL 
Sbjct  295   AHDYLATRRAMDVVGISKAEQESIFRVVAAILHIGNIDFGKGKEIDSSVPKDDNARFHLK  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP SAL SRD LAKTVYSRLFDW+V K
Sbjct  355   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPLSALVSRDGLAKTVYSRLFDWLVDK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD  SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  415   INNSIGQDHTSKSLIGVLDIYGFESFKNNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  474

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  475   KEEIDWSYIEFVDNQDV  491



>ref|XP_010476915.1| PREDICTED: myosin-5 [Camelina sativa]
Length=1520

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK  A GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKRVALGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+L NP+SFHYLNQS+CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLKNPQSFHYLNQSSCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR+AMD+VGIS +EQE IFRVVAAILHLGNI+F KG+EIDSSVIKDE+SR HLN
Sbjct  293   ANEYLETRKAMDVVGISNDEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDEESRHHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA+SLEDALI+RVMVTPEE+ITRTLDP SA+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCDAQSLEDALIRRVMVTPEEIITRTLDPNSAIVSRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>gb|KFK43186.1| hypothetical protein AALP_AA1G091000 [Arabis alpina]
Length=1530

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+P +FHYLNQS CYEL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPNTFHYLNQSKCYELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLT  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMVTPEEVIKRSLDPQSAVTSRDGLAKTVYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>ref|XP_010498125.1| PREDICTED: myosin-5-like isoform X2 [Camelina sativa]
Length=1491

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK  A GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKRVALGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+L NP+SFHYLNQS+CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLKNPQSFHYLNQSSCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR+AMD+VGIS +EQE IFRVVAAILHLGNI+F KG+EIDSSVIKDE SR HLN
Sbjct  293   ASEYLETRKAMDVVGISNDEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDEGSRHHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA+SLEDALI+RVMVTPEE+ITRTLDP SA+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCDAQSLEDALIRRVMVTPEEIITRTLDPNSAIVSRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_006589199.1| PREDICTED: myosin-11-like [Glycine max]
Length=1532

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEKKSNSILVSGESGAGKTETTKMLMQYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQS CYEL  V+D
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSKCYELADVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS+++QE IFRVVA+ILH+GNIEF KG++IDSSV KD+KS+FHL 
Sbjct  296   AREYLATRRAMDIVGISQKDQEAIFRVVASILHIGNIEFTKGKDIDSSVPKDDKSKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDADALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_010660140.1| PREDICTED: myosin-9 [Vitis vinifera]
Length=1530

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRVATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVA+ILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVASILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP +A  SRD  AKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDPLALEDALCKRVMITPEEVIKRSLDPLAATVSRDGFAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_009591029.1| PREDICTED: myosin-9-like isoform X4 [Nicotiana tomentosiformis]
Length=1055

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEKYKGVPLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGHKGTQRRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKL +PKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLRDPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IFRVVA++LHLGNIEFAKG EIDSSV+KD+KSRFHL 
Sbjct  297   AHDYLEIRRAMDIVGISEKEQEAIFRVVASVLHLGNIEFAKGNEIDSSVLKDDKSRFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD   LEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TTAELLMCDVTLLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FK+EQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKIEQEEYS  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  477   KEEINWSYIEFVDNQDV  493



>ref|XP_010498124.1| PREDICTED: myosin-5-like isoform X1 [Camelina sativa]
Length=1495

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK  A GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  117   MMEQYKRVALGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+L NP+SFHYLNQS+CY+LDGV+D
Sbjct  237   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLKNPQSFHYLNQSSCYKLDGVDD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR+AMD+VGIS +EQE IFRVVAAILHLGNI+F KG+EIDSSVIKDE SR HLN
Sbjct  297   ASEYLETRKAMDVVGISNDEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDEGSRHHLN  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA+SLEDALI+RVMVTPEE+ITRTLDP SA+ SRD LAKT+YS LFDWIV K
Sbjct  357   LAAELLMCDAQSLEDALIRRVMVTPEEIITRTLDPNSAIVSRDTLAKTIYSHLFDWIVNK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  477   KEEIDWSYIEFIDNQDV  493



>ref|XP_002890235.1| hypothetical protein ARALYDRAFT_889165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66494.1| hypothetical protein ARALYDRAFT_889165 [Arabidopsis lyrata subsp. 
lyrata]
Length=1520

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAA GELSPHVFA+ D AYRAMINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKGAALGELSPHVFAIGDAAYRAMINEGKNNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKL NP  FHYLNQS+CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLENPHKFHYLNQSSCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F KG+EIDSSVIKD+ SR HLN
Sbjct  293   AKEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDKDSRSHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A LL C+A+SLEDALI+RVMVTPEE+ITRTLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  353   MAAKLLMCNAQSLEDALIRRVMVTPEEIITRTLDPDNAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_009591028.1| PREDICTED: myosin-9-like isoform X3 [Nicotiana tomentosiformis]
Length=1071

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEKYKGVPLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGHKGTQRRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKL +PKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLRDPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IFRVVA++LHLGNIEFAKG EIDSSV+KD+KSRFHL 
Sbjct  297   AHDYLEIRRAMDIVGISEKEQEAIFRVVASVLHLGNIEFAKGNEIDSSVLKDDKSRFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD   LEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TTAELLMCDVTLLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FK+EQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKIEQEEYS  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  477   KEEINWSYIEFVDNQDV  493



>gb|EEC80642.1| hypothetical protein OsI_23028 [Oryza sativa Indica Group]
Length=1716

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/377 (87%), Positives = 352/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI+EGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  303   MMQQYKGAPFGELSPHVFAVADVAYRAMIHEGKSNSILVSGESGAGKTETTKMLMRYLAY  362

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  363   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  422

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  423   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGNPKTFHYLNQSNCYELVGVSD  482

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E+DSSV+KD+KS+FHL+
Sbjct  483   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEVDSSVLKDDKSKFHLD  542

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD+ +L DAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  543   TTAELLMCDSGALGDALCKRVMVTPEEVIKRSLDPYNATVSRDGLAKTIYSRLFDWLVDK  602

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  603   INSSIGQDPNSKSLIGVLDIYGFESFKLNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  662

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  663   KEQIDWSYIEFVDNQDV  679



>ref|XP_010498126.1| PREDICTED: myosin-5-like isoform X3 [Camelina sativa]
Length=1524

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK  A GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  117   MMEQYKRVALGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+L NP+SFHYLNQS+CY+LDGV+D
Sbjct  237   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLKNPQSFHYLNQSSCYKLDGVDD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR+AMD+VGIS +EQE IFRVVAAILHLGNI+F KG+EIDSSVIKDE SR HLN
Sbjct  297   ASEYLETRKAMDVVGISNDEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDEGSRHHLN  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA+SLEDALI+RVMVTPEE+ITRTLDP SA+ SRD LAKT+YS LFDWIV K
Sbjct  357   LAAELLMCDAQSLEDALIRRVMVTPEEIITRTLDPNSAIVSRDTLAKTIYSHLFDWIVNK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  477   KEEIDWSYIEFIDNQDV  493



>ref|XP_010923044.1| PREDICTED: myosin-11-like [Elaeis guineensis]
Length=1527

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGAQFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYKLGNPKAFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNI+FAKG+EIDSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAQEQDAIFRVVAAILHIGNIDFAKGKEIDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVMVTPEEVI R+LDP  A  SRD  AKTVYSRLFDW+V K
Sbjct  356   MTAELLMCDPLALEDALCKRVMVTPEEVIKRSLDPLGATVSRDGFAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP S S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPTSSSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>ref|XP_006442753.1| hypothetical protein CICLE_v10018485mg [Citrus clementina]
 gb|ESR55993.1| hypothetical protein CICLE_v10018485mg [Citrus clementina]
Length=1474

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAM+NEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  60    MMQQYKGAPFGELSPHVFAVADVAYRAMVNEGKSNSILVSGESGAGKTETTKMLMRYLAF  119

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  120   LGGRTATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  179

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS+PERNYHCFYLLC AP EE E+YKLGNPK+FHYLNQS C+EL GV+D
Sbjct  180   TYLLERSRVCQISSPERNYHCFYLLCNAPQEEVERYKLGNPKTFHYLNQSTCFELVGVSD  239

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE++QE IFRVVAAILH+GNIEF+KG+E+DSS+ KD++++FHL 
Sbjct  240   AHDYLATRRAMDIVGISEKDQEAIFRVVAAILHIGNIEFSKGKEVDSSIPKDDQAKFHLK  299

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KR+M+TPEEVI R+LDP+SAL SRD LAKT+YSRLFDW+V K
Sbjct  300   TAAELLMCDPVALEDALCKRIMITPEEVIKRSLDPQSALVSRDGLAKTIYSRLFDWLVDK  359

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  360   INSSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  419

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  420   KEEIDWSYIEFVDNQDV  436



>emb|CAN71597.1| hypothetical protein VITISV_019007 [Vitis vinifera]
Length=1594

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  180   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  239

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  240   LGGRVATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  299

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  300   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  359

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVA+ILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  360   AHDYLATRRAMDIVGISEKEQEAIFRVVASILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  419

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP +A  SRD  AKT+YSRLFDW+V K
Sbjct  420   MTAELLMCDPLALEDALCKRVMITPEEVIKRSLDPLAATVSRDGFAKTIYSRLFDWLVDK  479

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  480   INVSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  539

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  540   KEEIDWSYIEFVDNQDV  556



>ref|XP_010475685.1| PREDICTED: myosin-9 [Camelina sativa]
Length=1529

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE INWSYIEFVDNQDV
Sbjct  476   KEAINWSYIEFVDNQDV  492



>ref|XP_010553755.1| PREDICTED: myosin-11 [Tarenaya hassleriana]
Length=1530

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGHPKTFHYLNQSKCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GN+EF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNVEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD ++LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TVAELLMCDVQALEDALCKRVMITPEEVIKRSLDPQSAVISRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>gb|EPS64096.1| hypothetical protein M569_10684, partial [Genlisea aurea]
Length=1519

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/379 (86%), Positives = 351/379 (93%), Gaps = 2/379 (1%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+AD+A+RAM+NEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEQYKGAPFGELSPHVFAIADIAFRAMMNEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  177   LGGRKRTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGSPKTFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS++EQE IFRVVAAILHLGNI+F+KGQEIDSSV+KDEKS+FHL 
Sbjct  297   AHDYLATRRAMDIVGISQKEQEAIFRVVAAILHLGNIQFSKGQEIDSSVLKDEKSKFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDW--IV  238
             TTA+LL CD  +LEDAL+KRVMVTPEEVI R+LDP+ AL SRD LAKT YSRLFDW  +V
Sbjct  357   TTAELLMCDEDALEDALLKRVMVTPEEVIKRSLDPDGALVSRDGLAKTAYSRLFDWYVLV  416

Query  237   QKINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqee  58
             +KIN+SIGQD  SK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEE
Sbjct  417   EKINVSIGQDQTSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEE  476

Query  57    yekeEINWSYIEFVDNQDV  1
             Y +EEI+WSYIEFVDNQDV
Sbjct  477   YTREEIDWSYIEFVDNQDV  495



>ref|XP_006656811.1| PREDICTED: myosin-11-like [Oryza brachyantha]
Length=1573

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  160   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGRSNSILVSGESGAGKTETTKMLMRYLAY  219

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  220   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  279

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLC+AP EE EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  280   TYLLERSRVCQISDPERNYHCFYLLCSAPQEEVEKYKLGNPKTFHYLNQSNCYELVGVSD  339

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E+DSSV+KD+KS+FHL+
Sbjct  340   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEVDSSVLKDDKSKFHLD  399

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +L DAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  400   TTAELLMCDPGALGDALCKRVMVTPEEVIKRSLDPYNATVSRDGLAKTIYSRLFDWLVDK  459

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  460   INSSIGQDANSKSLIGVLDIYGFESFKLNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  519

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  520   KEQIDWSYIEFVDNQDV  536



>ref|XP_010321831.1| PREDICTED: myosin-9-like [Solanum lycopersicum]
Length=1529

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  117   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGRRSTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS+CYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLGDPKTFHYLNQSSCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMD+VGISE+EQE IFRVVA++LHLGN++FAKG+EIDSSV+KDEKS+FHL 
Sbjct  297   AQDYLATRRAMDVVGISEKEQEAIFRVVASVLHLGNLQFAKGKEIDSSVLKDEKSKFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL+KRVMVTPEEVI R+LDP++A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TVAELLMCDLKDLEDALLKRVMVTPEEVIKRSLDPDAATVSRDGLAKTLYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             +EEI+WSYIEFVDN+DV
Sbjct  477   REEIDWSYIEFVDNKDV  493



