BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13656_g1_i3 len=1816 path=[1:0-1455 @1457@!:1456-1707
1709:1708-1815]

Length=1816
                                                                      Score     E

emb|CDO97901.1|  unnamed protein product                                347   2e-109   
ref|XP_006343133.1|  PREDICTED: heterogeneous nuclear ribonucleop...    327   5e-102   
ref|XP_004235586.1|  PREDICTED: heterogeneous nuclear ribonucleop...    325   2e-101   
ref|XP_009773369.1|  PREDICTED: heterogeneous nuclear ribonucleop...    321   4e-100   
ref|XP_011072532.1|  PREDICTED: heterogeneous nuclear ribonucleop...    322   4e-100   
ref|XP_009588879.1|  PREDICTED: heterogeneous nuclear ribonucleop...    320   9e-100   
ref|XP_009787037.1|  PREDICTED: heterogeneous nuclear ribonucleop...    319   3e-99    
ref|XP_011013661.1|  PREDICTED: heterogeneous nuclear ribonucleop...    300   2e-91    
ref|XP_011015319.1|  PREDICTED: heterogeneous nuclear ribonucleop...    298   2e-90    
ref|XP_006369249.1|  hypothetical protein POPTR_0001s20310g             297   2e-90    
ref|XP_006385422.1|  hypothetical protein POPTR_0003s04340g             297   3e-90    
gb|EPS58223.1|  hypothetical protein M569_16592                         292   7e-90    
ref|XP_008228275.1|  PREDICTED: heterogeneous nuclear ribonucleop...    295   8e-90    
ref|XP_007215501.1|  hypothetical protein PRUPE_ppa006895mg             293   3e-89    
ref|XP_008391337.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   6e-88    
ref|XP_009380446.1|  PREDICTED: heterogeneous nuclear ribonucleop...    284   9e-86    
ref|XP_009409355.1|  PREDICTED: heterogeneous nuclear ribonucleop...    284   1e-85    
ref|XP_010915268.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   3e-85    
ref|XP_008782526.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   8e-85    
ref|XP_010654539.1|  PREDICTED: heterogeneous nuclear ribonucleop...    280   1e-84    
ref|XP_010925454.1|  PREDICTED: heterogeneous nuclear ribonucleop...    280   3e-84    
ref|NP_001145761.1|  uncharacterized protein LOC100279268               278   3e-83    Zea mays [maize]
gb|AFW76490.1|  hypothetical protein ZEAMMB73_698498                    278   3e-83    
ref|XP_002521392.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    277   9e-83    Ricinus communis
gb|AGT17194.1|  hypothetical protein SHCRBa_041_N14_R_160               275   6e-82    
ref|XP_004303649.1|  PREDICTED: RNA-binding protein Musashi homol...    274   1e-81    
ref|XP_004966062.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   1e-81    
ref|XP_008658258.1|  PREDICTED: hypothetical protein isoform X1         273   3e-81    
ref|XP_007150506.1|  hypothetical protein PHAVU_005G158100g             270   5e-81    
ref|XP_010033771.1|  PREDICTED: heterogeneous nuclear ribonucleop...    271   1e-80    
ref|XP_002437175.1|  hypothetical protein SORBIDRAFT_10g022380          271   1e-80    Sorghum bicolor [broomcorn]
gb|KDP40755.1|  hypothetical protein JCGZ_24754                         269   6e-80    
ref|XP_004951463.1|  PREDICTED: heterogeneous nuclear ribonucleop...    269   7e-80    
ref|XP_003542073.1|  PREDICTED: heterogeneous nuclear ribonucleop...    267   1e-79    
gb|EAZ37394.1|  hypothetical protein OsJ_21732                          266   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453550.1|  hypothetical protein SORBIDRAFT_04g007860          267   4e-79    Sorghum bicolor [broomcorn]
gb|EAZ01374.1|  hypothetical protein OsI_23407                          267   5e-79    Oryza sativa Indica Group [Indian rice]
gb|ACG36152.1|  heterogeneous nuclear ribonucleoprotein A3              266   8e-79    Zea mays [maize]
ref|NP_001131946.2|  uncharacterized protein LOC100193339               266   1e-78    Zea mays [maize]
ref|XP_008676544.1|  PREDICTED: uncharacterized protein LOC100193...    265   2e-78    
gb|AFW66026.1|  heterogeneous nuclear ribonucleoprotein A3              265   7e-78    
gb|EMS66161.1|  Heterogeneous nuclear ribonucleoprotein 27C             265   9e-78    
ref|XP_008462346.1|  PREDICTED: heterogeneous nuclear ribonucleop...    260   3e-77    
gb|KGN45519.1|  hypothetical protein Csa_7G450760                       259   5e-77    
ref|XP_003563737.1|  PREDICTED: heterogeneous nuclear ribonucleop...    261   7e-77    
ref|XP_010537557.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   8e-77    
ref|NP_001168743.1|  uncharacterized protein LOC100382538               260   1e-76    Zea mays [maize]
dbj|BAD17623.1|  putative heterogeneous nuclearribonucleoprotein A2     259   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571746.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   3e-76    
ref|XP_006648465.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   3e-76    
ref|NP_001046322.1|  Os02g0221500                                       259   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_173208.1|  RNA recognition motif-containing protein              257   1e-75    Arabidopsis thaliana [mouse-ear cress]
gb|EEE56577.1|  hypothetical protein OsJ_05928                          261   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006304958.1|  hypothetical protein CARUB_v10012031mg             256   2e-75    
ref|XP_010459366.1|  PREDICTED: heterogeneous nuclear ribonucleop...    256   2e-75    
ref|XP_006416683.1|  hypothetical protein EUTSA_v10007978mg             256   2e-75    
ref|XP_008462347.1|  PREDICTED: heterogeneous nuclear ribonucleop...    254   4e-75    
dbj|BAJ97842.1|  predicted protein                                      256   7e-75    
dbj|BAJ89606.1|  predicted protein                                      256   7e-75    
ref|XP_010498136.1|  PREDICTED: heterogeneous nuclear ribonucleop...    255   8e-75    
ref|XP_010476920.1|  PREDICTED: heterogeneous nuclear ribonucleop...    254   1e-74    
ref|XP_008782529.1|  PREDICTED: heterogeneous nuclear ribonucleop...    251   1e-73    
gb|ADN34116.1|  heterogeneous nuclear ribonucleoprotein a1              261   1e-73    
ref|XP_004141686.1|  PREDICTED: uncharacterized protein LOC101220676    260   2e-73    
emb|CDY26229.1|  BnaA06g11880D                                          250   5e-73    
ref|XP_009149216.1|  PREDICTED: heterogeneous nuclear ribonucleop...    250   6e-73    
gb|AAF79476.1|AC022492_20  F1L3.34                                      249   1e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CDY48318.1|  BnaC05g13720D                                          248   2e-72    
gb|AFW86727.1|  hypothetical protein ZEAMMB73_661369                    244   4e-72    
gb|KFK43948.1|  hypothetical protein AALP_AA1G195500                    246   1e-71    
ref|XP_006853839.1|  hypothetical protein AMTR_s00036p00067000          244   2e-70    
gb|ABR16107.1|  unknown                                                 241   1e-69    Picea sitchensis
ref|XP_009615296.1|  PREDICTED: heterogeneous nuclear ribonucleop...    239   1e-69    
ref|XP_002892960.1|  hypothetical protein ARALYDRAFT_335030             239   3e-69    
gb|ABR17668.1|  unknown                                                 238   9e-68    Picea sitchensis
ref|XP_010689212.1|  PREDICTED: heterogeneous nuclear ribonucleop...    234   2e-67    
ref|XP_002968957.1|  hypothetical protein SELMODRAFT_68338              225   2e-66    
gb|EMT12173.1|  Heterogeneous nuclear ribonucleoprotein 27C             237   3e-66    
ref|XP_010227591.1|  PREDICTED: heterogeneous nuclear ribonucleop...    232   5e-66    
ref|XP_006416684.1|  hypothetical protein EUTSA_v10007978mg             230   9e-66    
ref|XP_009337721.1|  PREDICTED: heterogeneous nuclear ribonucleop...    230   1e-65    
ref|XP_001773137.1|  predicted protein                                  224   1e-65    
ref|XP_001754422.1|  predicted protein                                  223   2e-65    
ref|XP_001752764.1|  predicted protein                                  221   2e-64    
gb|EAY85049.1|  hypothetical protein OsI_06408                          231   3e-64    Oryza sativa Indica Group [Indian rice]
gb|EMT25802.1|  Heterogeneous nuclear ribonucleoprotein 27C             229   5e-64    
gb|ABK24684.1|  unknown                                                 226   7e-64    Picea sitchensis
ref|NP_001057893.2|  Os06g0566100                                       219   2e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003542187.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   3e-62    
ref|XP_008358788.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   3e-62    
gb|AFW86729.1|  hypothetical protein ZEAMMB73_661369                    218   4e-62    
ref|XP_011038851.1|  PREDICTED: heterogeneous nuclear ribonucleop...    220   4e-62    
ref|XP_008366190.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   5e-62    
ref|XP_007020434.1|  RNA-binding family protein                         220   6e-62    
gb|KDP39313.1|  hypothetical protein JCGZ_01070                         220   7e-62    
gb|KHN10640.1|  Heterogeneous nuclear ribonucleoprotein 27C             219   9e-62    
ref|XP_009615253.1|  PREDICTED: RNA-binding protein squid               220   9e-62    
emb|CBI39777.3|  unnamed protein product                                217   1e-61    
ref|XP_007146012.1|  hypothetical protein PHAVU_006G005300g             219   1e-61    
ref|XP_009367242.1|  PREDICTED: heterogeneous nuclear ribonucleop...    219   1e-61    
ref|XP_010109275.1|  Heterogeneous nuclear ribonucleoprotein 27C        219   2e-61    
ref|XP_008366191.1|  PREDICTED: heterogeneous nuclear ribonucleop...    219   2e-61    
ref|XP_002271592.1|  PREDICTED: heterogeneous nuclear ribonucleop...    218   5e-61    Vitis vinifera
emb|CBI28469.3|  unnamed protein product                                214   5e-61    
emb|CBI18525.3|  unnamed protein product                                214   5e-61    
ref|XP_007049396.1|  RNA-binding family protein isoform 1               217   6e-61    
gb|KHG12728.1|  hypothetical protein F383_19605                         217   7e-61    
ref|XP_008218498.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   1e-60    
ref|XP_004502113.1|  PREDICTED: glycine-rich RNA-binding protein ...    216   1e-60    
ref|XP_009772282.1|  PREDICTED: heterogeneous nuclear ribonucleop...    217   1e-60    
ref|XP_010061433.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   2e-60    
ref|XP_008384591.1|  PREDICTED: heterogeneous nuclear ribonucleop...    217   2e-60    
ref|XP_010934253.1|  PREDICTED: heterogeneous nuclear ribonucleop...    219   2e-60    
ref|XP_007205326.1|  hypothetical protein PRUPE_ppa006963mg             217   3e-60    
ref|XP_002522793.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    215   3e-60    Ricinus communis
ref|XP_002267309.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   4e-60    Vitis vinifera
ref|XP_008384592.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   4e-60    
ref|XP_008229783.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   4e-60    
ref|XP_010252818.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   5e-60    
ref|XP_011091261.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   7e-60    
emb|CDP14410.1|  unnamed protein product                                214   7e-60    
ref|XP_002277226.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   7e-60    Vitis vinifera
gb|KHG09084.1|  Nuclear polyadenylated RNA-binding 4                    214   9e-60    
ref|XP_011091262.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   1e-59    
ref|XP_007215611.1|  hypothetical protein PRUPE_ppa007812mg             213   2e-59    
gb|KDO54113.1|  hypothetical protein CISIN_1g035855mg                   216   2e-59    
ref|XP_002300392.2|  hypothetical protein POPTR_0001s37920g             213   2e-59    Populus trichocarpa [western balsam poplar]
ref|XP_006489648.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   2e-59    
ref|XP_006420325.1|  hypothetical protein CICLE_v10004941mg             216   2e-59    
ref|XP_009763753.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   3e-59    
ref|XP_004294926.1|  PREDICTED: RNA-binding protein Musashi homol...    213   3e-59    
ref|XP_011029769.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   3e-59    
ref|XP_004296398.1|  PREDICTED: uncharacterized protein LOC101310107    216   3e-59    
ref|XP_002455956.1|  hypothetical protein SORBIDRAFT_03g027920          213   3e-59    Sorghum bicolor [broomcorn]
ref|NP_683559.2|  RNA recognition motif-containing protein              213   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625541.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   4e-59    
ref|XP_006338617.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   5e-59    
ref|XP_009358003.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   6e-59    
ref|XP_004231850.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   1e-58    
ref|XP_006407249.1|  hypothetical protein EUTSA_v10021050mg             211   1e-58    
ref|XP_006378320.1|  hypothetical protein POPTR_0010s07790g             214   1e-58    
ref|XP_011089468.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   1e-58    
ref|XP_008660278.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   1e-58    
ref|XP_004247759.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   2e-58    
ref|XP_006354447.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   2e-58    
ref|XP_010262417.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   2e-58    
ref|XP_007215536.1|  hypothetical protein PRUPE_ppa007179mg             211   2e-58    
ref|XP_008351334.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   2e-58    
gb|KEH24789.1|  RNA-binding (RRM/RBD/RNP motif) family protein          211   2e-58    
ref|XP_002528377.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    214   3e-58    Ricinus communis
ref|XP_011041422.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   3e-58    
emb|CDO99280.1|  unnamed protein product                                213   3e-58    
ref|XP_007150930.1|  hypothetical protein PHAVU_004G006700g             211   4e-58    
ref|NP_001061525.1|  Os08g0320100                                       210   4e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010088351.1|  Heterogeneous nuclear ribonucleoprotein 27C        210   4e-58    
ref|XP_009401201.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   4e-58    
ref|XP_008340642.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   4e-58    
ref|XP_006298001.1|  hypothetical protein CARUB_v10014046mg             210   4e-58    
ref|XP_007035223.1|  RNA-binding family protein isoform 2               213   4e-58    
ref|XP_006357669.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   4e-58    
ref|XP_004243590.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   5e-58    
ref|XP_008785173.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   5e-58    
ref|XP_009334212.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   5e-58    
gb|KFK38657.1|  hypothetical protein AALP_AA3G143300                    209   5e-58    
ref|XP_002312594.2|  hypothetical protein POPTR_0008s17030g             212   6e-58    Populus trichocarpa [western balsam poplar]
emb|CBI34862.3|  unnamed protein product                                207   6e-58    
gb|KHG04742.1|  Hrb27C                                                  209   6e-58    
ref|XP_011003137.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   7e-58    
gb|EPS72088.1|  g-strand specific single-stranded telomere-bindin...    209   7e-58    
ref|XP_004151998.1|  PREDICTED: DAZ-associated protein 1-like           211   7e-58    
ref|XP_010251079.1|  PREDICTED: glycine-rich RNA-binding protein ...    209   7e-58    
ref|XP_009334135.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   7e-58    
ref|XP_007222942.1|  hypothetical protein PRUPE_ppa005309mg             212   7e-58    
ref|XP_008447387.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   8e-58    
ref|XP_010500202.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   9e-58    
ref|XP_010942879.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   1e-57    
gb|AES71775.2|  RNA recognition motif                                   208   1e-57    
ref|XP_006357668.1|  PREDICTED: fibroin heavy chain-like                213   1e-57    
ref|XP_010109739.1|  Uncharacterized RNA-binding protein                211   2e-57    
ref|XP_002298541.2|  hypothetical protein POPTR_0001s35360g             209   2e-57    Populus trichocarpa [western balsam poplar]
ref|XP_004147161.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-57    
ref|XP_004234048.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   2e-57    
ref|XP_006356068.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-57    
gb|EYU18975.1|  hypothetical protein MIMGU_mgv1a019468mg                209   2e-57    
ref|XP_008460677.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-57    
ref|XP_006659294.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   2e-57    
ref|XP_004303580.1|  PREDICTED: RNA-binding protein Musashi homol...    208   2e-57    
emb|CAN67089.1|  hypothetical protein VITISV_033546                     201   2e-57    Vitis vinifera
ref|XP_007035222.1|  RNA-binding family protein isoform 1               213   2e-57    
ref|XP_010539319.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-57    
ref|XP_008224160.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-57    
ref|XP_010069110.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   3e-57    
ref|XP_009769829.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   3e-57    
ref|XP_010539320.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   3e-57    
ref|XP_006401444.1|  hypothetical protein EUTSA_v10013607mg             209   3e-57    
ref|XP_010264924.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   4e-57    
gb|KHG10024.1|  DAZ-associated 1                                        211   4e-57    
gb|KHN27548.1|  Nuclear polyadenylated RNA-binding protein 4            206   4e-57    
gb|KDP46415.1|  hypothetical protein JCGZ_10255                         207   4e-57    
ref|XP_010465141.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   4e-57    
ref|XP_010928065.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   4e-57    
ref|XP_010920312.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   6e-57    
ref|XP_010908651.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   6e-57    
gb|KDP40375.1|  hypothetical protein JCGZ_02373                         210   6e-57    
ref|XP_010908650.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   7e-57    
ref|XP_004973208.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   7e-57    
ref|XP_009614654.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   8e-57    
ref|XP_009380127.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   8e-57    
ref|XP_003547716.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   9e-57    
ref|XP_004173706.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...    209   9e-57    
gb|ADN95983.1|  G-strand specific single-stranded telomere-bindin...    206   9e-57    
ref|XP_010676082.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   1e-56    
gb|KDO55125.1|  hypothetical protein CISIN_1g016617mg                   207   1e-56    
gb|KCW52930.1|  hypothetical protein EUGRSUZ_J02246                     207   1e-56    
ref|XP_009420757.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   1e-56    
gb|KDO59188.1|  hypothetical protein CISIN_1g018875mg                   206   1e-56    
ref|XP_006474836.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   1e-56    
ref|XP_009598594.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   1e-56    
ref|XP_008346177.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   1e-56    
ref|XP_006857465.1|  hypothetical protein AMTR_s00067p00185510          209   1e-56    
ref|XP_006363028.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   2e-56    
ref|XP_008342253.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   2e-56    
ref|XP_006413156.1|  hypothetical protein EUTSA_v10025172mg             208   2e-56    
ref|XP_010908648.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   2e-56    
ref|XP_004243541.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   2e-56    
emb|CDY46690.1|  BnaA03g48180D                                          207   2e-56    
ref|XP_008372374.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   2e-56    
gb|ADN95984.1|  G-strand specific single-stranded telomere-bindin...    205   2e-56    
ref|XP_009361531.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-56    
emb|CAN68016.1|  hypothetical protein VITISV_025150                     208   2e-56    Vitis vinifera
gb|ADE75708.1|  unknown                                                 206   2e-56    
ref|XP_006857740.1|  hypothetical protein AMTR_s00061p00188860          205   2e-56    
emb|CDX92807.1|  BnaC07g40650D                                          207   2e-56    
ref|XP_003553735.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   3e-56    
ref|XP_009140012.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   3e-56    
gb|KGN61572.1|  hypothetical protein Csa_2G171930                       210   3e-56    
ref|XP_002285419.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   3e-56    Vitis vinifera
ref|XP_009137608.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   3e-56    
emb|CDY46689.1|  BnaA03g48190D                                          207   3e-56    
ref|XP_009404108.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   4e-56    
ref|XP_009764592.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   4e-56    