>ref|XP_008456307.1| PREDICTED: myosin-11 isoform X1 [Cucumis melo]
Length=1530

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  117   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  177   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQSNCYEL  V+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSNCYELVDVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNIEF KG+E+DSS+ KD+K++FHL 
Sbjct  297   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNIEFTKGKEVDSSIPKDDKAKFHLK  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD   LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  357   MTSELLMCDNAGLEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPNSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>emb|CBI35200.3| unnamed protein product [Vitis vinifera]
Length=1630

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  144   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  203

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  204   LGGRVATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  263

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  264   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  323

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVA+ILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  324   AHDYLATRRAMDIVGISEKEQEAIFRVVASILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  383

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP +A  SRD  AKT+YSRLFDW+V K
Sbjct  384   MTAELLMCDPLALEDALCKRVMITPEEVIKRSLDPLAATVSRDGFAKTIYSRLFDWLVDK  443

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  444   INVSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  503

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  504   KEEIDWSYIEFVDNQDV  520



>ref|XP_008456315.1| PREDICTED: myosin-11 isoform X2 [Cucumis melo]
Length=1529

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQSNCYEL  V+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSNCYELVDVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNIEF KG+E+DSS+ KD+K++FHL 
Sbjct  296   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNIEFTKGKEVDSSIPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD   LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTSELLMCDNAGLEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_009110876.1| PREDICTED: LOW QUALITY PROTEIN: myosin-9-like [Brassica rapa]
Length=1530

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELNPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCYELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GN+EF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNVEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDPESA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMVTPEEVIKRSLDPESAVTSRDGLAKTVYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INXSIGQDANSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDN+DV
Sbjct  476   KEAIDWSYIEFVDNKDV  492



>ref|NP_173201.2| myosin 1 [Arabidopsis thaliana]
 sp|Q39160.1|MYO5_ARATH RecName: Full=Myosin-5; AltName: Full=AtMYA1 [Arabidopsis thaliana]
 emb|CAA82234.1| myosin [Arabidopsis thaliana]
 gb|AEE29607.1| myosin 1 [Arabidopsis thaliana]
Length=1520

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG A GELSPHVFA+ D AYRAMINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKGIALGELSPHVFAIGDAAYRAMINEGKNNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKL NP  FHYLNQS+CY+LDGV+D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLENPHKFHYLNQSSCYKLDGVDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F KG+EIDSSVIKD+ SR HLN
Sbjct  293   ASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGKGEEIDSSVIKDKDSRSHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL C+A+SLEDALI+RVMVTPEE+ITRTLDP++A+ SRD LAKT+YS LFDWIV K
Sbjct  353   MAAELLMCNAQSLEDALIRRVMVTPEEIITRTLDPDNAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI WSYIEF+DNQDV
Sbjct  473   KEEIAWSYIEFIDNQDV  489



>ref|XP_007147198.1| hypothetical protein PHAVU_006G103900g [Phaseolus vulgaris]
 gb|ESW19192.1| hypothetical protein PHAVU_006G103900g [Phaseolus vulgaris]
Length=1531

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI+EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMIHEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVC+IS PERNYHCFY LCAAP EE EKYKLGNPK+FHYLNQS CY+L  +ND
Sbjct  236   TYLLERSRVCKISDPERNYHCFYFLCAAPQEEIEKYKLGNPKTFHYLNQSKCYDLADIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQE IFRVVAAILH+GNIEFAKG+EIDSSV KD+K++FHL 
Sbjct  296   SREYLATRRAMDIVGISQKEQEAIFRVVAAILHIGNIEFAKGKEIDSSVPKDDKAKFHLE  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL C+A SLEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCNAGSLEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVNK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD +SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDSSSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_010679211.1| PREDICTED: myosin-9-like isoform X3 [Beta vulgaris subsp. vulgaris]
Length=1440

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM  YKGAA GELSPHVFA+ DVA+RAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  41    MMNHYKGAALGELSPHVFALGDVAFRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  100

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  101   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKRGRISGAAIR  160

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+P+SFHYLNQSNCYEL G+N+
Sbjct  161   TYLLERSRVCQISDPERNYHCFYLLCAAPKEEVEKYKLGDPRSFHYLNQSNCYELVGINE  220

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAM IVGIS+EEQ+ IFRVVAAILHLGNIEF+KG+EIDSSV KD+KS+FHL 
Sbjct  221   AQDYLATRRAMGIVGISKEEQDAIFRVVAAILHLGNIEFSKGEEIDSSVPKDDKSKFHLQ  280

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  281   TTAELLMCDPVALEDALCKRVMVTPEEVIKRSLDPGAATTSRDGLAKTIYSRLFDWLVDK  340

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  341   INKSIGQDPNSKCLIGVLDIYGFESFKTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  400

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  401   KEEIDWSYIEFVDNQDV  417



>ref|XP_010531810.1| PREDICTED: myosin-11-like [Tarenaya hassleriana]
Length=1531

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCYELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVMVTPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TVAELLMCDVHALEDALCKRVMVTPEEVIKRSLDPQSAVISRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I WSYIEFVDNQDV
Sbjct  476   KEAIEWSYIEFVDNQDV  492



>ref|XP_008218295.1| PREDICTED: myosin-11 [Prunus mume]
Length=1529

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLANPKSFHYLNQSRCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNIEFAKG E+DSSV KD+ ++FHL 
Sbjct  296   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNIEFAKGMEVDSSVPKDDPAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDVDALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD  SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDATSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>emb|CDX95235.1| BnaC09g16350D [Brassica napus]
Length=1536

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  127   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  186

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  187   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  246

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  247   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  306

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y+ATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E DSSV KD+K++FHL+
Sbjct  307   AHDYIATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEADSSVPKDDKAKFHLS  366

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL KRVMVTPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+VQK
Sbjct  367   TVAELLMCDVKELEDALCKRVMVTPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVQK  426

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  427   INVSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  486

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDN+DV
Sbjct  487   KEAIDWSYIEFVDNKDV  503



>ref|XP_010679210.1| PREDICTED: myosin-9-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1459

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM  YKGAA GELSPHVFA+ DVA+RAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  60    MMNHYKGAALGELSPHVFALGDVAFRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  119

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  120   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKRGRISGAAIR  179

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+P+SFHYLNQSNCYEL G+N+
Sbjct  180   TYLLERSRVCQISDPERNYHCFYLLCAAPKEEVEKYKLGDPRSFHYLNQSNCYELVGINE  239

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAM IVGIS+EEQ+ IFRVVAAILHLGNIEF+KG+EIDSSV KD+KS+FHL 
Sbjct  240   AQDYLATRRAMGIVGISKEEQDAIFRVVAAILHLGNIEFSKGEEIDSSVPKDDKSKFHLQ  299

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  300   TTAELLMCDPVALEDALCKRVMVTPEEVIKRSLDPGAATTSRDGLAKTIYSRLFDWLVDK  359

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  360   INKSIGQDPNSKCLIGVLDIYGFESFKTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  419

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  420   KEEIDWSYIEFVDNQDV  436



>ref|XP_009777808.1| PREDICTED: myosin-9-like [Nicotiana sylvestris]
Length=1139

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM++YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMKKYKGVPLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGHKGTQRRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKLG+PKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLGDPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IFRVVA++LHLGNIEFAKG E DSSV+KD+KSRFHL 
Sbjct  297   AHDYLEIRRAMDIVGISEKEQEAIFRVVASVLHLGNIEFAKGNETDSSVLKDDKSRFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD   LEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TTAELLMCDVTLLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FKMEQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKMEQEEYS  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQD 
Sbjct  477   KEEINWSYIEFVDNQDA  493



>ref|XP_009591027.1| PREDICTED: myosin-9-like isoform X2 [Nicotiana tomentosiformis]
Length=1138

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMEKYKGVPLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGHKGTQRRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKL +PKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLRDPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IFRVVA++LHLGNIEFAKG EIDSSV+KD+KSRFHL 
Sbjct  296   AHDYLEIRRAMDIVGISEKEQEAIFRVVASVLHLGNIEFAKGNEIDSSVLKDDKSRFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD   LEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDVTLLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FK+EQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKIEQEEYS  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_009591022.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009591023.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009591024.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009591025.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009591026.1| PREDICTED: myosin-9-like isoform X1 [Nicotiana tomentosiformis]
Length=1139

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEKYKGVPLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGHKGTQRRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKL +PKSFHYLNQSNCYEL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLRDPKSFHYLNQSNCYELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IFRVVA++LHLGNIEFAKG EIDSSV+KD+KSRFHL 
Sbjct  297   AHDYLEIRRAMDIVGISEKEQEAIFRVVASVLHLGNIEFAKGNEIDSSVLKDDKSRFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD   LEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TTAELLMCDVTLLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FK+EQEEY 
Sbjct  417   INNSIGQDPNSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKIEQEEYS  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  477   KEEINWSYIEFVDNQDV  493



>ref|XP_010458123.1| PREDICTED: myosin-9-like [Camelina sativa]
Length=1531

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVV AILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVGAILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>ref|NP_172349.2| myosin class XI [Arabidopsis thaliana]
 sp|F4HXP9.1|MYO9_ARATH RecName: Full=Myosin-9; AltName: Full=Myosin XI C; Short=AtXIC 
[Arabidopsis thaliana]
 gb|AEE28340.1| myosin class XI [Arabidopsis thaliana]
Length=1538

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA  GELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  124   MMQQYKGAPLGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  183

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  184   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  243

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL G++D
Sbjct  244   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCFELVGISD  303

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNI+F KG+E+DSSV KDEKS+FHL 
Sbjct  304   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIDFTKGKEVDSSVPKDEKSKFHLK  363

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKTVYSRLFDW+V K
Sbjct  364   TAAELLMCDLKALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTVYSRLFDWLVDK  423

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  424   INKSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  483

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  484   KEAIDWSYIEFVDNQDV  500



>ref|XP_008447239.1| PREDICTED: myosin-11 isoform X1 [Cucumis melo]
Length=1092

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+Y+GA  GEL PHVFA+ADVAYRAMIN GKSNSILVSGESGAGKTETTKMLM YLA+
Sbjct  116   VMEKYRGAPIGELKPHVFAIADVAYRAMINYGKSNSILVSGESGAGKTETTKMLMCYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG +  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHAASEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPP+ERE+YKLGNPKSFHYLNQSNCYEL GVND
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPPQERERYKLGNPKSFHYLNQSNCYELAGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLAT+RAMDIVGI E+EQ+ IFRVVAAILHLGNIEFAKG+E DSS +KDE+S+FHL+
Sbjct  296   AHDYLATKRAMDIVGIGEQEQDAIFRVVAAILHLGNIEFAKGEESDSSFVKDEESKFHLH  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KR+MVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDPNALEDALCKRMMVTPEEVIKRSLDPHGATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESF+ NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPCSKYLIGVLDIYGFESFQTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYV  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|EYU46481.1| hypothetical protein MIMGU_mgv1a018273mg, partial [Erythranthe 
guttata]
Length=1514

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+AD+AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  115   MMEQYKGAPFGELSPHVFAIADMAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  175   LGGRKQTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+P++FHYLNQSNC EL+G++D
Sbjct  235   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLGDPRTFHYLNQSNCIELNGISD  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMDIVGIS++EQ+ IFRVVA++LHLGN+EFAKG+EIDSSV+K++KS+FHL 
Sbjct  295   AQDYLATRRAMDIVGISQKEQDAIFRVVASVLHLGNVEFAKGKEIDSSVLKNDKSKFHLK  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL+KRVMVTPEEVI R+LDP+ A  SRD LAKT+YSRLFDW+V K
Sbjct  355   TVAELLMCDLTALEDALLKRVMVTPEEVIKRSLDPDGATVSRDGLAKTIYSRLFDWLVDK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  415   INNSIGQDPNSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  474

Query  51    keEINWSYIEFVDNQDV  1
             +EEI+WSYIEFVDN+DV
Sbjct  475   REEIDWSYIEFVDNKDV  491



>ref|XP_007144848.1| hypothetical protein PHAVU_007G189300g [Phaseolus vulgaris]
 gb|ESW16842.1| hypothetical protein PHAVU_007G189300g [Phaseolus vulgaris]
Length=1533