ref|XP_008802392.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   4e-56    
emb|CDY24201.1|  BnaC01g37810D                                          205   4e-56    
gb|KHG09558.1|  DAZ-associated protein 1                                207   4e-56    
emb|CDY11989.1|  BnaC03g14150D                                          207   4e-56    
ref|XP_008379218.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...    205   4e-56    
ref|XP_003573706.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   4e-56    
gb|KHN27466.1|  Heterogeneous nuclear ribonucleoprotein 27C             204   5e-56    
ref|NP_001137092.1|  uncharacterized protein LOC100217268               205   5e-56    Zea mays [maize]
gb|EMS45801.1|  Heterogeneous nuclear ribonucleoprotein 27C             204   5e-56    
ref|XP_008235616.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   5e-56    
ref|XP_009369427.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   5e-56    
ref|XP_002316761.1|  hypothetical protein POPTR_0011s09050g             207   6e-56    Populus trichocarpa [western balsam poplar]
ref|XP_008776925.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   6e-56    
gb|ABF70162.1|  RNA-binding protein, putative                           207   6e-56    Musa acuminata [banana]
gb|ADN95985.1|  G-strand specific single-stranded telomere-bindin...    203   6e-56    
gb|KHN43809.1|  RNA-binding protein Musashi like Rbp6                   208   7e-56    
ref|XP_009397215.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   7e-56    
ref|XP_004506674.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   7e-56    
ref|XP_004289979.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   7e-56    
ref|XP_002866102.1|  hypothetical protein ARALYDRAFT_495641             206   7e-56    
ref|XP_003551514.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   7e-56    
ref|XP_010528224.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   7e-56    
ref|XP_008776924.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   7e-56    
ref|XP_009132374.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   7e-56    
gb|KHN19675.1|  Heterogeneous nuclear ribonucleoprotein 27C             204   7e-56    
ref|NP_001242362.1|  uncharacterized protein LOC100793209               204   7e-56    
gb|AFK38101.1|  unknown                                                 204   7e-56    
ref|XP_009142599.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...    206   8e-56    
emb|CDX94301.1|  BnaC01g18830D                                          206   8e-56    
ref|XP_007146588.1|  hypothetical protein PHAVU_006G053000g             207   8e-56    
ref|XP_011007099.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   8e-56    
emb|CDY36753.1|  BnaA03g11330D                                          206   8e-56    
ref|XP_006586118.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   8e-56    
ref|XP_007020625.1|  RNA-binding family protein isoform 1               207   9e-56    
ref|XP_011007096.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   9e-56    
emb|CDY36357.1|  BnaC04g32650D                                          208   9e-56    
ref|XP_011007097.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   9e-56    
emb|CBI37165.3|  unnamed protein product                                199   9e-56    
ref|XP_007146589.1|  hypothetical protein PHAVU_006G053000g             207   1e-55    
ref|XP_011007622.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   1e-55    
ref|XP_007020626.1|  RNA-binding family protein isoform 2               207   1e-55    
emb|CBI23698.3|  unnamed protein product                                204   1e-55    
ref|XP_011007620.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   1e-55    
gb|EMT24058.1|  Heterogeneous nuclear ribonucleoprotein 27C             203   1e-55    
ref|XP_011007619.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   1e-55    
ref|XP_007020630.1|  RNA-binding family protein isoform 6               206   1e-55    
ref|XP_002870699.1|  hypothetical protein ARALYDRAFT_493936             205   1e-55    
ref|XP_007199867.1|  hypothetical protein PRUPE_ppa005979mg             205   1e-55    
dbj|BAK01877.1|  predicted protein                                      206   1e-55    
ref|XP_010438716.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   1e-55    
ref|XP_009795233.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   1e-55    
emb|CDX89316.1|  BnaA01g15770D                                          206   1e-55    
ref|XP_010252687.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
ref|XP_010433462.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
ref|XP_009397214.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   2e-55    
ref|XP_004250279.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
ref|XP_009631808.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
ref|NP_001031725.1|  RNA recognition motif-containing protein           205   2e-55    
ref|XP_010448232.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
emb|CDP03780.1|  unnamed protein product                                204   2e-55    
ref|XP_010552352.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   2e-55    
ref|NP_198865.1|  RNA-binding (RRM/RBD/RNP motifs) family protein       204   2e-55    
gb|EMS61711.1|  RNA-binding protein Musashi-like protein 2              206   2e-55    
ref|XP_010524610.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   2e-55    
ref|XP_005845491.1|  hypothetical protein CHLNCDRAFT_36600              201   2e-55    
ref|XP_007140937.1|  hypothetical protein PHAVU_008G153800g             203   2e-55    
ref|NP_567753.1|  RNA recognition motif-containing protein              205   2e-55    
ref|XP_006280461.1|  hypothetical protein CARUB_v10026394mg             205   2e-55    
ref|XP_004502112.1|  PREDICTED: glycine-rich RNA-binding protein ...    202   2e-55    
gb|KGN59707.1|  hypothetical protein Csa_3G839850                       203   2e-55    
ref|XP_010545265.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   2e-55    
gb|AAM97088.1|  RNA-binding protein-like                                205   2e-55    
ref|XP_002869600.1|  RNA recognition motif-containing protein           205   3e-55    
ref|XP_009405917.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-55    
dbj|BAH19875.1|  AT4G26650                                              205   3e-55    
ref|XP_002300356.2|  hypothetical protein POPTR_0001s37230g             206   3e-55    
ref|XP_003536257.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-55    
ref|NP_851195.1|  RNA recognition motif-containing protein              205   3e-55    
ref|XP_006352343.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-55    
gb|EPS59033.1|  hypothetical protein M569_15778                         201   3e-55    
ref|XP_010545264.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-55    
gb|KHN23872.1|  RNA-binding protein Musashi like Rbp6                   206   3e-55    
ref|XP_006283675.1|  hypothetical protein CARUB_v10004740mg             205   3e-55    
gb|KHM99490.1|  RNA-binding protein Musashi like Rbp6                   206   3e-55    
ref|XP_003544715.1|  PREDICTED: heterogeneous nuclear ribonucleop...    206   3e-55    
gb|EMT31848.1|  RNA-binding Musashi-2-like protein                      205   3e-55    
ref|XP_002529044.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    205   3e-55    
ref|NP_001068335.1|  Os11g0637700                                       205   3e-55    
ref|XP_010035445.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-55    
ref|NP_568826.1|  RNA recognition motif-containing protein              205   3e-55    
ref|XP_006447738.1|  hypothetical protein CICLE_v10015084mg             205   4e-55    
ref|XP_002274734.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   4e-55    
dbj|BAJ98879.1|  predicted protein                                      202   4e-55    
ref|XP_008464191.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   4e-55    
ref|XP_004140014.1|  PREDICTED: uncharacterized protein LOC101222391    205   4e-55    
ref|XP_007142374.1|  hypothetical protein PHAVU_008G274900g             205   4e-55    
emb|CDY42577.1|  BnaA04g10360D                                          206   4e-55    
ref|XP_010555949.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   4e-55    
ref|XP_003574688.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   4e-55    
ref|XP_006663067.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   5e-55    
ref|XP_007142373.1|  hypothetical protein PHAVU_008G274900g             205   5e-55    
ref|XP_006443770.1|  hypothetical protein CICLE_v10020365mg             203   5e-55    
ref|XP_010322842.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   5e-55    
ref|XP_006283677.1|  hypothetical protein CARUB_v10004740mg             204   5e-55    
ref|XP_009390837.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   5e-55    
gb|AES64505.2|  RNA-binding (RRM/RBD/RNP motif) family protein          205   5e-55    
ref|XP_006283676.1|  hypothetical protein CARUB_v10004740mg             204   6e-55    
ref|XP_009124728.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   6e-55    
ref|XP_009336098.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   6e-55    
ref|XP_003519614.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_006575702.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_004979810.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_010532688.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   7e-55    
ref|XP_009380131.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_010270159.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_010270160.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   7e-55    
ref|XP_010450655.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   8e-55    
ref|XP_010441197.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   8e-55    
emb|CDY43360.1|  BnaA01g29910D                                          201   8e-55    
dbj|BAB08572.1|  RNA-binding protein-like                               204   8e-55    
ref|XP_010441195.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   9e-55    
ref|XP_006452507.1|  hypothetical protein CICLE_v10008158mg             204   9e-55    
ref|XP_010435979.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   9e-55    
ref|XP_006474951.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   9e-55    
ref|XP_009380128.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   1e-54    
gb|KHG16529.1|  Nuclear polyadenylated RNA-binding 4                    201   1e-54    
ref|XP_004973780.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-54    
gb|KHN48470.1|  RNA-binding protein Musashi like 2                      204   1e-54    
gb|KDP36443.1|  hypothetical protein JCGZ_09513                         204   1e-54    
ref|XP_009802735.1|  PREDICTED: RNA-binding protein Musashi homol...    203   1e-54    
gb|KDO60385.1|  hypothetical protein CISIN_1g015040mg                   202   1e-54    
emb|CAN75779.1|  hypothetical protein VITISV_012423                     200   1e-54    
gb|KDP39233.1|  hypothetical protein JCGZ_00990                         204   1e-54    
ref|XP_010060242.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   1e-54    
ref|XP_002320502.2|  hypothetical protein POPTR_0014s15970g             204   1e-54    
emb|CAB43861.1|  hnRNP-like protein                                     205   1e-54    
gb|KCW66864.1|  hypothetical protein EUGRSUZ_F00624                     203   1e-54    
gb|KEH42685.1|  RNA-binding (RRM/RBD/RNP motif) family protein          203   1e-54    
ref|XP_006836782.1|  hypothetical protein AMTR_s00088p00174110          203   2e-54    
ref|XP_010060245.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   2e-54    
ref|XP_004293446.1|  PREDICTED: uncharacterized protein LOC101313871    203   2e-54    
ref|XP_010936617.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_010057821.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_004294459.1|  PREDICTED: uncharacterized protein LOC101307182    203   2e-54    
ref|XP_004495305.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_004486327.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_010688996.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_009625288.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_006852315.1|  hypothetical protein AMTR_s00049p00200350          200   2e-54    
ref|XP_010093086.1|  DAZ-associated protein 1                           202   2e-54    
ref|XP_004251544.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_009775500.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_003556346.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
ref|XP_010670958.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   2e-54    
ref|XP_006352009.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   2e-54    
gb|KDP26484.1|  hypothetical protein JCGZ_17642                         202   3e-54    
emb|CBI28407.3|  unnamed protein product                                201   3e-54    
gb|KHG04741.1|  Hrb27C                                                  199   3e-54    
ref|XP_004486326.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   3e-54    
gb|KHG05056.1|  RNA-binding Musashi                                     202   3e-54    
ref|XP_007215319.1|  hypothetical protein PRUPE_ppa005119mg             202   3e-54    
gb|KFK22119.1|  hypothetical protein AALP_AAs39140U000900               201   3e-54    
ref|XP_003594254.1|  RNA-binding protein, putative                      203   4e-54    
ref|XP_010522464.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   4e-54    
ref|XP_008342177.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   4e-54    
gb|KEH33977.1|  heterogeneous nuclear ribonucleoprotein 27C, puta...    202   4e-54    
ref|XP_010418951.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   4e-54    
ref|XP_003600251.1|  Heterogeneous nuclear ribonucleoprotein A1         202   4e-54    
ref|XP_003577309.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   4e-54    
ref|XP_011003504.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   5e-54    
gb|KDP29893.1|  hypothetical protein JCGZ_18462                         202   5e-54    
dbj|BAF01381.1|  hypothetical protein                                   194   5e-54    
ref|XP_007144122.1|  hypothetical protein PHAVU_007G130600g             202   5e-54    
emb|CDY12068.1|  BnaC03g59840D                                          199   5e-54    
ref|XP_008229871.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   5e-54    
ref|XP_010112801.1|  DAZ-associated protein 1                           204   6e-54    
ref|XP_009134994.1|  PREDICTED: heterogeneous nuclear ribonucleop...    202   6e-54    
gb|KDO62196.1|  hypothetical protein CISIN_1g009920mg                   203   6e-54    
ref|XP_007215320.1|  hypothetical protein PRUPE_ppa005132mg             202   6e-54    
ref|XP_008227101.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   7e-54    
gb|KHG03317.1|  RNA-binding Musashi                                     202   7e-54    
ref|XP_007026291.1|  RNA-binding family protein isoform 1               201   7e-54    
gb|ABK24693.1|  unknown                                                 201   8e-54    
ref|XP_010435156.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   8e-54    
ref|XP_002882810.1|  RNA recognition motif-containing protein           194   9e-54    
ref|XP_007212015.1|  hypothetical protein PRUPE_ppa004834mg             201   9e-54    
ref|NP_001062119.1|  Os08g0492100                                       198   9e-54    
gb|ADK92872.1|  hnRNP                                                   201   9e-54    
ref|XP_008342216.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_011097787.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_010509893.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   1e-53    
ref|XP_006338616.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   1e-53    
ref|XP_007026295.1|  RNA-binding family protein isoform 5               201   1e-53    
ref|XP_002521470.1|  RNA binding protein, putative                      210   1e-53    
ref|XP_011095499.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_010443192.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_007212016.1|  hypothetical protein PRUPE_ppa004834mg             201   1e-53    
ref|XP_006452643.1|  hypothetical protein CICLE_v10009293mg             194   1e-53    
ref|XP_010907705.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_004173895.1|  PREDICTED: nuclear polyadenylated RNA-bindin...    195   1e-53    
gb|EYU33847.1|  hypothetical protein MIMGU_mgv1a008238mg                198   1e-53    
emb|CDX74030.1|  BnaA03g30170D                                          201   1e-53    
ref|NP_851001.1|  RNA recognition motif-containing protein              194   1e-53    
ref|XP_008341707.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    209   1e-53    
ref|XP_008463022.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   1e-53    
ref|XP_002272993.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   1e-53    
ref|XP_010450068.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   1e-53    
ref|NP_193166.2|  heterogeneous nuclear ribonucleoprotein 1             199   1e-53    
ref|XP_004293449.1|  PREDICTED: uncharacterized protein LOC101314729    201   1e-53    
ref|XP_004982907.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   1e-53    
ref|XP_009606898.1|  PREDICTED: RNA-binding protein Musashi homol...    200   1e-53    
ref|XP_004149406.1|  PREDICTED: nuclear polyadenylated RNA-bindin...    197   1e-53    
ref|XP_009412069.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   2e-53    
ref|XP_010557695.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   2e-53    
ref|XP_007049271.1|  HnRNP isoform 1                                    201   2e-53    
ref|XP_007026293.1|  RNA-binding family protein isoform 3               201   2e-53    
ref|XP_011098418.1|  PREDICTED: heterogeneous nuclear ribonucleop...    198   2e-53    
ref|XP_010557774.1|  PREDICTED: heterogeneous nuclear ribonucleop...    201   2e-53    
ref|XP_007142507.1|  hypothetical protein PHAVU_008G286500g             201   2e-53    
ref|XP_010547196.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   2e-53    
ref|XP_011024451.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   2e-53    
ref|XP_010909449.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   2e-53    
ref|XP_002870323.1|  hypothetical protein ARALYDRAFT_493480             198   2e-53    
ref|XP_009377146.1|  PREDICTED: nuclear pore membrane glycoprotei...    209   2e-53    
ref|XP_010675870.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   2e-53    
ref|XP_006449887.1|  hypothetical protein CICLE_v10015098mg             200   2e-53    
gb|KHG03345.1|  RNA-binding Musashi Rbp6                                200   2e-53    
ref|XP_009790873.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   3e-53    
ref|XP_010413869.1|  PREDICTED: heterogeneous nuclear ribonucleop...    198   3e-53    
emb|CDY07975.1|  BnaC03g35480D                                          199   3e-53    
emb|CDX90262.1|  BnaA08g17220D                                          197   3e-53    
gb|KFK33096.1|  hypothetical protein AALP_AA6G330700                    204   3e-53    
ref|XP_009109571.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   3e-53    
ref|NP_001168878.1|  uncharacterized protein LOC100382683               199   3e-53    
ref|XP_006467314.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   3e-53    
ref|XP_008783019.1|  PREDICTED: heterogeneous nuclear ribonucleop...    196   4e-53    
ref|XP_009141312.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   4e-53    
ref|XP_003601524.1|  RNA-binding protein                                197   4e-53    
ref|XP_009790872.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   4e-53    
gb|KDO35501.1|  hypothetical protein SPRG_00348                         198   4e-53    
ref|XP_002532010.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    200   4e-53    
ref|XP_010536715.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   4e-53    
ref|XP_010483006.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   4e-53    
ref|XP_006446597.1|  hypothetical protein CICLE_v10018414mg             192   4e-53    
ref|XP_010536716.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   4e-53    
gb|ACN39853.1|  unknown                                                 199   4e-53    
ref|XP_011039340.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   5e-53    
ref|XP_004251912.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   5e-53    
gb|KDO78485.1|  hypothetical protein CISIN_1g011518mg                   199   5e-53    
ref|XP_009361093.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   5e-53    
ref|XP_002528240.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    199   5e-53    
ref|NP_001146692.1|  uncharacterized protein LOC100280293               199   5e-53    
ref|XP_006595660.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   6e-53    
ref|XP_009370365.1|  PREDICTED: nuclear pore membrane glycoprotei...    208   6e-53    
ref|XP_004489232.1|  PREDICTED: nuclear pore membrane glycoprotei...    208   6e-53    
emb|CBI26733.3|  unnamed protein product                                194   7e-53    
ref|XP_004236665.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   7e-53    
ref|XP_011040202.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   7e-53    
ref|XP_008798476.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   7e-53    



>emb|CDO97901.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/273 (69%), Positives = 218/273 (80%), Gaps = 18/273 (7%)
 Frame = -2

Query  1671  DYGVAEQNDVGYYGGD-------RGEGDLQYEEENRQEQLYSRgggggG-------DLEP  1534
             DY  AEQN    YG D       +G G+ +YEE+N  E  YS  GGGGG       +LEP
Sbjct  4     DYVAAEQN-FSAYGVDEQQSHHRQGGGEDEYEEDNHGEDYYSERGGGGGGIGGGGGELEP  62

Query  1533  PIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMD  1354
               +  D ++AGH+LKHS+DDS  SAGKLFVGGIAWETSEE F+RYFSKYGE+ DSVIMMD
Sbjct  63    LDNIDDSTTAGHDLKHSVDDS--SAGKLFVGGIAWETSEESFSRYFSKYGELTDSVIMMD  120

Query  1353  KVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRR-VSKTKKIFV  1177
             K+SGRPRGFGF+TFADPEVAN+VL+EEH+IDGR VEVKRTVPRED   R  VS+TKKIF+
Sbjct  121   KISGRPRGFGFVTFADPEVANKVLEEEHIIDGRTVEVKRTVPREDMQGRGGVSRTKKIFI  180

Query  1176  GGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMH  997
             GGIP TLTEDEL+EYFS+YG VVEHQIMLDH TGRSRGFGFVTF+ EDAV+K+ +DG+MH
Sbjct  181   GGIPLTLTEDELREYFSAYGKVVEHQIMLDHKTGRSRGFGFVTFETEDAVEKIFTDGQMH  240

Query  996   ELNGKQVEIKRAEPKRAGGDRASEGRMHRGNSN  898
             EL GKQVEIK+AEPKR+G D +S+ RM RG SN
Sbjct  241   ELGGKQVEIKKAEPKRSGYDHSSDSRMRRGGSN  273



>ref|XP_006343133.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=386

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 180/210 (86%), Gaps = 2/210 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             SAGHELKHS+DDS  SAGKLFVGGIAWET EE F +YFS++GE+ D VIMMDKVSGRPRG
Sbjct  19    SAGHELKHSLDDS--SAGKLFVGGIAWETREESFRKYFSRFGEITDCVIMMDKVSGRPRG  76

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADPE AN+VL+EEH+IDGR VEVKRTVP+ED   +   KTKKIFVGG+P TLTE
Sbjct  77    FGFVTFADPEAANKVLEEEHIIDGRTVEVKRTVPKEDMQVKGSPKTKKIFVGGLPLTLTE  136

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFSSYG V+E QIMLD  +GRSRGFGF+TFD+E+AV+KVL++GRMHE++GKQVEI
Sbjct  137   DELKEYFSSYGHVLEQQIMLDRESGRSRGFGFITFDSENAVEKVLNNGRMHEIHGKQVEI  196

Query  969   KRAEPKRAGGDRASEGRMHRGNSNMHSYGN  880
             KRAEPKRAG + A E R HRG S   SY N
Sbjct  197   KRAEPKRAGAENAIESRQHRGGSGSRSYNN  226



>ref|XP_004235586.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
 ref|XP_010318497.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=376

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 180/210 (86%), Gaps = 2/210 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             SAGHELKHS+DDS  SAGKLFVGGIAWET EE F +YFS++GE+ D VIMMDKVSGRPRG
Sbjct  19    SAGHELKHSLDDS--SAGKLFVGGIAWETREESFRKYFSRFGEITDCVIMMDKVSGRPRG  76

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADPE AN+VL+EEH+IDGR VEVKRTVP+ED   +   KTKKIFVGG+P TLTE
Sbjct  77    FGFVTFADPEAANKVLEEEHIIDGRTVEVKRTVPKEDMQVKGSPKTKKIFVGGLPLTLTE  136

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFSSYG V+E QIMLD  +GRSRGFGF+TFD+E+AV++VL++GRMHE++GKQVEI
Sbjct  137   DELKEYFSSYGHVLEQQIMLDRESGRSRGFGFITFDSENAVEEVLNNGRMHEIHGKQVEI  196

Query  969   KRAEPKRAGGDRASEGRMHRGNSNMHSYGN  880
             KRAEPKRAG + A E R HRG S   SY N
Sbjct  197   KRAEPKRAGAENAIESRQHRGGSGSRSYNN  226



>ref|XP_009773369.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=367

 Score =   321 bits (822),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S  HELKHS+DDS  SAGKLFVGGIAWET+EE F ++FS++GE+ D+VIMMDKVSGRPRG
Sbjct  13    SESHELKHSMDDS--SAGKLFVGGIAWETTEESFRKHFSQFGEITDAVIMMDKVSGRPRG  70

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+T+ D EVAN+VL+E+HVIDGR VEVK+TVP+E+   +   KTKKIF+GG+P  LTE
Sbjct  71    FGFVTYVDAEVANKVLEEDHVIDGRAVEVKKTVPKENMQVKGAPKTKKIFIGGLPLPLTE  130

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFSSYG VVEHQIMLD NTGRSRGFGFVTFDNE+AV+KVLS+GRMHEL GKQVEI
Sbjct  131   DELKEYFSSYGYVVEHQIMLDQNTGRSRGFGFVTFDNEEAVEKVLSNGRMHELRGKQVEI  190