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/377 (85%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI EGKSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMIIEGKSNSILVSGESGAGKTETTKMLMQYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAGTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+ PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQS CYEL  ++D
Sbjct  236   TYLLERSRVCQINDPERNYHCFYLLCAAPNEEIEKYKLGNPRSFHYLNQSKCYELADISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS+++QE IFRVVA+ILH+GNIEF KG+++DSSV KD+K++FHL 
Sbjct  296   AREYLATRRAMDIVGISQKDQEAIFRVVASILHIGNIEFTKGKDVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDANALEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPKSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_002319092.2| hypothetical protein POPTR_0013s04110g [Populus trichocarpa]
 gb|EEE95015.2| hypothetical protein POPTR_0013s04110g [Populus trichocarpa]
Length=1531

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/377 (84%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYR MINE KSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  152   MMQQYKGAPFGELSPHVFAVADVAYREMINERKSNSILVSGESGAGKTETTKMLMRYLAF  211

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  212   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  271

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S+PERNYHCFYLLCAAP EE EKYKLG+PKSFHYLNQ+NC+EL GV+D
Sbjct  272   TYLLERSRVCQVSSPERNYHCFYLLCAAPQEEVEKYKLGSPKSFHYLNQTNCFELAGVSD  331

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL+TRRAMDIVGIS +EQE IFRVVAA+LH+GNI+F+KG+E+DSSV KD++++FHL 
Sbjct  332   AHDYLSTRRAMDIVGISAKEQEAIFRVVAAVLHIGNIDFSKGKEVDSSVPKDDQAKFHLK  391

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKT+YSRLFDWIV K
Sbjct  392   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTIYSRLFDWIVDK  451

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  452   INNSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  511

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  512   KEQIDWSYIEFVDNQDV  528



>ref|XP_010679209.1| PREDICTED: myosin-9-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1515

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM  YKGAA GELSPHVFA+ DVA+RAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMNHYKGAALGELSPHVFALGDVAFRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKRGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+P+SFHYLNQSNCYEL G+N+
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPKEEVEKYKLGDPRSFHYLNQSNCYELVGINE  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAM IVGIS+EEQ+ IFRVVAAILHLGNIEF+KG+EIDSSV KD+KS+FHL 
Sbjct  296   AQDYLATRRAMGIVGISKEEQDAIFRVVAAILHLGNIEFSKGEEIDSSVPKDDKSKFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDPVALEDALCKRVMVTPEEVIKRSLDPGAATTSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INKSIGQDPNSKCLIGVLDIYGFESFKTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_003520844.2| PREDICTED: myosin-9-like [Glycine max]
Length=1528

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/378 (85%), Positives = 351/378 (93%), Gaps = 1/378 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMIN-EGKSNSILVSGESGAGKTETTKMLMRYLA  955
             MM+QYKGA FGELSPHVFAVADVAYRAMIN +GKSNSILVSGESGAGKTETTKMLMRYLA
Sbjct  117   MMQQYKGAPFGELSPHVFAVADVAYRAMINHDGKSNSILVSGESGAGKTETTKMLMRYLA  176

Query  954   YLGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAV  775
             +LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+
Sbjct  177   FLGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAI  236

Query  774   RTYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVN  595
             RTYLLERSRVCQI+ PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLNQS CYELD +N
Sbjct  237   RTYLLERSRVCQINDPERNYHCFYLLCAAPQEEIEKYKLGNPKTFHYLNQSKCYELDDIN  296

Query  594   DGEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHL  415
             D  EYLATRRAMDIVGIS+ EQE IFRVVAAILH+GNI+FAKG+E+DSSV KD+K++FHL
Sbjct  297   DSREYLATRRAMDIVGISQNEQEAIFRVVAAILHIGNIDFAKGREVDSSVPKDDKAKFHL  356

Query  414   NTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQ  235
              TT++LL CD ++LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+Y RLFDW+V 
Sbjct  357   KTTSELLMCDVRALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYCRLFDWLVN  416

Query  234   KINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeey  55
             KIN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY
Sbjct  417   KINSSIGQDSNSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEY  476

Query  54    ekeEINWSYIEFVDNQDV  1
             +KE+I+WSYIEFVDNQDV
Sbjct  477   KKEQIDWSYIEFVDNQDV  494



>ref|XP_002521953.1| myosin XI, putative [Ricinus communis]
 gb|EEF40357.1| myosin XI, putative [Ricinus communis]
Length=1533

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  119   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  178

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  179   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  238

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  239   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGNPKSFHYLNQSNCYELVGVSD  298

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVA+ILHLGNIEF KG+E+DSSV K+++++FHL 
Sbjct  299   AHDYLATRRAMDIVGISAKEQEAIFRVVASILHLGNIEFTKGKEVDSSVPKNDQAKFHLK  358

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKTVYSRLFDW+V K
Sbjct  359   MTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPQSATVSRDGLAKTVYSRLFDWLVDK  418

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  419   INNSIGQDHNSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  478

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  479   KEQIDWSYIEFVDNQDV  495



>ref|XP_008388696.1| PREDICTED: myosin-11 [Malus domestica]
Length=1529

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/377 (85%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELNPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLANPKSFHYLNQSRCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVAAILHLGNIEF+KG E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAKEQEAIFRVVAAILHLGNIEFSKGSEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKTVYSRLFDW+V K
Sbjct  356   MTSELLMCDPDALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD  SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDATSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_009364462.1| PREDICTED: myosin-11 [Pyrus x bretschneideri]
Length=1529

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/377 (85%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELNPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKL NPKSFHYLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLANPKSFHYLNQSRCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVAAILHLGNIEF+KG E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAKEQEAIFRVVAAILHLGNIEFSKGSEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKTVYSRLFDW+V K
Sbjct  356   MTSELLMCDPDALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD  SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDATSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_009148126.1| PREDICTED: myosin-9 [Brassica rapa]
Length=1530

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYR MI+EGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRDMISEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYEL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCYELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNI+F KG+E+DSSV KD+KS+FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIDFTKGKEVDSSVPKDDKSKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SA+ SRD  AKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMVTPEEVIKRSLDPQSAVTSRDGFAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INKSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>ref|XP_009800534.1| PREDICTED: myosin-9-like isoform X3 [Nicotiana sylvestris]
Length=1411

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  1     MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  60

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  61    LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  120

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  121   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  180

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E+DSSVIK++K +FHL 
Sbjct  181   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEVDSSVIKEDKPKFHLK  240

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  241   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  300

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  301   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  360

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  361   REAIDWSYIEFVDNQDV  377



>ref|XP_011038539.1| PREDICTED: myosin-9 [Populus euphratica]
Length=1528

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 351/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINERKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PKSFHYLNQ+NC+EL GV+D
Sbjct  236   TYLLERSRVCQVSNPERNYHCFYLLCAAPQEEVEKYKLGSPKSFHYLNQTNCFELAGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL+TRRAMDIVGI+ +EQE IFRVVAA+LH+GNI+F+KG+E+DSSV KD++++FHL 
Sbjct  296   AHDYLSTRRAMDIVGINAKEQEAIFRVVAAVLHIGNIDFSKGKEVDSSVPKDDQAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKT+YSRLFDWIV K
Sbjct  356   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPQSAVTSRDGLAKTIYSRLFDWIVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPDSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_010227822.1| PREDICTED: myosin-11-like isoform X2 [Brachypodium distachyon]
Length=1530

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEKKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLN+SNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGNPKTFHYLNKSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E DSSV+KD+KS+FHL+
Sbjct  296   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEADSSVLKDDKSKFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +L DAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPGALTDALCKRVMVTPEEVIKRSLDPYNATISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDANSKCLIGVLDIYGFESFKLNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_010227821.1| PREDICTED: myosin-11-like isoform X1 [Brachypodium distachyon]
Length=1532

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/377 (86%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEKKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPK+FHYLN+SNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEVEKYKLGNPKTFHYLNKSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E DSSV+KD+KS+FHL+
Sbjct  296   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEADSSVLKDDKSKFHLD  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +L DAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPGALTDALCKRVMVTPEEVIKRSLDPYNATISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDANSKCLIGVLDIYGFESFKLNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_010233428.1| PREDICTED: myosin-17 [Brachypodium distachyon]
Length=2358

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/377 (86%), Positives = 355/377 (94%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYR MINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMEQYKGADFGELSPHVFAIADVAYREMINEGKNNSILVSGESGAGKTETTKMLMRYLAH  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAPPE+ ++YKL + +SFHYLNQS+C E++G+ND
Sbjct  236   TYLLERSRVCQINTPERNYHCFYFLCAAPPEDTQRYKLADARSFHYLNQSSCIEVEGIND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LH+GNI FAKG E+DSSVIKD+ SRFHLN
Sbjct  296   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHIGNINFAKGTEVDSSVIKDDNSRFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL+CD  +LE ALI RV+VTPEE+ITRTLDP+SAL SRDALAKTVYSRLFDWIV+K
Sbjct  356   TAAELLECDCNNLEKALITRVIVTPEEIITRTLDPDSALASRDALAKTVYSRLFDWIVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKQLIGVLDIYGFESFKVNSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  476   REEINWSYIEFVDNQDV  492



>ref|XP_006303672.1| hypothetical protein CARUB_v10011741mg [Capsella rubella]
 gb|EOA36570.1| hypothetical protein CARUB_v10011741mg [Capsella rubella]
Length=1519

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK  A GELSPHVFA+ D AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  113   MMEQYKRVALGELSPHVFAIGDAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  172

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  173   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIR  232

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAPPE+ EKY+L NP+SFHYLNQSNCY+LDG++D
Sbjct  233   TYLLERSRVCQISDPERNYHCFYLLCAAPPEDIEKYQLKNPQSFHYLNQSNCYKLDGIDD  292

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR+AMD+VGIS +EQE IFRVVAAILHLGNI F KG+ IDSSV+KDE+S  HLN
Sbjct  293   ASEYLETRKAMDVVGISNDEQEAIFRVVAAILHLGNINFGKGEAIDSSVVKDEESGRHLN  352

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA+SLEDALI+RVMVTP+E+ITRTL+P+ A+ SRD LAKT+YS LFDWIV K
Sbjct  353   LAAELLMCDAQSLEDALIRRVMVTPDEIITRTLNPDDAIASRDTLAKTIYSHLFDWIVNK  412

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  413   INTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  472

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEF+DNQDV
Sbjct  473   KEEIDWSYIEFIDNQDV  489



>ref|XP_004966839.1| PREDICTED: myosin-H heavy chain-like [Setaria italica]
Length=1538

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/377 (85%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSN+ILVSGESGAGKTETTKMLMRYLAY
Sbjct  125   MMQQYKGAPFGELSPHVFAVADVAYRAMINEHKSNAILVSGESGAGKTETTKMLMRYLAY  184

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  185   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  244

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLC+AP EE EKYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  245   TYLLERSRVCQISDPERNYHCFYLLCSAPQEEVEKYKLGNPKTFHYLNQSNCYELVGVSD  304

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEF+KG+E+DSSV+KDEKS+FHL 
Sbjct  305   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFSKGKEVDSSVLKDEKSKFHLE  364

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL C+  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  365   TTAELLMCNPGALEDALCKRVMVTPEEVIKRSLDPYNATISRDGLAKTIYSRLFDWLVDK  424

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD +SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  425   INSSIGQDASSKCLIGVLDIYGFESFKANSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  484

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  485   KEQIDWSYIEFVDNQDV  501



>ref|XP_009395618.1| PREDICTED: myosin-11-like [Musa acuminata subsp. malaccensis]
Length=1535

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/377 (85%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA  GELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  120   MMIQYKGARLGELSPHVFAVADVAYRAMINEEKSNSILVSGESGAGKTETTKMLMRYLAY  179

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD+ GRISGAA+R
Sbjct  180   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDRQGRISGAAIR  239

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP E  EKYKL  P SFHYLNQSNCYEL GV+D
Sbjct  240   TYLLERSRVCQVSDPERNYHCFYLLCAAPTEVVEKYKLSKPNSFHYLNQSNCYELVGVSD  299

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+ IFRVVAAILHLGNI+FAKGQ+IDSSV+KD+KS+FHL 
Sbjct  300   AHDYLATRRAMDIVGISAQEQDAIFRVVAAILHLGNIDFAKGQDIDSSVLKDDKSKFHLK  359