Query  969   KRAEPKRAGGDRASEGRMHRGNSNMHSY  886
             KRAEPKR G + ASE R+HRG S+  +Y
Sbjct  191   KRAEPKRGGAEHASESRLHRGGSSSKAY  218



>ref|XP_011072532.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A2 homolog 
1 [Sesamum indicum]
Length=400

 Score =   322 bits (825),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 195/255 (76%), Gaps = 21/255 (8%)
 Frame = -2

Query  1674  MDYGVAEQNDVGYYGGDRGEGDLQYEEENRQEQLYSRgggggGDLEPPIHSLDGSSAGHE  1495
             MDYGV EQN V  YG +  + +  YE E                 E    S+D       
Sbjct  1     MDYGVPEQN-VAVYGDEEPQYEGHYEAE-----------------EGNYDSIDNIDDSAG  42

Query  1494  LKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFIT  1315
             +KH   DS+ SAGKLFVGGIAWETSEE F+RYF KYGE+ DSVIM+DK+SGRPRGFGF+T
Sbjct  43    IKH---DSSSSAGKLFVGGIAWETSEESFSRYFRKYGEITDSVIMLDKISGRPRGFGFVT  99

Query  1314  FADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKE  1135
             FADPEVA++VLQE+HVIDGR VEVKRTVPRED   R VS+TKKIFVGG+P +L ED+L+E
Sbjct  100   FADPEVADKVLQEDHVIDGRAVEVKRTVPREDMQGRGVSRTKKIFVGGLPLSLNEDDLRE  159

Query  1134  YFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEP  955
             YFSSYG++VEHQIMLDH TGRSRGFGFVTF+NEDAV+K+ SDGRMHEL GKQVEIKRAEP
Sbjct  160   YFSSYGNIVEHQIMLDHKTGRSRGFGFVTFENEDAVEKIFSDGRMHELGGKQVEIKRAEP  219

Query  954   KRAGGDRASEGRMHR  910
             KR+G D +SE R+ R
Sbjct  220   KRSGFDHSSESRLRR  234



>ref|XP_009588879.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009588880.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=364

 Score =   320 bits (819),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S  HELKHS+DDS  SAGKLFVGGIAWET+EE F ++FS++GE+ D+VIMMDKVSGRPRG
Sbjct  13    SESHELKHSMDDS--SAGKLFVGGIAWETTEESFRKHFSQFGEITDAVIMMDKVSGRPRG  70

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+T+AD EVAN+VL+E+HVIDGR VEVK+TVP+E+   +  SKTKKIF+GG+P  LTE
Sbjct  71    FGFVTYADVEVANKVLEEDHVIDGRAVEVKKTVPKENMQVKGASKTKKIFIGGLPLPLTE  130

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFSSYG VVEHQIMLD NTGRSRGFGFVTFDNE+AV+KVLS+GRMHEL GKQVEI
Sbjct  131   DELKEYFSSYGYVVEHQIMLDQNTGRSRGFGFVTFDNEEAVEKVLSNGRMHELRGKQVEI  190

Query  969   KRAEPKRAGGDRASEGRMHR  910
             KRAEPKR G + ASE R+HR
Sbjct  191   KRAEPKRGGAEHASESRLHR  210



>ref|XP_009787037.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=379

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 189/263 (72%), Gaps = 31/263 (12%)
 Frame = -2

Query  1674  MDYGVAEQNDVGYYGGDRGEGDLQYEEENRQEQLYSRgggggGDLEPPIHSLDGSSAGHE  1495
             MDY VAEQND  Y                               LEP   +   +SAGHE
Sbjct  1     MDYDVAEQNDGNY-----------------------------QPLEPYSETRGDNSAGHE  31

Query  1494  LKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFIT  1315
             LKHSIDDS  SAGKLFVGGIAWET+EE F +YFS++GE  D VIMMDKVSGRPRGFGF+T
Sbjct  32    LKHSIDDS--SAGKLFVGGIAWETNEESFRKYFSRFGETTDCVIMMDKVSGRPRGFGFVT  89

Query  1314  FADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKE  1135
             FA+PEV N+VL+E+HVIDGR VEVKRTVP+ED   +   KTKK FVGG+P +LTEDELKE
Sbjct  90    FANPEVVNKVLEEDHVIDGRTVEVKRTVPKEDMQVKGAPKTKKFFVGGLPLSLTEDELKE  149

Query  1134  YFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEP  955
             YF SYG V+EHQIMLD  TGRSRGFGFVTFD+E A++KVL++GRMHE+ GKQ EIKRAEP
Sbjct  150   YFYSYGYVLEHQIMLDRETGRSRGFGFVTFDSEHAIEKVLNNGRMHEICGKQAEIKRAEP  209

Query  954   KRAGGDRASEGRMHRGNSNMHSY  886
             KRAG + A+  R H G S   SY
Sbjct  210   KRAGAEYANGSRQHHGGSGSKSY  232



>ref|XP_011013661.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=411

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S  H   H   DS+ SAGKLFVGG++WET+EE F  YFSKYGEV+DSVIM D+ SGRPRG
Sbjct  62    SMNHHYHHHNRDSS-SAGKLFVGGVSWETTEETFTNYFSKYGEVMDSVIMTDRHSGRPRG  120

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADP V +RVL+E+HVIDGR VEVKRTVPRED  F+ +++TKKIFVGGIPP+LTE
Sbjct  121   FGFVTFADPAVGDRVLEEDHVIDGRAVEVKRTVPREDIEFKGITRTKKIFVGGIPPSLTE  180

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFS YGS+V+HQIMLDH TGRSRGFGFVTFD EDAV+++ S+GR HEL GKQVEI
Sbjct  181   DELKEYFSVYGSIVDHQIMLDHKTGRSRGFGFVTFDIEDAVEQIFSEGRTHELGGKQVEI  240

Query  969   KRAEPKRAGGDRASEGRMHRGNSNM  895
             K+AEPKR GGD  +  + + G  N+
Sbjct  241   KKAEPKRTGGDHGNATKSYAGFRNV  265



>ref|XP_011015319.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Populus 
euphratica]
Length=415

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -2

Query  1461  AGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVL  1282
             AGKLFVGG++WET+EE F  YFSKYGEV+DSVIM D+ SGRPRGFGF+TFADP VA+RVL
Sbjct  71    AGKLFVGGVSWETTEETFTNYFSKYGEVMDSVIMTDRHSGRPRGFGFVTFADPAVADRVL  130

Query  1281  QEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEH  1102
             +E+HVIDGR VEVKRTVPRED   + V++TKKIFVGGIPP+LTEDELKEYFS YGS+V+H
Sbjct  131   EEDHVIDGRAVEVKRTVPREDMDIKGVTRTKKIFVGGIPPSLTEDELKEYFSVYGSIVDH  190

Query  1101  QIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEG  922
             QIMLDH TGRSRGFGFVTFD EDAV+++ S+GR HEL GKQVEIK+AEPKR+GGD  S  
Sbjct  191   QIMLDHKTGRSRGFGFVTFDIEDAVEQIFSEGRTHELGGKQVEIKKAEPKRSGGDYGSTA  250

Query  921   RMH  913
             + H
Sbjct  251   KSH  253



>ref|XP_006369249.1| hypothetical protein POPTR_0001s20310g [Populus trichocarpa]
 gb|ERP65818.1| hypothetical protein POPTR_0001s20310g [Populus trichocarpa]
Length=408

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 169/201 (84%), Gaps = 2/201 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S  H   H   DS+ SAGKLFVGG++WET+EE F  YFSKYGEV+DSVIM D+ SGRPRG
Sbjct  60    SMNHHYHHHNRDSS-SAGKLFVGGVSWETTEETFTNYFSKYGEVMDSVIMTDRHSGRPRG  118

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADP VA+RVL+E+HVIDGR VEVKRTVPRED   R V++TKKIFVGGIPP+LTE
Sbjct  119   FGFVTFADPVVADRVLEEDHVIDGRAVEVKRTVPREDMEVR-VTRTKKIFVGGIPPSLTE  177

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKEYFS YGS+V+HQIMLDH TGRSRGFGFVTFD+EDAV+++ S+GR HEL GKQVEI
Sbjct  178   DELKEYFSVYGSIVDHQIMLDHKTGRSRGFGFVTFDSEDAVERIFSEGRTHELGGKQVEI  237

Query  969   KRAEPKRAGGDRASEGRMHRG  907
             K+AEPKR GGD  +  + + G
Sbjct  238   KKAEPKRTGGDHGNATKSYAG  258



>ref|XP_006385422.1| hypothetical protein POPTR_0003s04340g [Populus trichocarpa]
 gb|ERP63219.1| hypothetical protein POPTR_0003s04340g [Populus trichocarpa]
Length=421

 Score =   297 bits (760),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  1470  TPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVAN  1291
             + SAGKLFVGG++WET+EE F  YFSKYGEV+DSVIM D+ SGRPRGFGF+TFADP VA+
Sbjct  76    SSSAGKLFVGGVSWETTEETFTNYFSKYGEVMDSVIMTDRHSGRPRGFGFVTFADPAVAD  135

Query  1290  RVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSV  1111
             RVL+E+HVIDGR VEVKRTVPRED   + V++TKKIFVGGIPP+LTEDELKEYFS YGS+
Sbjct  136   RVLEEDHVIDGRAVEVKRTVPREDMDVKGVTRTKKIFVGGIPPSLTEDELKEYFSVYGSI  195

Query  1110  VEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRA  931
             V+HQIMLDH TGRSRGFGFVTFD EDAV+++ S+GR HEL GKQVEIK+AEPKR GGD  
Sbjct  196   VDHQIMLDHKTGRSRGFGFVTFDIEDAVEQIFSEGRTHELGGKQVEIKKAEPKRTGGDYG  255

Query  930   SEGRMHRG  907
             S  + + G
Sbjct  256   STAKSYTG  263



>gb|EPS58223.1| hypothetical protein M569_16592, partial [Genlisea aurea]
Length=305

 Score =   292 bits (748),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             KLFVGGIAWETSEE F RYF+KYGE+ DSVIMMDKV+GRPRGFGF+TF+D EVA +VLQ+
Sbjct  1     KLFVGGIAWETSEESFRRYFAKYGEISDSVIMMDKVTGRPRGFGFVTFSDQEVAEKVLQQ  60

Query  1275  EHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQI  1096
             +HVIDGR VEVKRTVPRE+   R VSKTKKIFVGG+P ++ ED+L+EYFSSYG++VEHQI
Sbjct  61    DHVIDGRSVEVKRTVPREEYQSRGVSKTKKIFVGGLPVSMNEDDLREYFSSYGTIVEHQI  120

Query  1095  MLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRM  916
             MLDH TGRSRGFGFVTFD+EDAV+KVLSDGRMHEL+GKQVEIKRAEPKR   + A     
Sbjct  121   MLDHKTGRSRGFGFVTFDSEDAVEKVLSDGRMHELSGKQVEIKRAEPKRFSFEYAPPESR  180

Query  915   HRGNSNMHS  889
              RG SN  S
Sbjct  181   FRGASNSRS  189



>ref|XP_008228275.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Prunus 
mume]
Length=391

 Score =   295 bits (755),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 168/197 (85%), Gaps = 2/197 (1%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKV  1348
             H++D  S G+E + S +    +AGKLFVGG++WET+EE F  YFSKYGE+ DSVIM+DK 
Sbjct  52    HNVD--SEGNEFRDSFNHRDSAAGKLFVGGVSWETTEEAFTNYFSKYGEIADSVIMIDKH  109

Query  1347  SGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGI  1168
             SGRPRGFGF+TFADP V + VL+EEHVIDGRVVEVKRTVPRED  F+ +SK KKIFVGGI
Sbjct  110   SGRPRGFGFVTFADPGVVDSVLEEEHVIDGRVVEVKRTVPREDMGFKGISKRKKIFVGGI  169

Query  1167  PPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELN  988
             P +LT+DEL EYFS+YGS+VEHQIM+DH TGRSRGFGFVTF+NEDA+ KV S+G++HEL 
Sbjct  170   PTSLTDDELGEYFSTYGSIVEHQIMVDHKTGRSRGFGFVTFENEDALDKVFSEGKIHELG  229

Query  987   GKQVEIKRAEPKRAGGD  937
             GKQVEIK+AEPKR GGD
Sbjct  230   GKQVEIKKAEPKRGGGD  246



>ref|XP_007215501.1| hypothetical protein PRUPE_ppa006895mg [Prunus persica]
 gb|EMJ16700.1| hypothetical protein PRUPE_ppa006895mg [Prunus persica]
Length=391

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 168/197 (85%), Gaps = 2/197 (1%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKV  1348
             H++D  S G+E + S +    +AGKLFVGG++WET+EE F  YFSKYGE+ DSVIM+DK 
Sbjct  52    HNVD--SEGNEFRDSFNHRDSAAGKLFVGGVSWETTEEAFTNYFSKYGEIADSVIMIDKH  109

Query  1347  SGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGI  1168
             SGRPRGFGF+TFADP V + VL+EEHVIDGRVVEVKRTVPRE+  F+ +SK KKIFVGGI
Sbjct  110   SGRPRGFGFVTFADPGVVDSVLEEEHVIDGRVVEVKRTVPRENMGFKGISKRKKIFVGGI  169

Query  1167  PPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELN  988
             P +LT+DEL EYFS+YGS+VEHQIM+DH TGRSRGFGFVTF+NEDA+ KV S+G++HEL 
Sbjct  170   PTSLTDDELGEYFSTYGSIVEHQIMVDHKTGRSRGFGFVTFENEDALDKVFSEGKIHELG  229

Query  987   GKQVEIKRAEPKRAGGD  937
             GKQVEIK+AEPKR GGD
Sbjct  230   GKQVEIKKAEPKRGGGD  246



>ref|XP_008391337.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0 [Malus 
domestica]
 ref|XP_008391338.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0 [Malus 
domestica]
Length=395