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD+ +LEDAL KRVM+TPEEVI R LDP +A  SRD LAKT+YSRLFDWIV K
Sbjct  360   MTAELLMCDSAALEDALCKRVMITPEEVIKRPLDPRAATISRDGLAKTIYSRLFDWIVDK  419

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  420   INVSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  479

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  480   KEEIDWSYIEFVDNQDV  496



>ref|XP_004304760.1| PREDICTED: unconventional myosin-Vc-like [Fragaria vesca subsp. 
vesca]
Length=1532

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/377 (85%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  119   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  178

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  179   LGGRVATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  238

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PKSFHYLNQS CYEL GV+D
Sbjct  239   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGDPKSFHYLNQSRCYELVGVSD  298

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVAAILHLGNI F KG+E+DSSV KD++++FHL 
Sbjct  299   AHDYLATRRAMDIVGISAKEQEAIFRVVAAILHLGNILFTKGKEVDSSVPKDDQAKFHLK  358

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  359   MVAELLMCDTAALEDALCKRVMITPEEVIKRSLDPQSATISRDGLAKTIYSRLFDWLVDK  418

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  419   INVSIGQDANSKSLIGVLDIYGFESFKNNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  478

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  479   KEEIDWSYIEFVDNQDV  495



>ref|XP_006370974.1| hypothetical protein POPTR_0019s02280g, partial [Populus trichocarpa]
 gb|ERP48771.1| hypothetical protein POPTR_0019s02280g, partial [Populus trichocarpa]
Length=1526

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/377 (84%), Positives = 349/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADV+YRAM+ EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  115   MMQQYKGAPFGELSPHVFAVADVSYRAMVIEGKSNSILVSGESGAGKTETTKMLMRYLAF  174

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  175   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  234

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE E+YKLG+PKSFHYLNQS C+EL GV+D
Sbjct  235   TYLLERSRVCQVSNPERNYHCFYLLCAAPQEEIERYKLGSPKSFHYLNQSTCFELVGVSD  294

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS  EQE IFRVVAA+LH+GNI+FAKG+E+DSSV KD++S+FHL 
Sbjct  295   AHDYLATRRAMDIVGISAREQEAIFRVVAAVLHIGNIDFAKGKEVDSSVPKDDQSKFHLK  354

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA+ SRD LAKT+YSRLFDWIV K
Sbjct  355   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPQSAVISRDGLAKTIYSRLFDWIVDK  414

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  415   INNSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  474

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  475   KEQIDWSYIEFVDNQDV  491



>ref|XP_006303742.1| hypothetical protein CARUB_v10011892mg [Capsella rubella]
 gb|EOA36640.1| hypothetical protein CARUB_v10011892mg [Capsella rubella]
Length=1530

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINERKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE +KYKLG+PK+FHYLNQS C+EL G++D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIDKYKLGHPKTFHYLNQSKCFELVGISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGISE+EQE IFRVVAAILH+GNIEF KG+E+DSSV KD+K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISEKEQEAIFRVVAAILHIGNIEFTKGKEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDLKALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NS+S+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INKSIGQDANSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  476   KEAIDWSYIEFVDNQDV  492



>ref|XP_004139250.1| PREDICTED: unconventional myosin-Vc-like [Cucumis sativus]
 gb|KGN60778.1| hypothetical protein Csa_2G010140 [Cucumis sativus]
Length=1530

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  117   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  177   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQSNCYEL  V+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSNCYELVDVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNI F KG+++DSS+ KD+K++FHL 
Sbjct  297   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNIVFTKGKDVDSSIPKDDKAKFHLK  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD   LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  357   MTSELLMCDNAGLEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPKSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_004150341.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
Length=1122

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA  GEL PHVFA+ADVAYRAMIN GKSNSILVSGESGAGKTETTKMLM YLA+
Sbjct  146   VMEKYKGAPIGELKPHVFAIADVAYRAMINYGKSNSILVSGESGAGKTETTKMLMCYLAF  205

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG +  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  206   LGGHAASEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKKGRISGAAIR  265

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS  ERNYHCFYLLCAAPP+ERE+YKLGNPKSFHYLNQSNCYEL GVND
Sbjct  266   TYLLERSRVCQISDLERNYHCFYLLCAAPPQERERYKLGNPKSFHYLNQSNCYELAGVND  325

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLAT+RAMDIVGI E+EQ+ IFRVVAAILHLGNIEFAKG+E DSS +KDE+S+FHL+
Sbjct  326   AHDYLATKRAMDIVGIGEQEQDAIFRVVAAILHLGNIEFAKGEESDSSFVKDEESKFHLH  385

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KR+MVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V K
Sbjct  386   MTAELLMCDPNALEDALCKRMMVTPEEVIKRSLDPHGATVSRDGLAKTIYSRLFDWLVDK  445

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESF+ NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  446   INVSIGQDPCSKYLIGVLDIYGFESFQTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYV  505

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  506   KEEIDWSYIEFVDNQDV  522



>ref|XP_006365902.1| PREDICTED: myosin-11-like [Solanum tuberosum]
Length=1529

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 350/377 (93%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  117   MMEQYKGAPLGELSPHVFAIADAAYRQMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR   EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGRRSTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS+C+EL GV+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEVEKYKLGDPKTFHYLNQSSCFELVGVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              ++YLATRRAMD+VGISE+EQE IFRVVA++LHLGN++FAKG+E DSSV+KD+KS+FHL 
Sbjct  297   AQDYLATRRAMDVVGISEKEQEAIFRVVASVLHLGNLQFAKGKETDSSVLKDDKSKFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K LEDAL+KRVMVTPEEVI R+LDP++A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TVAELLMCDLKDLEDALLKRVMVTPEEVIKRSLDPDAATVSRDGLAKTLYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INNSIGQDPSSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             +EEI+WSYIEFVDN+DV
Sbjct  477   REEIDWSYIEFVDNKDV  493



>gb|KEH24572.1| DIL domain myosin family protein [Medicago truncatula]
Length=1530

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMINEKKSNSILVSGESGAGKTETTKMLMQYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ++ PERNYHCFYLLCAAP EE EKYKLG+PK++HYLNQS CYEL  ++D
Sbjct  236   TYLLERSRVCQVNDPERNYHCFYLLCAAPQEEIEKYKLGHPKTYHYLNQSKCYELADISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQE IFRVVAAILH+GNI+F KG+E+DSSV KD+K++FHLN
Sbjct  296   AREYLATRRAMDIVGISQKEQEAIFRVVAAILHIGNIDFTKGKEVDSSVPKDDKAKFHLN  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVMVTPEE+I R+LDP+SA  SRD  AKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDVGALEDALCKRVMVTPEEIIKRSLDPQSAQISRDGFAKTMYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_004156476.1| PREDICTED: LOW QUALITY PROTEIN: unconventional myosin-Vc-like 
[Cucumis sativus]
Length=1530

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/377 (85%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  117   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  177   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQSNCYEL  V+D
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSNCYELVDVSD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNI F KG+++DSS+ KD+K++FHL 
Sbjct  297   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNIVFTKGKDVDSSIPKDDKAKFHLK  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              T++LL CD   LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  357   MTSELLMCDNAGLEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  417   INVSIGQDPKSKSLIGVLDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_010652356.1| PREDICTED: myosin-9-like [Vitis vinifera]
Length=1150

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/376 (84%), Positives = 340/376 (90%), Gaps = 0/376 (0%)
 Frame = -2

Query  1128  MEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAYL  949
             ME+YKGA  GELSPHVFA+ADVAYR M NEGK NSILVSGESGAGKTETTKMLMRYLAYL
Sbjct  133   MEKYKGAPLGELSPHVFAIADVAYRDMANEGKGNSILVSGESGAGKTETTKMLMRYLAYL  192

Query  948   GGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVRT  769
             GG +  EGR+VEQ+VLESNPVLEAFGNAKTVRNNNSSRFGKFV IQFDK GRISGAA+RT
Sbjct  193   GGNTVTEGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVVIQFDKHGRISGAAIRT  252

Query  768   YLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVNDG  589
             YLLERSRVCQIS PERNYHCFY LCAAPPEE E+YKLGNPKSFHYLNQSNC+EL  VND 
Sbjct  253   YLLERSRVCQISDPERNYHCFYHLCAAPPEEIERYKLGNPKSFHYLNQSNCHELLDVNDA  312

Query  588   EEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLNT  409
             + YLATRRAMDIVGISE+EQE IFRVVAAILHLGNI+FAKG+E+DSSV+KD+K++FHL  
Sbjct  313   QYYLATRRAMDIVGISEKEQEAIFRVVAAILHLGNIDFAKGEEVDSSVLKDDKAKFHLQM  372

Query  408   TADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQKI  229
             T++LL CD  +LEDAL KRVMVTPEEVI R+LDP  A  SRD LAKT+YSRLFDW+V KI
Sbjct  373   TSELLMCDPHALEDALCKRVMVTPEEVIKRSLDPLGAAVSRDGLAKTIYSRLFDWLVNKI  432

Query  228   NISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeyek  49
             N SIGQDPNSKS IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY K
Sbjct  433   NFSIGQDPNSKSTIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYSK  492

Query  48    eEINWSYIEFVDNQDV  1
             E I+WSYIEF+DNQDV
Sbjct  493   EGIDWSYIEFIDNQDV  508



>ref|XP_009597756.1| PREDICTED: myosin-9-like isoform X3 [Nicotiana tomentosiformis]
Length=1411

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  1     MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  60

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  61    LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  120

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  121   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  180

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E DSSVIK++K +FHL 
Sbjct  181   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEADSSVIKEDKPKFHLK  240

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  241   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  300

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  301   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  360

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  361   REAIDWSYIEFVDNQDV  377



>emb|CDO99965.1| unnamed protein product [Coffea canephora]
Length=1582

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA  GELSPHVFAVADVAYR M+ EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  130   MMVQYKGAPLGELSPHVFAVADVAYRQMVKEGKSNSILVSGESGAGKTETTKMLMRYLAF  189

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  190   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  249

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS CYELDGV+D
Sbjct  250   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSRCYELDGVSD  309

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQE IFRVVAAILH+GNI+FAKG+EIDSS++KDEKS+FHL 
Sbjct  310   AHDYLATRRAMDIVGISAKEQEAIFRVVAAILHIGNIDFAKGKEIDSSMLKDEKSKFHLK  369

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL+CD  +LEDAL+KRVM+TPEEVI R+LDP SA   RD  AKT+YSRLFDW+V K
Sbjct  370   TTAELLRCDPVALEDALLKRVMITPEEVIKRSLDPLSATVGRDGFAKTIYSRLFDWLVDK  429

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD  SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  430   INVSIGQDAKSKSLIGVLDIYGFESFKHNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  489

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  490   REAIDWSYIEFVDNQDV  506



>ref|XP_010033759.1| PREDICTED: myosin-17 isoform X2 [Eucalyptus grandis]
Length=1403

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/353 (90%), Positives = 342/353 (97%), Gaps = 0/353 (0%)
 Frame = -2

Query  1059  YRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAYLGGRSGVEGRTVEQQVLESNPVLE  880
             YRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+LGGRSGVEGRTVEQQVLESNPVLE
Sbjct  12    YRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAHLGGRSGVEGRTVEQQVLESNPVLE  71

Query  879   AFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVRTYLLERSRVCQISTPERNYHCFYL  700
             AFGNAKT+RNNNSSRFGKFVEIQFDK+GRISGAA+RTYLLERSRVCQIS PERNYHCFYL
Sbjct  72    AFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIRTYLLERSRVCQISNPERNYHCFYL  131

Query  699   LCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVNDGEEYLATRRAMDIVGISEEEQEGI  520
             LCAAP E+  +YKLG+PKSFHYLNQS+CYEL+GVND  EYLATRRAMDIVGI+EEEQE I
Sbjct  132   LCAAPEEDIARYKLGSPKSFHYLNQSSCYELEGVNDAHEYLATRRAMDIVGINEEEQEAI  191

Query  519   FRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLNTTADLLKCDAKSLEDALIKRVMVT  340
             FRVVAAILHLGNI+FAKG+EIDSSVIKDEKSRFHLNTTA+LL+CDA+SLEDALIKRVMVT
Sbjct  192   FRVVAAILHLGNIDFAKGKEIDSSVIKDEKSRFHLNTTAELLRCDAQSLEDALIKRVMVT  251