 Score =   290 bits (743),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 178/224 (79%), Gaps = 10/224 (4%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKV  1348
             H+LD  + G+E + S      +AGKLFVGG++WET+EE F+ YFSKYGE++DSVIM+DK 
Sbjct  44    HNLD--NEGNEFRDSFSHRDSAAGKLFVGGVSWETTEENFSNYFSKYGEIVDSVIMIDKH  101

Query  1347  SGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGI  1168
             +G+PRGFGF+TF+DP V + VL+ EHVIDGRVVEVKRTVPR D  F+  SK KKIFVGGI
Sbjct  102   TGKPRGFGFVTFSDPMVIDSVLEVEHVIDGRVVEVKRTVPRGDVGFKGASKRKKIFVGGI  161

Query  1167  PPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELN  988
             P +LT+DEL EYFS+YG++VEHQIMLDH TGRSRGFGFVTF+NEDA+ K+ SDG++HEL 
Sbjct  162   PTSLTDDELGEYFSAYGTIVEHQIMLDHKTGRSRGFGFVTFENEDALDKIFSDGKVHELG  221

Query  987   GKQVEIKRAEPKRAGGDRASEGRMHRGNSNMHSYGNVNGDAEDF  856
             GKQVEIK+AEPKR GGD +         S+  SYG+++G A  +
Sbjct  222   GKQVEIKKAEPKRGGGDFS--------GSSARSYGSLSGAAAGY  257



>ref|XP_009380446.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   284 bits (726),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             +S G E++ + D  + SAGK+FVGG+AW+T+E+ FN++FSKYGE+IDSVIM DK +  PR
Sbjct  75    NSGGEEMRQA-DAGSSSAGKIFVGGVAWDTTEDTFNKHFSKYGEIIDSVIMKDKNTHMPR  133

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLT  1153
             GFGF+TFADP V +RV ++EHVIDGR VEVKRTVPRED P +   KTKKIFVGGIP  LT
Sbjct  134   GFGFVTFADPSVIDRVWEDEHVIDGRTVEVKRTVPREDMPSKAGIKTKKIFVGGIPTALT  193

Query  1152  EDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVE  973
             EDELKE+FSSYG V+EHQIMLDH+T RSRGFGFVTF +E+AV K++S+GRMH+L GKQVE
Sbjct  194   EDELKEHFSSYGEVIEHQIMLDHSTRRSRGFGFVTFKDEEAVDKIISEGRMHDLAGKQVE  253

Query  972   IKRAEPKRAGGDRASEGRMHRGNSNMHSYG  883
             IK+AEPKR+GG      R+  G SN  + G
Sbjct  254   IKKAEPKRSGGSSRMNERVSHGGSNRSARG  283



>ref|XP_009409355.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=380

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMD  1354
             P+     +S G E+K + D  + SAGK+FVGG+AW+T+EE FN +FSKYGE+ DSVIM D
Sbjct  73    PVGKRMDNSGGEEMKQA-DIGSSSAGKIFVGGVAWDTTEETFNEHFSKYGEITDSVIMKD  131

Query  1353  KVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVG  1174
             K +  PRGFGF+TFADP V ++VL++EHVIDGR+VEVKRTVPRED P +  ++T+KIFVG
Sbjct  132   KNTHMPRGFGFVTFADPSVIDKVLEDEHVIDGRMVEVKRTVPREDMPSKAGNRTRKIFVG  191

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             G+P +LTEDELKE+FS YG VVE+QIMLDH+TGRSRGFGFVTF  E+AV K++S+GRMH+
Sbjct  192   GLPTSLTEDELKEHFSLYGEVVENQIMLDHSTGRSRGFGFVTFKTEEAVDKIISEGRMHD  251

Query  993   LNGKQVEIKRAEPKRAGGDRASEGRMHRGNSNMHSYG  883
             L GKQVEIKRAEPKR+GG  A  GR   G S   ++G
Sbjct  252   LAGKQVEIKRAEPKRSGGHSAVNGRASHGASGGSAHG  288



>ref|XP_010915268.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010915270.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010915271.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=365

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             SAG E++   D ++ S+GK+FVGG+AW+T+EE F+++F KYG + DSVIM D+ +  PRG
Sbjct  73    SAGEEIQP--DSTSYSSGKIFVGGVAWDTTEETFSKHFEKYGVITDSVIMKDRHTHMPRG  130

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADP V ++VL++EHVIDGR+VEVKRTVPRED P +   KTKKIFVGGIPP+LTE
Sbjct  131   FGFVTFADPSVVDKVLEDEHVIDGRMVEVKRTVPREDMPSKAGFKTKKIFVGGIPPSLTE  190

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKE+F+SYG+VVEHQIMLDH TGRSRGFGFVTF+NE+AV+K++S+GRMH L GKQVEI
Sbjct  191   DELKEHFASYGNVVEHQIMLDHATGRSRGFGFVTFENEEAVKKIISEGRMHHLGGKQVEI  250

Query  969   KRAEPKRAGGD  937
             KRAEPK+AGGD
Sbjct  251   KRAEPKKAGGD  261



>ref|XP_008782526.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782527.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782528.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Phoenix dactylifera]
Length=366

 Score =   281 bits (719),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S G E++   D S+ S+GK+FVGG+AW+T+EE F+++F KYGE+ DSVIM DK +  PRG
Sbjct  75    SVGEEIQP--DSSSFSSGKIFVGGVAWDTTEETFSKHFEKYGEITDSVIMKDKHTHMPRG  132

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADP V + VL++EHVIDGR+VEVKRTVPR D P +   KTKKIFVGGIP +LTE
Sbjct  133   FGFVTFADPSVVDNVLEDEHVIDGRMVEVKRTVPRGDLPSKAGLKTKKIFVGGIPLSLTE  192

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKE+F+SYG V+EHQIMLDH+TGRSRGFGFVTF+NE+AV+K++S+GRMH L GKQVEI
Sbjct  193   DELKEHFASYGKVIEHQIMLDHSTGRSRGFGFVTFENEEAVKKIISEGRMHNLGGKQVEI  252

Query  969   KRAEPKRAGGDRASEGRMHRGN  904
             KRAEPK+AGGD  + GR+  G 
Sbjct  253   KRAEPKKAGGDPGNNGRVGHGT  274


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = -2

Query  1260  GRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHN  1081
             GR +E+  +V  E  P      + KIFVGG+    TE+   ++F  YG + +  IM D +
Sbjct  67    GRGIEMVDSVGEEIQPDSSSFSSGKIFVGGVAWDTTEETFSKHFEKYGEITDSVIMKDKH  126

Query  1080  TGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             T   RGFGFVTF +   V  VL D   H ++G+ VE+KR  P+
Sbjct  127   THMPRGFGFVTFADPSVVDNVLED--EHVIDGRMVEVKRTVPR  167



>ref|XP_010654539.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
 ref|XP_010654540.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
 emb|CBI35964.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMD  1354
             PI+S+D  S G  ++  +D     +GKLFVGGI+WETSEE F  YFS YGE+ DSVIMMD
Sbjct  28    PINSVD--SEGIGIQQLVDVRNSYSGKLFVGGISWETSEEIFTNYFSNYGEITDSVIMMD  85

Query  1353  KVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVG  1174
             + +GRPRGFGFITFADP VA++VL+E+HVIDGR VEVK+TVPRE    R VSKT+KIFVG
Sbjct  86    RHTGRPRGFGFITFADPAVADKVLEEDHVIDGRAVEVKKTVPREGMEVRGVSKTRKIFVG  145

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             GIP +LTEDELK+YFSSYG++VE+QIMLDH TGRSRGFGFVTF +EDAV+++ S+G+ HE
Sbjct  146   GIPSSLTEDELKDYFSSYGAIVENQIMLDHVTGRSRGFGFVTFVSEDAVERLFSEGKTHE  205

Query  993   LNGKQVEIKRAEPKRAGGD  937
             L GK VEIK+AEPKRAG +
Sbjct  206   LGGKLVEIKKAEPKRAGAE  224



>ref|XP_010925454.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010925455.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=372

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             SAG E+K   D S+ S+GK+FVGG+AW+T+EE F R+F KYGE+ DSVIM DK +  PRG
Sbjct  75    SAGEEIKQP-DSSSSSSGKIFVGGVAWDTTEETFTRHFEKYGEITDSVIMKDKHTHMPRG  133

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTE  1150
             FGF+TFADP V ++VL++EH IDGR VEVKRTVPRE+ P +   KTKKIFVGGIPP+LTE
Sbjct  134   FGFVTFADPSVIDKVLEDEHAIDGRTVEVKRTVPREEMPSKAGLKTKKIFVGGIPPSLTE  193

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             DELKE+F+SYG VVE QIMLDH+TGRSRGFGFVTF+NE+AV+K++S+GRMH+L GKQVEI
Sbjct  194   DELKEHFASYGEVVERQIMLDHSTGRSRGFGFVTFENEEAVEKIISEGRMHDLGGKQVEI  253

Query  969   KRAEPKRAGGD  937
             KRAEPK+AGGD
Sbjct  254   KRAEPKKAGGD  264



>ref|NP_001145761.1| uncharacterized protein LOC100279268 [Zea mays]
 gb|ACL52540.1| unknown [Zea mays]
Length=413

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  98    ASGKIFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  157

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVP+E+   +   KTKKIFVGGIPP+LTED+LKE+FSSYG VVE
Sbjct  158   LEDEHVIDGRTVEVKRTVPKEEMSSKDGPKTKKIFVGGIPPSLTEDKLKEHFSSYGKVVE  217

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAG-GDRAS  928
             HQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQVEIK+AEPK+ G GD +S
Sbjct  218   HQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKKPGVGDSSS  277

Query  927   EGRMHRGNSNMHSY  886
              GR  RG  +  SY
Sbjct  278   NGRHSRGGGHRDSY  291



>gb|AFW76490.1| hypothetical protein ZEAMMB73_698498 [Zea mays]
Length=413

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  98    ASGKIFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  157

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVP+E+   +   KTKKIFVGGIPP+LTED+LKE+FSSYG VVE
Sbjct  158   LEDEHVIDGRTVEVKRTVPKEEMSSKDGPKTKKIFVGGIPPSLTEDKLKEHFSSYGKVVE  217

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAG-GDRAS  928
             HQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQVEIK+AEPK+ G GD +S
Sbjct  218   HQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKKPGVGDSSS  277

Query  927   EGRMHRGNSNMHSY  886
              GR  RG  +  SY
Sbjct  278   NGRHSRGGGHRDSY  291



>ref|XP_002521392.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
 gb|EEF41060.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
Length=412

 Score =   277 bits (709),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  1473  STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVA  1294
             S  S GKLFVGGI+WET+EE F  YFSK+GE+ DSVIM D+ SGRPRGFGF+TFAD   A
Sbjct  74    SDSSQGKLFVGGISWETTEETFTSYFSKFGEITDSVIMRDRHSGRPRGFGFVTFADLAAA  133

Query  1293  NRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             +RVL+E+H+ID R VEVKRTVPRE+   + V + +KIFVGGIPPTLTEDEL EYFS YG+
Sbjct  134   DRVLEEDHIIDDRAVEVKRTVPREEMEVKGVVRARKIFVGGIPPTLTEDELGEYFSVYGN  193

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             +VEHQIMLDH TGRSRGFGFVTF+ ED+V+++ S GR HEL GK+VEIK+A PKR GGD 
Sbjct  194   IVEHQIMLDHKTGRSRGFGFVTFETEDSVEQIFSTGRTHELGGKRVEIKKAVPKRNGGDY  253

Query  933   ASEGRMHRGNSN  898
              S G+ H G SN
Sbjct  254   GSSGKYHTGFSN  265



>gb|AGT17194.1| hypothetical protein SHCRBa_041_N14_R_160 [Saccharum hybrid cultivar 
R570]
Length=412

 Score =   275 bits (703),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  95    ASGKIFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  154

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+++HVIDGR VEVKRTVP+E+   +   KTKKIFVGGIPP+LTED+LKE+FSSYG VVE
Sbjct  155   LEDDHVIDGRTVEVKRTVPKEEMSSKDGPKTKKIFVGGIPPSLTEDKLKEHFSSYGKVVE  214

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR-AGGDRAS  928
             HQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQVEIK+AEPK+  GGD +S
Sbjct  215   HQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKKPGGGDSSS  274

Query  927   EGRMHRG  907
              GR  RG
Sbjct  275   NGRHSRG  281



>ref|XP_004303649.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score =   274 bits (700),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTP--SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             S G+E + S   S    +AGKLFVGG++WET+E+ F  YFSKYGE+ DSVIM+DK +GRP
Sbjct  54    SEGNEFRDSSFSSRADAAAGKLFVGGVSWETTEDTFTNYFSKYGEIADSVIMLDKHTGRP  113

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFITFAD   A+ VL+EEHVIDGRVVEVKRTVPRED  F+  SK KKIFVGGIP +L
Sbjct  114   RGFGFITFADSVAADAVLEEEHVIDGRVVEVKRTVPREDIGFKGGSKRKKIFVGGIPTSL  173

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             +++EL +YFS++GS+VEHQIM+DH TGRSRGFGFVTF+NED++ KV S+G++HEL GKQV
Sbjct  174   SDEELGDYFSTFGSIVEHQIMVDHKTGRSRGFGFVTFENEDSLDKVFSEGKIHELGGKQV  233

Query  975   EIKRAEPKRAGGDRASEGR  919
             EIKRAEPKR G    S  R
Sbjct  234   EIKRAEPKRPGDFSGSAAR  252



>ref|XP_004966062.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like [Setaria italica]
Length=423

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  98    ASGKIFVGGVAWETTEESFTKHFQKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDRV  157

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVI+GR VEVKRTVP+E+   +   KTKKIFVGGIPP+LTED+LKE+FSSYG VVE
Sbjct  158   LEDEHVINGRTVEVKRTVPKEEMSTKDGPKTKKIFVGGIPPSLTEDKLKEHFSSYGKVVE  217

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR-AGGDRAS  928
             HQIMLDH+TGRSRGFGFVTF++EDAV++V+S GRMH+L GKQVEIK+AEPK+  GGD +S
Sbjct  218   HQIMLDHSTGRSRGFGFVTFESEDAVERVMSQGRMHDLGGKQVEIKKAEPKKPGGGDSSS  277