Query  339   PEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQKINISIGQDPNSKSIIGVLDIYGFE  160
             PEEVITRTLDP +A+GSRDALAKT+YSRLFDWIV+KIN+SIGQDP SKS+IGVLDIYGFE
Sbjct  252   PEEVITRTLDPVNAIGSRDALAKTLYSRLFDWIVEKINLSIGQDPTSKSLIGVLDIYGFE  311

Query  159   SFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeyekeEINWSYIEFVDNQDV  1
             SFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY KEEI+WSYIEF+DNQDV
Sbjct  312   SFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYSKEEIDWSYIEFIDNQDV  364



>ref|XP_004495594.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1075

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/377 (82%), Positives = 342/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YK    GELSPHVFAVAD AYR M+ EGK+NSILVSGESGAGKTETTKMLM++LA+
Sbjct  116   MMERYKAVPVGELSPHVFAVADAAYREMVIEGKNNSILVSGESGAGKTETTKMLMQFLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR   EGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKF+EIQFDKSGRISGAA+R
Sbjct  176   VGGRVATEGRTVEQQVLESNPVLEAFGNAKTIRNNNSSRFGKFIEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ++ PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQS CYEL  +ND
Sbjct  236   TYLLERSRVCQVNDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSKCYELADLND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMDIVGIS+ +QE IFRVVAAILHLGNI+FAKG+EIDSSV KD+K++FHL 
Sbjct  296   AQEYLATRRAMDIVGISQTDQEAIFRVVAAILHLGNIDFAKGKEIDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   IAAELLMCDADALEDALCKRVMITPEEVIKRSLDPQSATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQH+FKMEQEEY 
Sbjct  416   INNSIGQDPNSKCLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHLFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_009372154.1| PREDICTED: myosin-9 [Pyrus x bretschneideri]
Length=1485

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA  GELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  72    MMQQYKGAPLGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  131

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  132   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  191

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE +KYKL NPKSF YLNQS CYEL GV+D
Sbjct  192   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIDKYKLANPKSFRYLNQSCCYELVGVSD  251

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQE IFRVVAAILH+GNIEF KG E+DSSV KD+K++FHL 
Sbjct  252   AHEYLATRRAMDIVGISAKEQEAIFRVVAAILHVGNIEFTKGSEVDSSVPKDDKAKFHLK  311

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  312   MTAELLMCDPDALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVDK  371

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD +SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  372   INVSIGQDASSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  431

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  432   KEQIDWSYIEFVDNQDV  448



>ref|XP_009396405.1| PREDICTED: myosin-11-like [Musa acuminata subsp. malaccensis]
Length=1530

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA  GELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMTQYKGAPLGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQF++ G+ISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFNRQGKISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP E  +KYKLG P SFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEIVDKYKLGKPSSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS +EQ+GIFRVVA ILHLGNI+F KGQE+DSSV+KD+KS+FHL 
Sbjct  296   AHDYLATRRAMDIVGISAQEQDGIFRVVAGILHLGNIDFTKGQEVDSSVLKDDKSKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD+++LEDAL KRVM+TPEEVI R LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDSEALEDALCKRVMITPEEVIKRPLDPHAATISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPTSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>ref|XP_009800533.1| PREDICTED: myosin-11-like isoform X2 [Nicotiana sylvestris]
Length=1465

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E+DSSVIK++K +FHL 
Sbjct  296   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEVDSSVIKEDKPKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  416   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  475

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  476   REAIDWSYIEFVDNQDV  492



>ref|XP_004495595.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1044

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/377 (82%), Positives = 342/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MME+YK    GELSPHVFAVAD AYR M+ EGK+NSILVSGESGAGKTETTKMLM++LA+
Sbjct  116   MMERYKAVPVGELSPHVFAVADAAYREMVIEGKNNSILVSGESGAGKTETTKMLMQFLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR   EGRTVEQQVLESNPVLEAFGNAKT+RNNNSSRFGKF+EIQFDKSGRISGAA+R
Sbjct  176   VGGRVATEGRTVEQQVLESNPVLEAFGNAKTIRNNNSSRFGKFIEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ++ PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQS CYEL  +ND
Sbjct  236   TYLLERSRVCQVNDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSKCYELADLND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMDIVGIS+ +QE IFRVVAAILHLGNI+FAKG+EIDSSV KD+K++FHL 
Sbjct  296   AQEYLATRRAMDIVGISQTDQEAIFRVVAAILHLGNIDFAKGKEIDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
               A+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   IAAELLMCDADALEDALCKRVMITPEEVIKRSLDPQSATVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQH+FKMEQEEY 
Sbjct  416   INNSIGQDPNSKCLIGVLDIYGFESFKLNSFEQFCINFTNEKLQQHFNQHLFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+INWSYIEFVDNQDV
Sbjct  476   KEQINWSYIEFVDNQDV  492



>ref|XP_010323140.1| PREDICTED: myosin-9-like [Solanum lycopersicum]
Length=1139

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/377 (83%), Positives = 342/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM +YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMAKYKGVQLGKLSPHVFAIADAAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  177   LGGHKGTQKRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKLG+PKSF YLNQSNCYEL GVND
Sbjct  237   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLGDPKSFRYLNQSNCYELVGVND  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IF VVA++LHLGNIEF KG E+DSSV+KD+KSRFHL 
Sbjct  297   AHDYLEIRRAMDIVGISEKEQEAIFSVVASVLHLGNIEFEKGNEVDSSVVKDDKSRFHLQ  356

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  SLEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  357   TTAELLMCDVTSLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTLYSRLFDWLVDK  416

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FK EQEEY 
Sbjct  417   INNSIGQDPHSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKTEQEEYT  476

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  477   KEEIDWSYIEFVDNQDV  493



>ref|XP_006352745.1| PREDICTED: myosin-9-like [Solanum tuberosum]
Length=1138

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/377 (83%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM +YKG   G+LSPHVFA+AD AYRAMINEGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  116   MMAKYKGVQLGKLSPHVFAIADTAYRAMINEGKSNSILVSGESGAGKTETTKMLMQYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G + RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  176   LGGHKGSQKRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKNGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE ++YKLG+PKSF YLNQSNCYEL GVND
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEEIKRYKLGDPKSFRYLNQSNCYELVGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YL  RRAMDIVGISE+EQE IF VVA++LHLGNIEF KG E+DSSV+KD+KSRFHL 
Sbjct  296   AHDYLEIRRAMDIVGISEKEQEAIFSVVASVLHLGNIEFEKGNEVDSSVVKDDKSRFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  SLEDAL++RVMVTPEEVI R+LDPE+A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDVTSLEDALLRRVMVTPEEVIKRSLDPEAAAVSRDGLAKTLYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQH+FKMEQEEY 
Sbjct  416   INNSIGQDPHSKSLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHMFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  476   KEEIDWSYIEFVDNQDV  492



>gb|EPS63247.1| hypothetical protein M569_11538, partial [Genlisea aurea]
Length=920

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/377 (81%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +MEQYKGAAFG+LSPHVFA+AD A+RAMINEGKSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  118   IMEQYKGAAFGKLSPHVFAIADAAFRAMINEGKSNSILVSGESGAGKTETTKMLMQYLAF  177

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG  G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK G+ISGAA+R
Sbjct  178   LGGHKGAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGKISGAAIR  237

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKY+LGNPK+FHYLNQSNCYEL GV D
Sbjct  238   TYLLERSRVCQISDPERNYHCFYLLCAAPKEEVEKYRLGNPKTFHYLNQSNCYELVGVCD  297

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATR+AMD+VGIS+ EQ+ IFR+VAAILHLGN+EF KG+E+DSS + +++S+FHL 
Sbjct  298   AHDYLATRKAMDVVGISQNEQDSIFRIVAAILHLGNVEFDKGEEVDSSALLNDESKFHLQ  357

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T ADLL CD  +LE+AL+KRVMVTPEEVI R+LDP  ++ SRD LAKT+YSRLFDW+V K
Sbjct  358   TAADLLMCDPNALENALLKRVMVTPEEVIERSLDPNGSIVSRDGLAKTLYSRLFDWLVDK  417

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKSIIG+LDIYGFESFK NSFEQ CIN+TNEKLQQHFNQ+VFKMEQEEY 
Sbjct  418   INFSIGQDPDSKSIIGILDIYGFESFKTNSFEQLCINYTNEKLQQHFNQYVFKMEQEEYV  477

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSYIEFVDNQDV
Sbjct  478   KEGIDWSYIEFVDNQDV  494



>ref|XP_009800532.1| PREDICTED: myosin-11-like isoform X1 [Nicotiana sylvestris]
Length=1526

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E+DSSVIK++K +FHL 
Sbjct  296   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEVDSSVIKEDKPKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  416   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  475

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  476   REAIDWSYIEFVDNQDV  492



>ref|XP_004494720.1| PREDICTED: myosin-H heavy chain-like [Cicer arietinum]
Length=1538

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAM+NE KSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMVNERKSNSILVSGESGAGKTETTKMLMQYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ++ PERNYHCFYLLCAAP EE +KYKLG+PK+FHYLNQS CYEL  ++D
Sbjct  236   TYLLERSRVCQVNDPERNYHCFYLLCAAPQEELDKYKLGHPKTFHYLNQSKCYELADISD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS++EQE IFRVVA+ILH+GNI+FAKG+E+DSSV KD+K+RFHL 
Sbjct  296   AREYLATRRAMDIVGISQKEQEAIFRVVASILHIGNIDFAKGKEVDSSVPKDDKARFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVMVTPEE+I R+LDP+SA  SRD  AKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDVDALEDALCKRVMVTPEEIIKRSLDPQSAAISRDGFAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDANSKSLIGVLDIYGFESFKSNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_009597755.1| PREDICTED: myosin-11-like isoform X2 [Nicotiana tomentosiformis]
Length=1465

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E DSSVIK++K +FHL 
Sbjct  296   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEADSSVIKEDKPKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  416   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  475

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  476   REAIDWSYIEFVDNQDV  492



>ref|XP_008370724.1| PREDICTED: myosin-9 [Malus domestica]
Length=1529

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA  GELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPLGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE +KYKL NPKSF YLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIDKYKLANPKSFRYLNQSRCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQE IFRVVAAILH+GNIEF KG E+DSSV KD+K++FHL 
Sbjct  296   AHEYLATRRAMDIVGISAKEQEAIFRVVAAILHVGNIEFTKGSEVDSSVPKDDKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAXLLMCDPDALEDALCKRVMITPEEVIKRSLDPQSAAISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQD +SKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDASSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_008659087.1| PREDICTED: myosin-11-like [Zea mays]
 gb|AFW85235.1| hypothetical protein ZEAMMB73_903589 [Zea mays]
Length=1529

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/377 (84%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGA FGELSPHVFAVADVAYRAM+NE KSN+ILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMHQYKGAPFGELSPHVFAVADVAYRAMVNENKSNAILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP E+ +KYKLGNPK+FHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPQEDVDKYKLGNPKTFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEF+KG+E DSSV+KDEKS+FHL 
Sbjct  296   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFSKGKEADSSVLKDEKSKFHLE  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL C+  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCNPGALEDALCKRVMVTPEEVIKRSLDPYNATISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD +SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INSSIGQDASSKCLIGVLDIYGFESFKANSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_011002934.1| PREDICTED: myosin-11 [Populus euphratica]
Length=1525

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 348/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADV+YRAM+ EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVSYRAMVIEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE E+YKLG+PKSFHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQVSNPERNYHCFYLLCAAPQEEVERYKLGSPKSFHYLNQSTCFELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS  EQE IFRVVAA+LH+GNI+FA+G+E+DSSV KD++++FHL 
Sbjct  296   AHDYLATRRAMDIVGISAREQEAIFRVVAAVLHIGNIDFARGKEVDSSVPKDDQAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP+SA+ SRD  AKT+YSRLFDWIV K
Sbjct  356   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPQSAVISRDGFAKTIYSRLFDWIVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  476   KEQIDWSYIEFVDNQDV  492