Query  927   EGRMHRG  907
              GR  RG
Sbjct  278   NGRYSRG  284



>ref|XP_008658258.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW86726.1| hypothetical protein ZEAMMB73_661369 [Zea mays]
Length=401

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 164/198 (83%), Gaps = 10/198 (5%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  91    ASGKVFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  150

Query  1284  LQEEHVIDGRVVEVKRTVPRE----DTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYG  1117
             L++EHVIDGR VEVKRTVP+E    D P     KTKKIFVGGIPP+LTED+LKE+FSSYG
Sbjct  151   LEDEHVIDGRTVEVKRTVPKELSSKDGP-----KTKKIFVGGIPPSLTEDKLKEHFSSYG  205

Query  1116  SVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAG-G  940
              VVEHQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQVEIK+AEPK+ G G
Sbjct  206   KVVEHQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKKPGAG  265

Query  939   DRASEGRMHRGNSNMHSY  886
             D +S GR  RG  +  SY
Sbjct  266   DSSSNGRHSRGGGHRDSY  283



>ref|XP_007150506.1| hypothetical protein PHAVU_005G158100g [Phaseolus vulgaris]
 ref|XP_007150507.1| hypothetical protein PHAVU_005G158100g [Phaseolus vulgaris]
 gb|ESW22500.1| hypothetical protein PHAVU_005G158100g [Phaseolus vulgaris]
 gb|ESW22501.1| hypothetical protein PHAVU_005G158100g [Phaseolus vulgaris]
Length=353

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 161/206 (78%), Gaps = 2/206 (1%)
 Frame = -2

Query  1494  LKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFIT  1315
             +K S +   PS+GKLFVGGI+WETS+E F  YFSKYGEV DSVIM +K+SGRPRGFGF+T
Sbjct  28    VKPSSNPRDPSSGKLFVGGISWETSQESFFNYFSKYGEVTDSVIMTNKLSGRPRGFGFVT  87

Query  1314  FADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKE  1135
             FAD  VA+ VL +EH IDGRVVEVKRTVPRED     V  TKKIFVGGIP   ++DEL+ 
Sbjct  88    FADSAVADEVLAQEHTIDGRVVEVKRTVPREDMEGIGVLTTKKIFVGGIPQLFSDDELRG  147

Query  1134  YFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEP  955
             YF  YG+V+E QIM+DHNTGRSRGFGFVTFDNED+V+KV S G++HE+ GKQVEIKRAEP
Sbjct  148   YFLPYGNVIECQIMVDHNTGRSRGFGFVTFDNEDSVEKVFSVGKIHEIGGKQVEIKRAEP  207

Query  954   KRAGGDRASEGRMHRG--NSNMHSYG  883
             KR+G D +S  R   G   + M  YG
Sbjct  208   KRSGVDHSSTSRKSYGGFGNEMDGYG  233



>ref|XP_010033771.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 gb|KCW53574.1| hypothetical protein EUGRSUZ_J02849 [Eucalyptus grandis]
Length=416

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+ KLFVGGI+WET+E+ F  YFSKYGE+ DSVIM DK SGRPRGFGF+TFAD  VA++V
Sbjct  82    SSRKLFVGGISWETTEDRFTSYFSKYGEIADSVIMTDKYSGRPRGFGFVTFADSVVADKV  141

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+E HVIDGR VEVKRT+PRED   +   KTKKIFVGG+P  L+EDELKEYFS YGSVVE
Sbjct  142   LEECHVIDGREVEVKRTIPREDMEGKSALKTKKIFVGGLPAFLSEDELKEYFSFYGSVVE  201

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH TGRSRGFGFVTF  EDAV++++S+G++HEL GKQVEIK+AEPKR G D +  
Sbjct  202   HQIMLDHTTGRSRGFGFVTFGEEDAVERIISEGKVHELGGKQVEIKKAEPKRGGSDYSGS  261

Query  924   GRMHRGNSN  898
                 RG+ N
Sbjct  262   HSKFRGSFN  270



>ref|XP_002437175.1| hypothetical protein SORBIDRAFT_10g022380 [Sorghum bicolor]
 gb|EER88542.1| hypothetical protein SORBIDRAFT_10g022380 [Sorghum bicolor]
Length=414

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  97    SSGKIFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  156

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++ HVIDGR VEVKRTVP+E+   +   KTKKIFVGGIP +LTED+LKE+FSSYG VVE
Sbjct  157   LEDAHVIDGRTVEVKRTVPKEEMSSKDGPKTKKIFVGGIPSSLTEDKLKEHFSSYGKVVE  216

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR-AGGDRAS  928
             HQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQVEIK+AEPK+  GGD +S
Sbjct  217   HQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKKPGGGDSSS  276

Query  927   EGRMHRG  907
              GR  RG
Sbjct  277   NGRHSRG  283


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+FVGGI    +E+    +FS YG+V++  IM+D  +GR RGFGF+TF   +   R
Sbjct  185   PKTKKIFVGGIPSSLTEDKLKEHFSSYGKVVEHQIMLDHSTGRSRGFGFVTFESEDAVER  244

Query  1287  VLQE--EHVIDGRVVEVKRTVPRE  1222
             V+ E   H + G+ VE+K+  P++
Sbjct  245   VMSEGRMHDLGGKQVEIKKAEPKK  268



>gb|KDP40755.1| hypothetical protein JCGZ_24754 [Jatropha curcas]
Length=400

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 170/247 (69%), Gaps = 33/247 (13%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSID--------DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVID  1372
             H   GSSAG   K S++         S+ SAGKLFVGG++WETSEE F  YFSKYGE+ D
Sbjct  39    HHYMGSSAGIGRKQSLNHHNRDSTSSSSSSAGKLFVGGVSWETSEETFTNYFSKYGEITD  98

Query  1371  SVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKT  1192
             SVIM D+ SGRPRGFGF+TFADP  A+RVL+E HVIDGR VEVKRTVPRED   + V + 
Sbjct  99    SVIMTDRHSGRPRGFGFVTFADPAAADRVLEESHVIDGRAVEVKRTVPREDMEVKGVVRA  158

Query  1191  KKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS  1012
             KKIFVGGIPP L+ED+L++YFS YG+++EHQIMLDH TGRSRGFGFVTF+ ED+V+++ S
Sbjct  159   KKIFVGGIPPALSEDDLRDYFSVYGNIIEHQIMLDHKTGRSRGFGFVTFETEDSVEQIFS  218

Query  1011  DGRMHELNGKQVEIKRAEPKRAGGDRASE-------------------------GRMHRG  907
             +G+ HEL GKQVEIK+A PKR GGD  S                          G+M RG
Sbjct  219   EGKTHELGGKQVEIKKAVPKRGGGDYGSAVKPHTGFSDGAGGYGAGHNSGAMYGGKMSRG  278

Query  906   NSNMHSY  886
                   Y
Sbjct  279   YGGYGGY  285



>ref|XP_004951463.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria 
italica]
Length=393

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  54    SSGKIFVGGVAWETTEETFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  113

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG VVE
Sbjct  114   LEDEHVIDGRTVEVKRTVPREEMTTKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGKVVE  173

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S 
Sbjct  174   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSN  233

Query  924   GRMHRG  907
             GR   G
Sbjct  234   GRSSHG  239


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+F+GG+    +E+    +FS YG+V++  IM+D  +GR RGFGF+TF   +   R
Sbjct  142   PKTRKIFIGGLPPSLTEDELKDHFSSYGKVVEHQIMLDHSTGRSRGFGFVTFESEDSVER  201

Query  1287  VLQEEHVID--GRVVEVKRTVPRE  1222
             V+ E  + D  G+ VE+K+  P++
Sbjct  202   VISEGRMRDLGGKQVEIKKAEPKK  225



>ref|XP_003542073.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Glycine 
max]
 gb|KHN30057.1| Putative RNA-binding protein [Glycine soja]
Length=353

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = -2

Query  1494  LKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFIT  1315
             +K S +     +GKLFVGGI+WETS+E F  YFSKYGEV DSVIM +K+SGRPRGFGF+T
Sbjct  28    VKPSFNRRDSFSGKLFVGGISWETSQESFFNYFSKYGEVTDSVIMTNKLSGRPRGFGFVT  87

Query  1314  FADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKE  1135
             FA+  VA+ VL +EH ID RVVEVKRTVPRED     V KTKKIFVGGI    T+DEL+E
Sbjct  88    FANSAVADEVLAQEHTIDHRVVEVKRTVPREDVDVTGVFKTKKIFVGGIAQFFTDDELRE  147

Query  1134  YFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEP  955
             YFS YG+V+E QIMLDHNTGRSRGFGFVTFD+ED+V+KV S G++HE+ GKQVEIKRAEP
Sbjct  148   YFSPYGNVIECQIMLDHNTGRSRGFGFVTFDDEDSVEKVFSVGKIHEIGGKQVEIKRAEP  207

Query  954   KRAGGDRASEGRMHRG  907
             KR+G D  +  R   G
Sbjct  208   KRSGVDYCNTSRKSYG  223



>gb|EAZ37394.1| hypothetical protein OsJ_21732 [Oryza sativa Japonica Group]
Length=344

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++VLQ+
Sbjct  29    KIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLQD  88

Query  1275  EHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQI  1096
             EH IDGR VEVKRTVPRE+   +   KT+KIFVGGIPP+LTED+LKE+FSSYG VVEHQI
Sbjct  89    EHTIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQI  148

Query  1095  MLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS  928
             MLDH TGRSRGFGFVTF+NEDAV++V+S+GRMH+L GKQVEIK+AEPK+ GG  +S
Sbjct  149   MLDHGTGRSRGFGFVTFENEDAVERVMSEGRMHDLAGKQVEIKKAEPKKPGGGDSS  204



>ref|XP_002453550.1| hypothetical protein SORBIDRAFT_04g007860 [Sorghum bicolor]
 gb|EES06526.1| hypothetical protein SORBIDRAFT_04g007860 [Sorghum bicolor]
Length=391

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  54    SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  113

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+++HVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG VVE
Sbjct  114   LEDDHVIDGRTVEVKRTVPREEMTTKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGKVVE  173

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S 
Sbjct  174   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSN  233

Query  924   GRMHRG  907
             GR   G
Sbjct  234   GRSSHG  239


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+F+GG+    +E+    +FS YG+V++  IM+D  +GR RGFGF+TF   +   R
Sbjct  142   PKTRKIFIGGLPPSLTEDELKDHFSSYGKVVEHQIMLDHSTGRSRGFGFVTFESEDSVER  201

Query  1287  VLQEEHVID--GRVVEVKRTVPRE  1222
             V+ E  + D  G+ VE+K+  P++
Sbjct  202   VISEGRMRDLGGKQVEIKKAEPKK  225



>gb|EAZ01374.1| hypothetical protein OsI_23407 [Oryza sativa Indica Group]
Length=407

 Score =   267 bits (683),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++VLQ+
Sbjct  92    KIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLQD  151

Query  1275  EHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQI  1096
             EH IDGR VEVKRTVPRE+   +   KT+KIFVGGIPP+LTED+LKE+FSSYG VVEHQI
Sbjct  152   EHTIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQI  211

Query  1095  MLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS  928
             MLDH TGRSRGFGFVTF+NEDAV++V+S+GRMH+L GKQVEIK+AEPK+ GG  +S
Sbjct  212   MLDHGTGRSRGFGFVTFENEDAVERVMSEGRMHDLAGKQVEIKKAEPKKPGGGDSS  267



>gb|ACG36152.1| heterogeneous nuclear ribonucleoprotein A3 [Zea mays]
Length=384

 Score =   266 bits (679),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  53    SLGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  112

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+++HVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG+VVE
Sbjct  113   LEDDHVIDGRTVEVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVE  172

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S 
Sbjct  173   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSN  232

Query  924   GRMHRG  907
             GR + G
Sbjct  233   GRSNHG  238


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHS------IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG +   E+K +      I    P   K+F+GG+    +E+    +FS YG V++  
Sbjct  117   HVIDGRTV--EVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVEHQ  174

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  175   IMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  224



>ref|NP_001131946.2| uncharacterized protein LOC100193339 [Zea mays]
 ref|XP_008676542.1| PREDICTED: uncharacterized protein LOC100193339 isoform X1 [Zea 
mays]
 ref|XP_008676543.1| PREDICTED: uncharacterized protein LOC100193339 isoform X1 [Zea 
mays]
 gb|ACF81591.1| unknown [Zea mays]
 gb|ACN27926.1| unknown [Zea mays]
 gb|ACF80580.2| unknown [Zea mays]
 gb|AFW66028.1| heterogeneous nuclear ribonucleoprotein A3 isoform 1 [Zea mays]
 gb|AFW66029.1| heterogeneous nuclear ribonucleoprotein A3 isoform 2 [Zea mays]
 gb|AFW66030.1| heterogeneous nuclear ribonucleoprotein A3 isoform 3 [Zea mays]
Length=384

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  53    SLGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  112

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+++HVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG+VVE
Sbjct  113   LEDDHVIDGRTVEVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVE  172

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGF+TF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S 
Sbjct  173   HQIMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSN  232

Query  924   GRMHRG  907
             GR + G
Sbjct  233   GRSNHG  238


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHS------IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG +   E+K +      I    P   K+F+GG+    +E+    +FS YG V++  
Sbjct  117   HVIDGRTV--EVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVEHQ  174

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGFITF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  175   IMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  224



>ref|XP_008676544.1| PREDICTED: uncharacterized protein LOC100193339 isoform X2 [Zea 
mays]
 ref|XP_008676545.1| PREDICTED: uncharacterized protein LOC100193339 isoform X2 [Zea 
mays]
 gb|ACR34605.1| unknown [Zea mays]
 gb|AFW66027.1| hypothetical protein ZEAMMB73_185087 [Zea mays]
Length=366

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  1461  AGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVL  1282
             +GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++VL
Sbjct  36    SGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVL  95

Query  1281  QEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEH  1102
             +++HVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG+VVEH
Sbjct  96    EDDHVIDGRTVEVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVEH  155

Query  1101  QIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEG  922
             QIMLDH+TGRSRGFGF+TF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S G
Sbjct  156   QIMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSNG  215

Query  921   RMHRG  907
             R + G
Sbjct  216   RSNHG  220


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = -2

Query  1224  EDTPFRRVSK---TKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGF  1054
             E  P RRV +   + KIFVGG+    TE+   ++F  YG++ +  IM D +T   RGFGF
Sbjct  23    EGHPGRRVGRDGGSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGF  82

Query  1053  VTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             VTF +   + KVL D   H ++G+ VE+KR  P+
Sbjct  83    VTFSDPSVIDKVLEDD--HVIDGRTVEVKRTVPR  114


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHS------IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG +   E+K +      I    P   K+F+GG+    +E+    +FS YG V++  
Sbjct  99    HVIDGRTV--EVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVEHQ  156

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGFITF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  157   IMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  206



>gb|AFW66026.1| heterogeneous nuclear ribonucleoprotein A3 [Zea mays]
Length=443

 Score =   265 bits (678),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  112   SLGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  171

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L+++HVIDGR VEVKRTVPRE+   +   KT+KIF+GG+PP+LTEDELK++FSSYG+VVE
Sbjct  172   LEDDHVIDGRTVEVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVE  231

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGF+TF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D +S 
Sbjct  232   HQIMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDHSSN  291

Query  924   GRMHRG  907
             GR + G
Sbjct  292   GRSNHG  297


 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHS------IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG +   E+K +      I    P   K+F+GG+    +E+    +FS YG V++  
Sbjct  176   HVIDGRTV--EVKRTVPREEMITKDGPKTRKIFIGGLPPSLTEDELKDHFSSYGNVVEHQ  233

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGFITF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  234   IMLDHSTGRSRGFGFITFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  283



>gb|EMS66161.1| Heterogeneous nuclear ribonucleoprotein 27C [Triticum urartu]
Length=448

 Score =   265 bits (677),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -2

Query  1461  AGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVL  1282
             +GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +G PRGFGF+TF+DP V +RVL
Sbjct  79    SGKIFVGGVAWETTEEKFTKHFQKYGAITDSVIMKDKHTGMPRGFGFVTFSDPSVIDRVL  138

Query  1281  QEEHVIDGRVVEVKRTVPREDTPFRRV-SKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++EH IDGR VEVKRTVPRE+   +   +KT+KIFVGGIP +LTED+LKE+FSSYG V E
Sbjct  139   EDEHTIDGRTVEVKRTVPREEMSTKDAPNKTRKIFVGGIPASLTEDKLKEHFSSYGKVAE  198

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIM+DH+TGRSRGFGFVTF++EDAV++V+SDGRMH+L GKQVEIKRAEPK+ GG  +S 
Sbjct  199   HQIMVDHSTGRSRGFGFVTFESEDAVERVMSDGRMHDLGGKQVEIKRAEPKKPGGGDSSS  258

Query  924   GRMH  913
                H
Sbjct  259   NSRH  262


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  1221  DTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFD  1042
             D P      + KIFVGG+    TE++  ++F  YG++ +  IM D +TG  RGFGFVTF 
Sbjct  70    DVPAEPADGSGKIFVGGVAWETTEEKFTKHFQKYGAITDSVIMKDKHTGMPRGFGFVTFS  129

Query  1041  NEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             +   + +VL D   H ++G+ VE+KR  P+
Sbjct  130   DPSVIDRVLED--EHTIDGRTVEVKRTVPR  157


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 11/111 (10%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI-------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDS  1369
             H++DG +   E+K ++        D+     K+FVGGI    +E+    +FS YG+V + 
Sbjct  142   HTIDGRTV--EVKRTVPREEMSTKDAPNKTRKIFVGGIPASLTEDKLKEHFSSYGKVAEH  199

Query  1368  VIMMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
              IM+D  +GR RGFGF+TF   +   RV+ +   H + G+ VE+KR  P++
Sbjct  200   QIMVDHSTGRSRGFGFVTFESEDAVERVMSDGRMHDLGGKQVEIKRAEPKK  250



>ref|XP_008462346.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Cucumis melo]
Length=341

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 169/243 (70%), Gaps = 1/243 (0%)
 Frame = -2

Query  1593  ENRQEQLYSRgggggGDLEPPIHSLDGSSAGHELKHSIDD-STPSAGKLFVGGIAWETSE  1417
             EN Q  L +       D+   +   +  S   E+K+S     + S+GKLFVGG+AWET+E
Sbjct  17    ENGQNFLQTCNQQEQFDMRNELEQANVDSTRSEIKNSTTQYDSSSSGKLFVGGVAWETTE  76

Query  1416  ECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKR  1237
             + F+ YFSKYGE+ DSVIM+DK +GRPRGFGF+TF DP +A+ VL+ +H+IDGR VEVKR
Sbjct  77    DTFSDYFSKYGEIADSVIMIDKHTGRPRGFGFVTFCDPAIADMVLKIDHIIDGRAVEVKR  136

Query  1236  TVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFG  1057
             TVPR D   + VS+TKKIFVGGIPP LTE E K+YFSS+G ++EHQIM+D+ T RSRGFG
Sbjct  137   TVPRADMNDKMVSRTKKIFVGGIPPGLTEVEFKDYFSSFGRIIEHQIMIDYKTKRSRGFG  196

Query  1056  FVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMHRGNSNMHSYGNV  877
             F+TF+NED+V  + S  R+HEL GKQVEIK+A PK+   D  S         +M+  G +
Sbjct  197   FITFENEDSVDNIFSGDRIHELGGKQVEIKKAVPKKVAYDFNSNSGHTSSGYDMYRCGGL  256

Query  876   NGD  868
               D
Sbjct  257   YDD  259



>gb|KGN45519.1| hypothetical protein Csa_7G450760 [Cucumis sativus]
Length=337

 Score =   259 bits (663),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = -2

Query  1545  DLEPPIHSLDGSSAGHELKHSIDD-STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDS  1369
             D+   +   +  S   E+K+S     + S+GKLFVGG+AWET+E+ F  YFSKYGE+ DS
Sbjct  30    DMGNELEQANVDSTRSEIKNSTTQYDSSSSGKLFVGGVAWETTEDTFRDYFSKYGEIADS  89

Query  1368  VIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTK  1189
             VIM+DK +GRPRGFGF+TF DP +A+ VL+ +H+IDGR VEVKRTVPR D   + VS+TK
Sbjct  90    VIMIDKHTGRPRGFGFVTFCDPAIADMVLKIDHIIDGRAVEVKRTVPRADMNDKMVSRTK  149

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIFVGGIPP LTE+E K+YFSS+G ++EHQIM+D+ T RSRGFGF+TF+NED+V+ + S 
Sbjct  150   KIFVGGIPPGLTEEEFKDYFSSFGRIIEHQIMIDYKTKRSRGFGFITFENEDSVENIFSG  209

Query  1008  GRMHELNGKQVEIKRAEPKRAGGDRAS  928
              R+HEL GKQVEIK+A PKR   D  S
Sbjct  210   DRIHELGGKQVEIKKAVPKRVAYDFNS  236



>ref|XP_003563737.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0-like isoform 
X1 [Brachypodium distachyon]
Length=410

 Score =   261 bits (668),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1521  LDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSG  1342
             ++  + G E K    +    +GK+FVGG+AWET+EE F+++F KYG + DSVIM DK + 
Sbjct  62    VNSEAGGEEGKDVAAEPADGSGKIFVGGVAWETTEETFSKHFQKYGAITDSVIMKDKHTK  121

Query  1341  RPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPP  1162
              PRGFGF+TF+DP V +RVL++EH IDGR VEVKRTVPRE+   +   KT+KIFVGGIP 
Sbjct  122   MPRGFGFVTFSDPSVIDRVLEDEHTIDGRTVEVKRTVPREEMSTKDGPKTRKIFVGGIPT  181

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             +LTE +LKE+FSSYG V EHQIM+DH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GK
Sbjct  182   SLTEGKLKEHFSSYGKVEEHQIMVDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGK  241

Query  981   QVEIKRAEPKRAGGDRAS  928
             QVEIKRAEPK+ GG  +S
Sbjct  242   QVEIKRAEPKKPGGGDSS  259



>ref|XP_010537557.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Tarenaya 
hassleriana]
Length=359

 Score =   259 bits (663),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 160/193 (83%), Gaps = 7/193 (4%)
 Frame = -2

Query  1494  LKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             +KHS++      ST S+GKLFVGG++W+T+EE F  YF K+GE++D ++M D+++G+PRG
Sbjct  51    MKHSVEHRHTSSSTSSSGKLFVGGVSWQTTEESFAEYFLKFGELVDCILMTDRMTGKPRG  110

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSK--TKKIFVGGIPPTL  1156
             FGF+TFAD EVA +VL+EEHVIDGR V++KRTVPR++  F+ +SK  TKKIFVGG+PP+L
Sbjct  111   FGFVTFADSEVAEKVLEEEHVIDGRKVDLKRTVPRDEKEFKAISKSKTKKIFVGGLPPSL  170

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
              EDELKEYFS YG + EHQIM DHNTGRSRGFGFVTF  E++V +++S+G++HEL  KQV
Sbjct  171   KEDELKEYFSFYGDITEHQIMYDHNTGRSRGFGFVTFQTEESVDRIISEGKIHELGDKQV  230

Query  975   EIKRAEPKRAGGD  937
             EIKRAEP+R G D
Sbjct  231   EIKRAEPRRNGRD  243



>ref|NP_001168743.1| uncharacterized protein LOC100382538 [Zea mays]
 gb|ACN30574.1| unknown [Zea mays]
 gb|AFW71300.1| hypothetical protein ZEAMMB73_007301 [Zea mays]
 gb|AFW71301.1| hypothetical protein ZEAMMB73_007301 [Zea mays]
Length=384

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  53    SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  112

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIF+GG+P +LTEDELK++FS YG V+E
Sbjct  113   LEDEHVIDGRTVEVKRTVPREEMNTKDGPKTRKIFIGGLPASLTEDELKDHFSLYGKVLE  172

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ G D    
Sbjct  173   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGSDNIGN  232

Query  924   GRMHRGNSNMHS  889
             GR  +G     S
Sbjct  233   GRSSQGGGGYRS  244



>dbj|BAD17623.1| putative heterogeneous nuclearribonucleoprotein A2 [Oryza sativa 
Japonica Group]
 dbj|BAD17631.1| putative heterogeneous nuclearribonucleoprotein A2 [Oryza sativa 
Japonica Group]
Length=374

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  64    SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  123

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIFVGG+P +LTEDEL+E+FS YG +VE
Sbjct  124   LEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVE  183

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  184   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  239



>ref|XP_003571746.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0-like [Brachypodium 
distachyon]
Length=403

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  63    SSGKIFVGGVAWETTEETFSKHFGKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  122

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EH IDGR VEVKRTVPRE+   +   KT+KIFVGG+P +L+ED+L+++FSSYG VVE
Sbjct  123   LEDEHNIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPASLSEDDLRDHFSSYGKVVE  182

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIM+DH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD +S 
Sbjct  183   HQIMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGDHSSN  242

Query  924   GR  919
             GR
Sbjct  243   GR  244


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++          P   K+FVGG+    SE+    +FS YG+V++  
Sbjct  127   HNIDGRTV--EVKRTVPREEMSSKDGPKTRKIFVGGLPASLSEDDLRDHFSSYGKVVEHQ  184

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  185   IMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  234



>ref|XP_006648465.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza 
brachyantha]
Length=392

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  60    SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  119

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIFVGG+P +LTEDEL+E+FS YG +VE
Sbjct  120   LEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVE  179

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  180   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  235



>ref|NP_001046322.1| Os02g0221500 [Oryza sativa Japonica Group]
 dbj|BAD17624.1| putative heterogeneous nuclearribonucleoprotein A2 [Oryza sativa 
Japonica Group]
 dbj|BAD17632.1| putative heterogeneous nuclearribonucleoprotein A2 [Oryza sativa 
Japonica Group]
 dbj|BAF08236.1| Os02g0221500 [Oryza sativa Japonica Group]
Length=397

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  64    SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  123

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIFVGG+P +LTEDEL+E+FS YG +VE
Sbjct  124   LEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVE  183

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  184   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  239



>ref|NP_173208.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE29617.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=369

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 156/200 (78%), Gaps = 7/200 (4%)
 Frame = -2

Query  1509  SAGHELKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G ++KHS+D      S  S GKLFVGG++WET+ E F  YF K+GEV+DSVIM D+++
Sbjct  44    TGGIQMKHSVDHRHSSSSMSSPGKLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRIT  103

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G PRGFGF+TFAD  VA +VL+E+HVID R V++KRT+PR  +DT  + VSKT+KIFVGG
Sbjct  104   GNPRGFGFVTFADSAVAEKVLEEDHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGG  163

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK YF  YG ++EHQIM DH+TGRSRGFGFVTF  ED+V ++ SDG++HEL
Sbjct  164   LPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHEL  223

Query  990   NGKQVEIKRAEPKRAGGDRA  931
               KQVEIKRAEPKR G D +
Sbjct  224   GDKQVEIKRAEPKRTGRDNS  243



>gb|EEE56577.1| hypothetical protein OsJ_05928 [Oryza sativa Japonica Group]
Length=510

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  177   SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  236

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR VEVKRTVPRE+   +   KT+KIFVGG+P +LTEDEL+E+FS YG +VE
Sbjct  237   LEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVE  296

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  297   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  352



>ref|XP_006304958.1| hypothetical protein CARUB_v10012031mg [Capsella rubella]
 gb|EOA37856.1| hypothetical protein CARUB_v10012031mg [Capsella rubella]
Length=369

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 157/200 (79%), Gaps = 7/200 (4%)
 Frame = -2

Query  1509  SAGHELKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G ++KHS++      S  S GKLFVGG++WET+EE F  YF K+GEV+DSVIM D+++
Sbjct  44    TGGVQMKHSVEHRHSSSSMSSPGKLFVGGVSWETTEENFANYFGKFGEVVDSVIMTDRMT  103