>ref|XP_011076889.1| PREDICTED: myosin-11-like [Sesamum indicum]
Length=1525

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI+EGKSNSILVSGESGAGKTETTKMLM+YLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMIHEGKSNSILVSGESGAGKTETTKMLMQYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFYLLCAAP EE +KYKL +PKSFHYLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYLLCAAPKEEIDKYKLDHPKSFHYLNQSKCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMDIVGIS+ EQE IFRVVAAILHLGNI+F KG+EIDSS+ KD K++FHL 
Sbjct  296   AHDYLATRRAMDIVGISKAEQEAIFRVVAAILHLGNIDFGKGKEIDSSIPKDNKAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TTAELLMCDPVALEDALCKRVMITPEEVIKRSLDPLSAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP SK +IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INKSIGQDPKSKCLIGVLDIYGFESFKHNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>ref|XP_002436758.1| hypothetical protein SORBIDRAFT_10g008210 [Sorghum bicolor]
 gb|EER88125.1| hypothetical protein SORBIDRAFT_10g008210 [Sorghum bicolor]
Length=1539

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/377 (85%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINE KSN+ILVSGESGAGKTETTKMLMRYLAY
Sbjct  126   MMQQYKGAPFGELSPHVFAVADVAYRAMINENKSNAILVSGESGAGKTETTKMLMRYLAY  185

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  186   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  245

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP E+ EKYKLGN K+FHYLNQSNCYEL GV+D
Sbjct  246   TYLLERSRVCQISDPERNYHCFYLLCAAPQEDVEKYKLGNRKTFHYLNQSNCYELVGVSD  305

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEF+KG+E+DSSV+KDEKS+FHL 
Sbjct  306   AHEYLATRRAMDIVGISTQEQDAIFRVVAAILHVGNIEFSKGKEVDSSVLKDEKSKFHLE  365

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL C+  +LEDAL KRVMVTPEEVI R+LDP +A  SRD LAKT+YSRLFDW+V K
Sbjct  366   TTAELLMCNPGALEDALCKRVMVTPEEVIKRSLDPYNATISRDGLAKTIYSRLFDWLVDK  425

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD +SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  426   INSSIGQDASSKCLIGVLDIYGFESFKANSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  485

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  486   KEQIDWSYIEFVDNQDV  502



>ref|XP_009597754.1| PREDICTED: myosin-11-like isoform X1 [Nicotiana tomentosiformis]
Length=1526

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 346/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFA+ADVAYRAM++EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAIADVAYRAMVHEGKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+PK+FHYLNQS C+EL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPKTFHYLNQSKCHELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYLATRRAMD+VGIS+ EQE IFRVVAAILHLGNI+FAKG+E DSSVIK++K +FHL 
Sbjct  296   ADEYLATRRAMDVVGISKHEQEAIFRVVAAILHLGNIDFAKGKEADSSVIKEDKPKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  416   INVSIGQDPQSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  475

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  476   REAIDWSYIEFVDNQDV  492



>ref|XP_011028769.1| PREDICTED: myosin-16 isoform X6 [Populus euphratica]
Length=952

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/377 (82%), Positives = 340/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA    LSPHVF +ADVAYR MI EG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   VMERYKGAPIEGLSPHVFTIADVAYREMIKEGRSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG SG EGRTVEQQVLESNPVLEAFGNAKT +NNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHSGAEGRTVEQQVLESNPVLEAFGNAKTAKNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ TRRAMD+VGI+E+EQ+ IFRVVAAILHLGNI F K ++IDS+V+KDE+S FHL 
Sbjct  296   AQEYITTRRAMDVVGINEKEQDAIFRVVAAILHLGNINFEKDEDIDSAVVKDEQSLFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  SLEDAL KRVM+TPEE+I R+LDP +A  SRD LAKT+YSRLF+W+V K
Sbjct  356   MTAELLMCDPLSLEDALCKRVMITPEEIIKRSLDPHAAAVSRDGLAKTIYSRLFEWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IG+LDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKCLIGILDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYA  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINW+Y+EFVDNQDV
Sbjct  476   KEEINWNYVEFVDNQDV  492



>ref|XP_002521016.1| myosin XI, putative [Ricinus communis]
 gb|EEF41433.1| myosin XI, putative [Ricinus communis]
Length=1129

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/377 (82%), Positives = 341/377 (90%), Gaps = 1/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  GELSPHVFA+A+++YR MINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  117   MMEQYKGARVGELSPHVFAIAEISYREMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  176

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG    EGRTVEQ+VLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD+ GRISGAA+R
Sbjct  177   LGGNKAAEGRTVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDEHGRISGAAIR  236

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNP+SFHYLNQS+CYEL GV+D
Sbjct  237   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPRSFHYLNQSSCYELVGVDD  296

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +Y ATRRAMD+VGISE+EQE IFRVVAAILHLGNI+F K ++IDSSV+KDE S FHL 
Sbjct  297   AHDYTATRRAMDVVGISEKEQEAIFRVVAAILHLGNIDFTKDEDIDSSVVKDE-SNFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD +SLEDAL KRVM+TPEE+I ++LDP  A  +RD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDPQSLEDALCKRVMITPEEIIKKSLDPHGAAVNRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNS  +IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKM+Q+EY 
Sbjct  416   INVSIGQDPNSNCLIGVLDIYGFESFRTNSFEQFCINFTNEKLQQHFNQHVFKMDQQEYI  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQDV
Sbjct  476   KEEINWSYIEFVDNQDV  492



>emb|CAN81284.1| hypothetical protein VITISV_030944 [Vitis vinifera]
Length=954

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/393 (80%), Positives = 339/393 (86%), Gaps = 17/393 (4%)
 Frame = -2

Query  1128  MEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAYL  949
             ME+YKGA  GELSPHVFAVADVAYR M NEGK NSILVSGESGAGKTETTKMLMRYLAYL
Sbjct  61    MEKYKGAPLGELSPHVFAVADVAYRDMANEGKGNSILVSGESGAGKTETTKMLMRYLAYL  120

Query  948   GGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVRT  769
             GG +  EGR+VEQ+VLESNPVLEAFGNAKTVRNNNSSRFGKFV IQFDK GRISGAA+RT
Sbjct  121   GGNTVTEGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVVIQFDKHGRISGAAIRT  180

Query  768   YLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVNDG  589
             YLLERSRVCQIS PERNYHCFY LCAAPPEE E+YKLGNPKSFHYLNQSNC EL  VND 
Sbjct  181   YLLERSRVCQISDPERNYHCFYHLCAAPPEEIERYKLGNPKSFHYLNQSNCLELLDVNDA  240

Query  588   EEYLATRRAMDIVGISEEE-----------------QEGIFRVVAAILHLGNIEFAKGQE  460
             + YLATRRAMDIVGISE+E                 QE IFRVVAAILHLGNI+FAKG+E
Sbjct  241   QYYLATRRAMDIVGISEKEQMLNVFTKSTLNKFSLSQEAIFRVVAAILHLGNIDFAKGEE  300

Query  459   IDSSVIKDEKSRFHLNTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDA  280
             +DSSV+KD+K++FHL  T++LL CD  +LEDAL KRVMVTPEEVI R+LDP  A  SRD 
Sbjct  301   VDSSVLKDDKAKFHLQMTSELLMCDPHALEDALCKRVMVTPEEVIKRSLDPLGAAVSRDG  360

Query  279   LAKTVYSRLFDWIVQKINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQ  100
             LAKT+YSRLFDW+V KIN SIGQDPNSKS IGVLDIYGFESFK NSFEQFCINFTNEKLQ
Sbjct  361   LAKTIYSRLFDWLVNKINFSIGQDPNSKSTIGVLDIYGFESFKTNSFEQFCINFTNEKLQ  420

Query  99    QHFNQHVFKMeqeeyekeEINWSYIEFVDNQDV  1
             QHFNQHVFKMEQEEY KE I+WSYIEF+DNQDV
Sbjct  421   QHFNQHVFKMEQEEYSKEGIDWSYIEFIDNQDV  453



>gb|AAF79470.1|AC022492_14 F1L3.28 [Arabidopsis thaliana]
Length=1599

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/388 (83%), Positives = 348/388 (90%), Gaps = 11/388 (3%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKG A GELSPHVFA+ D AYRAMINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  130   MMEQYKGIALGELSPHVFAIGDAAYRAMINEGKNNSILVSGESGAGKTETTKMLMRYLAF  189

Query  951   LGGRSGVEGRTVEQQVLE-----------SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD  805
             LGGRSGVEGRTVEQQVLE           SNPVLEAFGNAKT+RNNNSSRFGKFVEIQFD
Sbjct  190   LGGRSGVEGRTVEQQVLELNVYIPNGTLQSNPVLEAFGNAKTLRNNNSSRFGKFVEIQFD  249

Query  804   KSGRISGAAVRTYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQ  625
             K+GRISGAA+RTYLLERSRVCQIS PERNYHCFYLLCAAPPE+ +KYKL NP  FHYLNQ
Sbjct  250   KNGRISGAAIRTYLLERSRVCQISDPERNYHCFYLLCAAPPEDIKKYKLENPHKFHYLNQ  309

Query  624   SNCYELDGVNDGEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSV  445
             S+CY+LDGV+D  EYL TRRAMD+VGIS EEQE IFRVVAAILHLGNI+F KG+EIDSSV
Sbjct  310   SSCYKLDGVDDASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGKGEEIDSSV  369

Query  444   IKDEKSRFHLNTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTV  265
             IKD+ SR HLN  A+LL C+A+SLEDALI+RVMVTPEE+ITRTLDP++A+ SRD LAKT+
Sbjct  370   IKDKDSRSHLNMAAELLMCNAQSLEDALIRRVMVTPEEIITRTLDPDNAIASRDTLAKTI  429

Query  264   YSRLFDWIVQKINISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQ  85
             YS LFDWIV KIN SIGQDP SKSIIGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQ
Sbjct  430   YSHLFDWIVNKINTSIGQDPRSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQ  489

Query  84    HVFKMeqeeyekeEINWSYIEFVDNQDV  1
             HVFKMEQEEY KEEI WSYIEF+DNQDV
Sbjct  490   HVFKMEQEEYTKEEIAWSYIEFIDNQDV  517



>gb|KHN44988.1| Myosin-J heavy chain [Glycine soja]
Length=929

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/377 (81%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +M++YKGA  G+L PHVFA+A+ AYRAMINE KSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  60    VMQRYKGATIGDLDPHVFAIAESAYRAMINEEKSNSILVSGESGAGKTETTKMLMQYLAY  119

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG +  EGRTVE+QVLESNPVLEAFGNAKTVRN+NSSRFGKFVEIQF+K GRISGAA+R
Sbjct  120   LGGNTASEGRTVEKQVLESNPVLEAFGNAKTVRNDNSSRFGKFVEIQFNKYGRISGAAIR  179

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLE+SRVCQIS PERNYHCFYLLCA+PPEE+EKYKLG+P+SFHYLNQSNCYEL GVN 
Sbjct  180   TYLLEKSRVCQISAPERNYHCFYLLCASPPEEKEKYKLGDPRSFHYLNQSNCYELIGVNS  239

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EYL+T+RAMDIVGIS+EEQ+ IFRVVAAILHLGNI+FAK +E DSSV++DE+S+FHL 
Sbjct  240   AQEYLSTKRAMDIVGISQEEQDAIFRVVAAILHLGNIKFAKSEETDSSVLEDEESKFHLQ  299

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             TTA+LL CD  SLE AL +RVM+TPEE+I R+LDP  A  SRD LAKT+YSRLFDW+VQK
Sbjct  300   TTAELLMCDPNSLEGALRERVMITPEEIIKRSLDPLGATVSRDGLAKTLYSRLFDWLVQK  359

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             INISIGQDP+SK +IGVLDIYGFESF+ NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  360   INISIGQDPSSKCLIGVLDIYGFESFQMNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYT  419

Query  51    keEINWSYIEFVDNQDV  1
             KE I+WSY+EFVDNQDV
Sbjct  420   KEGIDWSYLEFVDNQDV  436



>gb|KDP23693.1| hypothetical protein JCGZ_23526 [Jatropha curcas]
Length=1540

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/390 (83%), Positives = 346/390 (89%), Gaps = 13/390 (3%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAM+NE KSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  116   MMQQYKGAPFGELSPHVFAVADVAYRAMVNEKKSNSILVSGESGAGKTETTKMLMRYLAF  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATRRAMD+VGIS +EQE IFRVVAAILHLGNI FAKG++IDSSV KDE+++FHL 
Sbjct  296   AHDYLATRRAMDVVGISAKEQEAIFRVVAAILHLGNILFAKGKDIDSSVPKDEQAKFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CDA +LEDAL KRVM+TPEEVI R+LDP+SA  SRD LAKT+YSRLFDW+V K
Sbjct  356   MTAELLMCDAIALEDALCKRVMITPEEVIKRSLDPQSAAVSRDGLAKTIYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQN-------------SFEQFCINFTNEKLQQHF  91
             IN SIGQDPNS  +IGVLDIYGFESFK N              FEQFCINFTNEKLQQHF
Sbjct  416   INNSIGQDPNSNCLIGVLDIYGFESFKTNRQGLNQNYVTHIIDFEQFCINFTNEKLQQHF  475

Query  90    NQHVFKMeqeeyekeEINWSYIEFVDNQDV  1
             NQHVFKMEQEEY KE+I+WSYIEFVDNQDV
Sbjct  476   NQHVFKMEQEEYTKEQIDWSYIEFVDNQDV  505



>ref|XP_011028766.1| PREDICTED: myosin-9 isoform X3 [Populus euphratica]
Length=1055

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/377 (82%), Positives = 340/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA    LSPHVF +ADVAYR MI EG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   VMERYKGAPIEGLSPHVFTIADVAYREMIKEGRSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG SG EGRTVEQQVLESNPVLEAFGNAKT +NNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHSGAEGRTVEQQVLESNPVLEAFGNAKTAKNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ TRRAMD+VGI+E+EQ+ IFRVVAAILHLGNI F K ++IDS+V+KDE+S FHL 
Sbjct  296   AQEYITTRRAMDVVGINEKEQDAIFRVVAAILHLGNINFEKDEDIDSAVVKDEQSLFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  SLEDAL KRVM+TPEE+I R+LDP +A  SRD LAKT+YSRLF+W+V K
Sbjct  356   MTAELLMCDPLSLEDALCKRVMITPEEIIKRSLDPHAAAVSRDGLAKTIYSRLFEWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IG+LDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKCLIGILDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYA  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINW+Y+EFVDNQDV
Sbjct  476   KEEINWNYVEFVDNQDV  492



>ref|XP_004249919.2| PREDICTED: myosin-11 [Solanum lycopersicum]
Length=1526

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFA+ADVAYRAMI EGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   MMQQYKGAPFGELNPHVFAIADVAYRAMILEGKSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKL +PKSF YLNQS CYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLEHPKSFRYLNQSKCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGIS++EQE IFRVVA+ILHLGNI+FAKG+E+DSSVIK+EK++ HL 
Sbjct  296   AEEYLATRRAMDVVGISKKEQEAIFRVVASILHLGNIDFAKGKEVDSSVIKEEKAKLHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKTVYSRLFDW+V K
Sbjct  356   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTVYSRLFDWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  416   INVSIGQDPLSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  475

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  476   REAIDWSYIEFVDNQDV  492



>ref|XP_010103104.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXC46298.1| Myosin-2 heavy chain [Morus notabilis]
Length=575

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/377 (80%), Positives = 338/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGAAFGELSPH+FAVAD  YRAMINE  S SILVSGESGAGKTETTKMLMRYLA+
Sbjct  29    MMEQYKGAAFGELSPHLFAVADTCYRAMINEKGSQSILVSGESGAGKTETTKMLMRYLAF  88

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR+G EGRTVEQQVLESNPVLEAFGNAKTV+NNNSSRFGKFVEIQFDK G+ISGAA+R
Sbjct  89    MGGRTGTEGRTVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKYGKISGAAIR  148

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFY+LCAAPPE+ +K+KLG+P+ FHYLNQS+CYE+  V+D
Sbjct  149   TYLLERSRVCQVSDPERNYHCFYMLCAAPPEDVKKFKLGDPRQFHYLNQSSCYEVANVDD  208

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYL TR AMDIVGIS+EEQE IFRVVAAILHLGNI+F KG+++DSS +KD+KS  HL 
Sbjct  209   AREYLETRNAMDIVGISQEEQEAIFRVVAAILHLGNIDFIKGKDVDSSKLKDDKSLNHLK  268

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LLKCD  SLE +L KRV+VTP+  IT+ LDP +A  +RDALAKT+YSRLFDWIV K
Sbjct  269   TAAELLKCDETSLEASLCKRVIVTPDGNITKPLDPAAAALNRDALAKTIYSRLFDWIVDK  328

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPN++S+IGVLDIYGFESFK NSFEQ CIN TNEKLQQHFNQHVFKMEQEEY 
Sbjct  329   INSSIGQDPNAESLIGVLDIYGFESFKINSFEQLCINLTNEKLQQHFNQHVFKMEQEEYT  388

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSY+EFVDNQDV
Sbjct  389   KEEINWSYVEFVDNQDV  405



>ref|XP_002521165.1| myosin XI, putative [Ricinus communis]
 gb|EEF41316.1| myosin XI, putative [Ricinus communis]
Length=1350

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/377 (83%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGAAFGELSPH FAVAD AYR MINEG S SILVSGESGAGKTE+TK+LMRYLAY
Sbjct  119   MMAQYKGAAFGELSPHPFAVADAAYRLMINEGISQSILVSGESGAGKTESTKLLMRYLAY  178

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD+ GRISGAA+R
Sbjct  179   MGGRAVAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDQMGRISGAAIR  238

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFY+LCAAP E+ ++YKLGNP++FHYLNQSNCYELDG++D
Sbjct  239   TYLLERSRVCQVSDPERNYHCFYMLCAAPQEDVQRYKLGNPRTFHYLNQSNCYELDGIDD  298

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ATRRAMDIVGIS +EQ+ IFRVVAA+LHLGNIEFAKG+E DSS+ KDEKSRFHL 
Sbjct  299   SKEYIATRRAMDIVGISSDEQDAIFRVVAAVLHLGNIEFAKGKETDSSMPKDEKSRFHLR  358

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD K+LED+L KRV+VT +E IT+ LDPESA+ SRDALAK VYSRLFDWIV K
Sbjct  359   TAAELLMCDVKALEDSLCKRVIVTRDETITKWLDPESAVLSRDALAKIVYSRLFDWIVDK  418

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SKS+IGVLDIYGFESFK NSFEQFCIN TNEKLQQHFNQHVFKMEQEEY 
Sbjct  419   INNSIGQDPDSKSLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYT  478

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYI+FVDNQDV
Sbjct  479   KEEIDWSYIDFVDNQDV  495



>gb|EYU17905.1| hypothetical protein MIMGU_mgv1a000381mg [Erythranthe guttata]
Length=1200

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/377 (82%), Positives = 345/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA  G+L+PHVFA+ADVA+RAM  EGKSNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  178   MMEQYKGAPLGKLNPHVFAIADVAFRAMRYEGKSNSILVSGESGAGKTETTKMLMQYLAY  237

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+G EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVE+QFDK GRISGAA+R
Sbjct  238   LGGRNGAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDKHGRISGAAIR  297

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLG+P +FHYLNQSNCYEL GV+D
Sbjct  298   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGHPNTFHYLNQSNCYELVGVSD  357

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               +YLATR+AMD+VGIS+ EQ+ IFRVVAAILHLGN+ F KG++IDSSV++++ S+FHL 
Sbjct  358   AHDYLATRKAMDVVGISQNEQDAIFRVVAAILHLGNVTFTKGEDIDSSVLENDVSKFHLQ  417

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL++RVMVTPEEVI R+LDP+ AL SRD LAKT+YSRLFDW+V K
Sbjct  418   TAAELLMCDPNALEDALLRRVMVTPEEVIKRSLDPDGALVSRDGLAKTIYSRLFDWLVDK  477

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN +IGQDPNSKS+IGVLDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFK EQEEY 
Sbjct  478   INFTIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKTEQEEYI  537

Query  51    keEINWSYIEFVDNQDV  1
             KEEI+WSYIEFVDNQDV
Sbjct  538   KEEIDWSYIEFVDNQDV  554



>gb|EMT07574.1| Myosin-2 heavy chain [Aegilops tauschii]
Length=1709

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/377 (84%), Positives = 351/377 (93%), Gaps = 3/377 (1%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYKGA FGELSPHVFA+ADVAYR MINEGK+NSILVSGESGAGKTETTKMLMRYLA+
Sbjct  148   MMEQYKGADFGELSPHVFAIADVAYREMINEGKNNSILVSGESGAGKTETTKMLMRYLAH  207

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGRSGVEGRTVEQQ   SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK+GRISGAA+R
Sbjct  208   LGGRSGVEGRTVEQQ---SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKTGRISGAAIR  264

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQI+TPERNYHCFY LCAAP E+ ++YKL + +SFHYLNQS+C E++G+ND
Sbjct  265   TYLLERSRVCQINTPERNYHCFYFLCAAPHEDTQRYKLADARSFHYLNQSSCIEVEGIND  324

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMDIVGI+EEEQE IFRVVAA+LH+GNI FAKG+E+DSSVI+D+ SRFHLN
Sbjct  325   AEEYLATRRAMDIVGINEEEQEAIFRVVAAVLHIGNINFAKGKEVDSSVIQDDNSRFHLN  384

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T ++LL+CD  +LE ALI R +VTPEE+ITRTLDPESAL SRDALAKT+YSRLFDWIV+K
Sbjct  385   TASELLECDCNNLEKALITREIVTPEEIITRTLDPESALASRDALAKTIYSRLFDWIVEK  444

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IGVLDIYGFESFK NSFEQ CIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  445   INVSIGQDPNSKQLIGVLDIYGFESFKINSFEQLCINYTNEKLQQHFNQHVFKMEQEEYT  504

Query  51    keEINWSYIEFVDNQDV  1
             +EEINWSYIEFVDNQDV
Sbjct  505   REEINWSYIEFVDNQDV  521



>gb|AAC64896.1| Strong similarity to F22O13.22 gi|3063460 myosin homolog from 
A. thaliana BAC gb|AC003981 [Arabidopsis thaliana]
Length=1556

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/405 (80%), Positives = 351/405 (87%), Gaps = 28/405 (7%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  111   MMQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  170

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  171   LGGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVR  230

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPE-EREKYKLGNPKSFHYLNQSNCYELDGVN  595
             TYLLERSRVCQIS PERNYHCFYLLCAAP E E EKYKLG+PK+FHYLNQS C+EL G++
Sbjct  231   TYLLERSRVCQISDPERNYHCFYLLCAAPQEQELEKYKLGHPKTFHYLNQSKCFELVGIS  290

Query  594   DGEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHL  415
             D  +Y+ATRRAMDIVG+SE+EQE IFRVVAAILHLGN+EF KG+E+DSSV KD+KS+FHL
Sbjct  291   DAHDYIATRRAMDIVGMSEKEQEAIFRVVAAILHLGNVEFTKGKEVDSSVPKDDKSKFHL  350

Query  414   NTTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDW---  244
             NT A+LL CD K+LEDAL KRVMVTPEEVI R+LDP+SAL SRD LAKT+YSRLFDW   
Sbjct  351   NTVAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWYFV  410

Query  243   ------------------------IVQKINISIGQDPNSKSIIGVLDIYGFESFKQNSFE  136
                                     +V+KIN+SIGQD  S+S+IGVLDIYGFESFK NSFE
Sbjct  411   TSNTTQVLVIDRFDSKLTSLVICRLVEKINVSIGQDATSRSLIGVLDIYGFESFKTNSFE  470

Query  135   QFCINFTNEKLQQHFNQHVFKMeqeeyekeEINWSYIEFVDNQDV  1
             QFCINFTNEKLQQHFNQHVFKMEQEEY KE I+WSYIEFVDNQDV
Sbjct  471   QFCINFTNEKLQQHFNQHVFKMEQEEYTKEAIDWSYIEFVDNQDV  515



>ref|XP_011028765.1| PREDICTED: myosin-9 isoform X2 [Populus euphratica]
Length=1105

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/377 (82%), Positives = 340/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA    LSPHVF +ADVAYR MI EG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   VMERYKGAPIEGLSPHVFTIADVAYREMIKEGRSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG SG EGRTVEQQVLESNPVLEAFGNAKT +NNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHSGAEGRTVEQQVLESNPVLEAFGNAKTAKNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ TRRAMD+VGI+E+EQ+ IFRVVAAILHLGNI F K ++IDS+V+KDE+S FHL 
Sbjct  296   AQEYITTRRAMDVVGINEKEQDAIFRVVAAILHLGNINFEKDEDIDSAVVKDEQSLFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  SLEDAL KRVM+TPEE+I R+LDP +A  SRD LAKT+YSRLF+W+V K
Sbjct  356   MTAELLMCDPLSLEDALCKRVMITPEEIIKRSLDPHAAAVSRDGLAKTIYSRLFEWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IG+LDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKCLIGILDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYA  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINW+Y+EFVDNQDV
Sbjct  476   KEEINWNYVEFVDNQDV  492



>ref|XP_011028764.1| PREDICTED: myosin-9 isoform X1 [Populus euphratica]
Length=1171

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/377 (82%), Positives = 340/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             +ME+YKGA    LSPHVF +ADVAYR MI EG+SNSILVSGESGAGKTETTKMLMRYLAY
Sbjct  116   VMERYKGAPIEGLSPHVFTIADVAYREMIKEGRSNSILVSGESGAGKTETTKMLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGG SG EGRTVEQQVLESNPVLEAFGNAKT +NNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  176   LGGHSGAEGRTVEQQVLESNPVLEAFGNAKTAKNNNSSRFGKFVEIQFDKKGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE EKYKLGNPKSFHYLNQSNCYEL GV+D
Sbjct  236   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIEKYKLGNPKSFHYLNQSNCYELVGVSD  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ TRRAMD+VGI+E+EQ+ IFRVVAAILHLGNI F K ++IDS+V+KDE+S FHL 
Sbjct  296   AQEYITTRRAMDVVGINEKEQDAIFRVVAAILHLGNINFEKDEDIDSAVVKDEQSLFHLQ  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
              TA+LL CD  SLEDAL KRVM+TPEE+I R+LDP +A  SRD LAKT+YSRLF+W+V K
Sbjct  356   MTAELLMCDPLSLEDALCKRVMITPEEIIKRSLDPHAAAVSRDGLAKTIYSRLFEWLVDK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDPNSK +IG+LDIYGFESFK NSFEQFCINFTNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INVSIGQDPNSKCLIGILDIYGFESFKANSFEQFCINFTNEKLQQHFNQHVFKMEQEEYA  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINW+Y+EFVDNQDV
Sbjct  476   KEEINWNYVEFVDNQDV  492



>ref|XP_002458397.1| hypothetical protein SORBIDRAFT_03g032770 [Sorghum bicolor]
 gb|EES03517.1| hypothetical protein SORBIDRAFT_03g032770 [Sorghum bicolor]
Length=499

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/376 (79%), Positives = 335/376 (89%), Gaps = 0/376 (0%)
 Frame = -2

Query  1128  MEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAYL  949
             ME+YKGA  G+L PHVFA+ADV+YR MINEGKSNSILVSGESGAGKTETTK+LMRYLA+L
Sbjct  117   MEKYKGANLGDLDPHVFAIADVSYRQMINEGKSNSILVSGESGAGKTETTKLLMRYLAFL  176

Query  948   GGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVRT  769
             GGRSG   RTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSG+ISGAA+RT
Sbjct  177   GGRSGTGERTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGKISGAAIRT  236

Query  768   YLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVNDG  589
             YLLERSRVCQI++PERNYHCFY LCAAP E+ +KYKLG+P SFHYLNQS C ++DG+ND 
Sbjct  237   YLLERSRVCQINSPERNYHCFYFLCAAPSEDLKKYKLGDPSSFHYLNQSACIKVDGINDA  296

Query  588   EEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLNT  409
             EEYLATR AMD VGI+++EQE IFRVVAA+LHLGNI FAKG+E+DSS+IKD+KSRFHLNT
Sbjct  297   EEYLATRNAMDTVGITDQEQEAIFRVVAAVLHLGNINFAKGREVDSSIIKDDKSRFHLNT  356

Query  408   TADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQKI  229
               +LL CD + LE+ALI R + TPE VIT T+ P SA  SRD LAK +YSRLFDW+V +I
Sbjct  357   AGELLMCDCEKLENALINREINTPEGVITTTVGPNSATISRDGLAKQIYSRLFDWLVNRI  416

Query  228   NISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeyek  49
             N SIGQDP+S  +IGVLDIYGFESFK NSFEQ CINFTNEKLQQHFNQ+VFKMEQEEY +
Sbjct  417   NASIGQDPDSNKLIGVLDIYGFESFKTNSFEQLCINFTNEKLQQHFNQNVFKMEQEEYTR  476

Query  48    eEINWSYIEFVDNQDV  1
             E+INWSYIEFVDNQDV
Sbjct  477   EQINWSYIEFVDNQDV  492



>ref|XP_006854437.1| hypothetical protein AMTR_s00039p00219460 [Amborella trichopoda]
 gb|ERN15904.1| hypothetical protein AMTR_s00039p00219460 [Amborella trichopoda]
Length=1497

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 340/377 (90%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MMEQYK AAFGELSPH FAVAD AYR M+NEG S SILVSGESGAGKTE+TKMLMRYLAY
Sbjct  135   MMEQYKAAAFGELSPHPFAVADAAYRLMMNEGISQSILVSGESGAGKTESTKMLMRYLAY  194

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  195   MGGRAAAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKRGRISGAAIR  254

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFY+LCAAPPE+ EKYKLGNP+ FHYLNQSNCYELDGVND
Sbjct  255   TYLLERSRVCQVSDPERNYHCFYMLCAAPPEDVEKYKLGNPRMFHYLNQSNCYELDGVND  314

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGIS +EQ+ IFRVVAAILHLGN+EFAKG+E DSS  KDEKS FHL 
Sbjct  315   SEEYLATRRAMDVVGISSDEQDAIFRVVAAILHLGNVEFAKGKETDSSQPKDEKSLFHLK  374

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+L  C+ K LED+L KRV+VT +E IT+TLDPESA  SRDALAK VYSRLFDW+V K
Sbjct  375   TAAELFMCNLKLLEDSLCKRVIVTRDETITKTLDPESATFSRDALAKIVYSRLFDWLVNK  434

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDP+SK +IGVLDIYGFESFK NSFEQFCIN TNEKLQQHFNQHVFKMEQEEY 
Sbjct  435   INSSIGQDPHSKFLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYT  494

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEF+DNQDV
Sbjct  495   KEEINWSYIEFIDNQDV  511



>ref|XP_006443695.1| hypothetical protein CICLE_v10018480mg [Citrus clementina]
 gb|ESR56935.1| hypothetical protein CICLE_v10018480mg [Citrus clementina]
Length=1408

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/377 (82%), Positives = 347/377 (92%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM QYKGAAFGELSPH FAVAD AYR MINEG S SILVSGESGAGKTE+TK LMRYLAY
Sbjct  116   MMAQYKGAAFGELSPHPFAVADAAYRQMINEGISQSILVSGESGAGKTESTKQLMRYLAY  175

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             +GGR+  EGR+VE++VLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFD+SGRISGAA+R
Sbjct  176   MGGRAAAEGRSVEKKVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDRSGRISGAAIR  235

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQ+S PERNYHCFY+LCAAPPE+ +++KLGNP++FHYLNQSNCYELDGVND
Sbjct  236   TYLLERSRVCQVSDPERNYHCFYMLCAAPPEDIQRFKLGNPRTFHYLNQSNCYELDGVND  295

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              +EY+ATR+AMD+VGIS +EQ+ IFRVVAAILHLGN+EFAKG+E+DSSV KD+KS+FHL 
Sbjct  296   SKEYIATRQAMDVVGISSDEQDAIFRVVAAILHLGNVEFAKGKEVDSSVPKDKKSQFHLK  355

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CDAK+LED+L KR +VT +E IT+ LDPE+A  SRDALAK VYSRLFDW+V+K
Sbjct  356   TVAELLMCDAKALEDSLCKREIVTRDETITKWLDPEAAAVSRDALAKIVYSRLFDWLVEK  415

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQDPNSKS+IGVLDIYGFESFK NSFEQFCIN TNEKLQQHFNQHVFKMEQEEY 
Sbjct  416   INNSIGQDPNSKSLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYS  475

Query  51    keEINWSYIEFVDNQDV  1
             KEEINWSYIEFVDNQD+
Sbjct  476   KEEINWSYIEFVDNQDI  492



>gb|EMT11775.1| Myosin-J heavy chain [Aegilops tauschii]
Length=1576

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 344/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGELSPHVFAVADVAYRAMI+EG+SNSILVSGESGAGKTETTKMLM+YLAY
Sbjct  133   MMQQYKGAPFGELSPHVFAVADVAYRAMIHEGRSNSILVSGESGAGKTETTKMLMQYLAY  192

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAAVR
Sbjct  193   LGGRAATEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAVR  252

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE +KYKL NP+++HYLN+SNCY+L GV+D
Sbjct  253   TYLLERSRVCQISDPERNYHCFYLLCAAPQEELDKYKLENPRTYHYLNKSNCYDLVGVSD  312

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
               EYLATRRAMDIVGIS +EQ+ IFRVVAAILH+GNIEFAKG+E+DSSV+KD+KS+FHL 
Sbjct  313   AREYLATRRAMDIVGISTQEQDAIFRVVAAILHIGNIEFAKGKEVDSSVLKDDKSKFHLE  372

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +  DAL KRVMVTPEEVI R+LDP SA  SRD  AKT+YSRLFDW+V K
Sbjct  373   TAAELLMCDPGAFTDALCKRVMVTPEEVIKRSLDPYSATISRDGFAKTIYSRLFDWLVDK  432

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN SIGQD NSK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY 
Sbjct  433   INSSIGQDANSKCLIGVLDIYGFESFKSNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYT  492

Query  51    keEINWSYIEFVDNQDV  1
             KE+I+WSYIEFVDNQDV
Sbjct  493   KEQIDWSYIEFVDNQDV  509



>ref|XP_006350947.1| PREDICTED: myosin-11-like [Solanum tuberosum]
Length=1460

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/377 (84%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1131  MMEQYKGAAFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAY  952
             MM+QYKGA FGEL+PHVFA+ADVAYRAMI EGKSNSILVSGESGAGKTETTKMLMRYLA+
Sbjct  50    MMQQYKGAPFGELNPHVFAIADVAYRAMILEGKSNSILVSGESGAGKTETTKMLMRYLAF  109

Query  951   LGGRSGVEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKSGRISGAAVR  772
             LGGR+  EGRTVEQQVL SNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDK GRISGAA+R
Sbjct  110   LGGRAATEGRTVEQQVLGSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKHGRISGAAIR  169

Query  771   TYLLERSRVCQISTPERNYHCFYLLCAAPPEEREKYKLGNPKSFHYLNQSNCYELDGVND  592
             TYLLERSRVCQIS PERNYHCFYLLCAAP EE  KYKL +PKSF YLNQS CYEL GV+D
Sbjct  170   TYLLERSRVCQISDPERNYHCFYLLCAAPQEEIVKYKLEHPKSFRYLNQSKCYELVGVSD  229

Query  591   GEEYLATRRAMDIVGISEEEQEGIFRVVAAILHLGNIEFAKGQEIDSSVIKDEKSRFHLN  412
              EEYLATRRAMD+VGIS++EQE IFRVVA+ILHLGNI+FAKG+E DSSVIK+EKS+ HL 
Sbjct  230   AEEYLATRRAMDVVGISKKEQEAIFRVVASILHLGNIDFAKGKEADSSVIKEEKSKLHLK  289

Query  411   TTADLLKCDAKSLEDALIKRVMVTPEEVITRTLDPESALGSRDALAKTVYSRLFDWIVQK  232
             T A+LL CD  +LEDAL KRVM+TPEEVI R+LDP SA  SRD LAKTVYSRLFDW+V K
Sbjct  290   TAAELLMCDPVALEDALCKRVMITPEEVIKRSLDPRSAEISRDGLAKTVYSRLFDWLVDK  349

Query  231   INISIGQDPNSKSIIGVLDIYGFESFKQNSFEQFCINFTNEKLQQHFNQHVFKMeqeeye  52
             IN+SIGQDP SK +IGVLDIYGFESFK NSFEQFCIN+TNEKLQQHFNQHVFKMEQEEY+
Sbjct  350   INVSIGQDPLSKCLIGVLDIYGFESFKHNSFEQFCINYTNEKLQQHFNQHVFKMEQEEYK  409

Query  51    keEINWSYIEFVDNQDV  1
             +E I+WSYIEFVDNQDV
Sbjct  410   REAIDWSYIEFVDNQDV  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2738153446368