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G+PRGFGF+TFADP VA +VL+EEHVID R V++KRTVPR   DT  + VSKT+KIFVGG
Sbjct  104   GKPRGFGFVTFADPAVAEKVLEEEHVIDDRKVDLKRTVPRGDRDTDIKAVSKTRKIFVGG  163

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK +F  YG ++EHQIM DH+TGRSRGFGF+TF  ED+V ++ SD ++HEL
Sbjct  164   LPPLLEEDELKNHFCVYGEIIEHQIMYDHHTGRSRGFGFITFQTEDSVDRLFSDEKVHEL  223

Query  990   NGKQVEIKRAEPKRAGGDRA  931
               KQVEIKRAEPKR G D +
Sbjct  224   GDKQVEIKRAEPKRTGRDNS  243



>ref|XP_010459366.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010459367.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010459369.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010459370.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=367

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 155/200 (78%), Gaps = 7/200 (4%)
 Frame = -2

Query  1509  SAGHELKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G ++KHS++      S  S GKLFVGG++WET+EE F  YF K+GEV+DSVIM D+++
Sbjct  44    TGGVQMKHSVEHRHSSSSMSSPGKLFVGGVSWETTEETFANYFGKFGEVVDSVIMTDRMT  103

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G PRGFGF+TFAD  VA +VL+EEHV+D R VE+KRTVPR   DT  + VSKT+KIFVGG
Sbjct  104   GNPRGFGFVTFADSAVAEKVLEEEHVLDDRKVELKRTVPRGDRDTDIKAVSKTRKIFVGG  163

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK YF  YG ++EHQIM DH TGRSRGFGF+TF  ED+V ++ SDG++HEL
Sbjct  164   LPPLLEEDELKNYFCVYGDIIEHQIMYDHLTGRSRGFGFITFQTEDSVDRLFSDGKVHEL  223

Query  990   NGKQVEIKRAEPKRAGGDRA  931
               KQVEI+RAEPKR G D +
Sbjct  224   GDKQVEIRRAEPKRTGRDNS  243



>ref|XP_006416683.1| hypothetical protein EUTSA_v10007978mg [Eutrema salsugineum]
 gb|ESQ35036.1| hypothetical protein EUTSA_v10007978mg [Eutrema salsugineum]
Length=369

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 159/200 (80%), Gaps = 7/200 (4%)
 Frame = -2

Query  1509  SAGHELKHSIDD-----STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G +++ S+++     S  S GKLFVGG++WET+EE F  YF K+GE++DSVIM D+++
Sbjct  44    TGGMQMRQSVENRHSSSSMSSPGKLFVGGVSWETTEETFANYFGKFGELVDSVIMTDRMT  103

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G+PRGFGF+TF+D  VA +VL+EEHVID R VE+KRTVPR   DT  + VSKTKKIFVGG
Sbjct  104   GKPRGFGFVTFSDSAVAEKVLEEEHVIDDRKVELKRTVPRGDRDTDIKAVSKTKKIFVGG  163

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK+YF  YG ++EHQIM DH TGRSRGFGFVTF +ED+V+++ SDG++HEL
Sbjct  164   LPPFLEEDELKKYFCVYGDIIEHQIMYDHLTGRSRGFGFVTFLSEDSVERLFSDGKVHEL  223

Query  990   NGKQVEIKRAEPKRAGGDRA  931
               KQVEIKRAEPKR G D +
Sbjct  224   GDKQVEIKRAEPKRTGRDNS  243



>ref|XP_008462347.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Cucumis melo]
Length=334

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 166/242 (69%), Gaps = 6/242 (2%)
 Frame = -2

Query  1593  ENRQEQLYSRgggggGDLEPPIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEE  1414
             EN Q  L +       D+   +   +  S   E+K+S      +  KLFVGG+AWET+E+
Sbjct  17    ENGQNFLQTCNQQEQFDMRNELEQANVDSTRSEIKNS------TTHKLFVGGVAWETTED  70

Query  1413  CFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRT  1234
              F+ YFSKYGE+ DSVIM+DK +GRPRGFGF+TF DP +A+ VL+ +H+IDGR VEVKRT
Sbjct  71    TFSDYFSKYGEIADSVIMIDKHTGRPRGFGFVTFCDPAIADMVLKIDHIIDGRAVEVKRT  130

Query  1233  VPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGF  1054
             VPR D   + VS+TKKIFVGGIPP LTE E K+YFSS+G ++EHQIM+D+ T RSRGFGF
Sbjct  131   VPRADMNDKMVSRTKKIFVGGIPPGLTEVEFKDYFSSFGRIIEHQIMIDYKTKRSRGFGF  190

Query  1053  VTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMHRGNSNMHSYGNVN  874
             +TF+NED+V  + S  R+HEL GKQVEIK+A PK+   D  S         +M+  G + 
Sbjct  191   ITFENEDSVDNIFSGDRIHELGGKQVEIKKAVPKKVAYDFNSNSGHTSSGYDMYRCGGLY  250

Query  873   GD  868
              D
Sbjct  251   DD  252



>dbj|BAJ97842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  60    SSGKIFVGGVAWETTEESFSKHFGKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  119

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EH IDGR VEVKRTVPRE+   +   KT+KIFVGG+P TLTED+L+++FSSYG+VVE
Sbjct  120   LEDEHNIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVE  179

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIM+DH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  180   HQIMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  235


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++          P   K+FVGG+    +E+    +FS YG V++  
Sbjct  124   HNIDGRTV--EVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVEHQ  181

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  182   IMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  231



>dbj|BAJ89606.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  60    SSGKIFVGGVAWETTEESFSKHFGKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  119

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EH IDGR VEVKRTVPRE+   +   KT+KIFVGG+P TLTED+L+++FSSYG+VVE
Sbjct  120   LEDEHNIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVE  179

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIM+DH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  180   HQIMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  235


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++          P   K+FVGG+    +E+    +FS YG V++  
Sbjct  124   HNIDGRTV--EVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVEHQ  181

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  182   IMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  231



>ref|XP_010498136.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010498137.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=367

 Score =   255 bits (651),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 172/246 (70%), Gaps = 16/246 (7%)
 Frame = -2

Query  1635  YGGDRGEGDLQYEEENRQEQLYSRgggggGDLEPPIHSLDGSSA----GHELKHSIDD--  1474
             Y  DRG  D  Y     +EQL         ++E  +   +G +A    G ++KH++++  
Sbjct  3     YNSDRGYDD-SYHRHLHKEQL----PPSDYEVETFVDRSNGGAAVDTGGVQMKHAVENRH  57

Query  1473  ---STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADP  1303
                S  S GKLFVGG++WET+EE F  YF K+GEV+DSV M D+++G PRGFGF+TFAD 
Sbjct  58    SSSSMSSPGKLFVGGVSWETTEETFVNYFGKFGEVVDSVFMTDRMTGNPRGFGFVTFADS  117

Query  1302  EVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
              VA +VL+EEHV+D R VE+KRTVPR   DT  + VSKT+KIFVGG+PP L EDELK YF
Sbjct  118   AVAEKVLEEEHVLDDRKVELKRTVPRGDRDTDIKAVSKTRKIFVGGLPPLLEEDELKNYF  177

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
               YG ++EHQIM DH TGRSRGFGF+TF  ED+V ++ SDG++HEL  KQVEI+RAEPKR
Sbjct  178   CVYGDIIEHQIMYDHLTGRSRGFGFITFQTEDSVDRLFSDGKVHELGDKQVEIRRAEPKR  237

Query  948   AGGDRA  931
              G D +
Sbjct  238   TGRDNS  243



>ref|XP_010476920.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=367

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 154/200 (77%), Gaps = 7/200 (4%)
 Frame = -2

Query  1509  SAGHELKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G ++KHS++      S  S GKLFVGG++WET+EE F  YF K+GEV+DSVIM D+++
Sbjct  44    TGGVQMKHSVEHRHSSSSMSSPGKLFVGGVSWETTEETFANYFGKFGEVVDSVIMTDRMT  103

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G PRGFGF+TFAD  VA +VL+EEHV+D R VE+KRTVPR   D   + VSKT+KIFVGG
Sbjct  104   GNPRGFGFVTFADSAVAEKVLEEEHVLDDRKVELKRTVPRGDRDIDIKAVSKTRKIFVGG  163

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK YF  YG ++EHQIM DH TGRSRGFGF+TF  ED+V ++ SDG++HEL
Sbjct  164   LPPLLEEDELKNYFCVYGDIIEHQIMYDHLTGRSRGFGFITFQTEDSVDRLFSDGKVHEL  223

Query  990   NGKQVEIKRAEPKRAGGDRA  931
               KQVEI+RAEPKR G D +
Sbjct  224   GDKQVEIRRAEPKRTGRDNS  243



>ref|XP_008782529.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Phoenix dactylifera]
Length=361

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  1419  EECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVK  1240
             EE F+++F KYGE+ DSVIM DK +  PRGFGF+TFADP V + VL++EHVIDGR+VEVK
Sbjct  98    EETFSKHFEKYGEITDSVIMKDKHTHMPRGFGFVTFADPSVVDNVLEDEHVIDGRMVEVK  157

Query  1239  RTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGF  1060
             RTVPR D P +   KTKKIFVGGIP +LTEDELKE+F+SYG V+EHQIMLDH+TGRSRGF
Sbjct  158   RTVPRGDLPSKAGLKTKKIFVGGIPLSLTEDELKEHFASYGKVIEHQIMLDHSTGRSRGF  217

Query  1059  GFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMHRGN  904
             GFVTF+NE+AV+K++S+GRMH L GKQVEIKRAEPK+AGGD  + GR+  G 
Sbjct  218   GFVTFENEEAVKKIISEGRMHNLGGKQVEIKRAEPKKAGGDPGNNGRVGHGT  269


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSID--DSTPSAG----KLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG     E+K ++   D    AG    K+FVGGI    +E+    +F+ YG+VI+  
Sbjct  147   HVIDGRMV--EVKRTVPRGDLPSKAGLKTKKIFVGGIPLSLTEDELKEHFASYGKVIEHQ  204

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF + E   +++ E   H + G+ VE+KR  P++
Sbjct  205   IMLDHSTGRSRGFGFVTFENEEAVKKIISEGRMHNLGGKQVEIKRAEPKK  254



>gb|ADN34116.1| heterogeneous nuclear ribonucleoprotein a1 [Cucumis melo subsp. 
melo]
Length=699

 Score =   261 bits (666),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 168/232 (72%), Gaps = 12/232 (5%)
 Frame = -2

Query  1629  GDRGEGDLQYEEENRQEQLYSRgggggGDLEPPIHSLDGSSAGHELKHSIDD-STPSAGK  1453
             G+ G+  LQ    N+QEQ          D+   +   +  S   E+K+S     + S+GK
Sbjct  374   GENGQNFLQ--TCNQQEQF---------DMRNELEQANVDSTRSEIKNSTTQYDSSSSGK  422

Query  1452  LFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEE  1273
             LFVGG+AWET+E+ F+ YFSKYGE+ DSVIM+DK +GRPRGFGF+TF DP +A+ VL+ +
Sbjct  423   LFVGGVAWETTEDTFSDYFSKYGEIADSVIMIDKHTGRPRGFGFVTFCDPAIADMVLKID  482

Query  1272  HVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIM  1093
             H+IDGR VEVKRTVPR D   + VS+TKKIFVGGIPP LTE E K+YFSS+G ++EHQIM
Sbjct  483   HIIDGRAVEVKRTVPRADMNDKMVSRTKKIFVGGIPPGLTEVEFKDYFSSFGRIIEHQIM  542

Query  1092  LDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             +D+ T RSRGFGF+TF+NED+V  + S  R+HEL GKQVEIK+A PK+   D
Sbjct  543   IDYKTKRSRGFGFITFENEDSVDNIFSGDRIHELGGKQVEIKKAVPKKVAYD  594



>ref|XP_004141686.1| PREDICTED: uncharacterized protein LOC101220676 [Cucumis sativus]
 ref|XP_004169988.1| PREDICTED: uncharacterized LOC101220676 [Cucumis sativus]
Length=700

 Score =   260 bits (665),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = -2

Query  1545  DLEPPIHSLDGSSAGHELKHSIDD-STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDS  1369
             D+   +   +  S   E+K+S     + S+GKLFVGG+AWET+E+ F  YFSKYGE+ DS
Sbjct  393   DMGNELEQANVDSTRSEIKNSTTQYDSSSSGKLFVGGVAWETTEDTFRDYFSKYGEIADS  452

Query  1368  VIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTK  1189
             VIM+DK +GRPRGFGF+TF DP +A+ VL+ +H+IDGR VEVKRTVPR D   + VS+TK
Sbjct  453   VIMIDKHTGRPRGFGFVTFCDPAIADMVLKIDHIIDGRAVEVKRTVPRADMNDKMVSRTK  512

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIFVGGIPP LTE+E K+YFSS+G ++EHQIM+D+ T RSRGFGF+TF+NED+V+ + S 
Sbjct  513   KIFVGGIPPGLTEEEFKDYFSSFGRIIEHQIMIDYKTKRSRGFGFITFENEDSVENIFSG  572

Query  1008  GRMHELNGKQVEIKRAEPKRAGGD  937
              R+HEL GKQVEIK+A PKR   D
Sbjct  573   DRIHELGGKQVEIKKAVPKRVAYD  596



>emb|CDY26229.1| BnaA06g11880D [Brassica napus]
Length=371

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 178/256 (70%), Gaps = 33/256 (13%)
 Frame = -2

Query  1635  YGGDRGEGDLQYEEENRQEQLYSRgggggGDLEPP----IHSLD-----GSSA----GHE  1495
             Y   RG GD  Y  + ++EQL            PP    + ++D     G+SA    G +
Sbjct  3     YNSGRGYGDDSYHRQLQEEQL------------PPSDYVVETVDDRSNGGASAVDTGGMQ  50

Query  1494  LKHSIDDS-----TPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             +K S D         S GKLFVGG++WET+EE F +YF K+GEV+DSVIM D+++G+PRG
Sbjct  51    MKQSSDHRHSSSSMCSPGKLFVGGVSWETTEENFGKYFEKFGEVVDSVIMRDRMTGKPRG  110

Query  1329  FGFITFADPEVANRVLQEE-HVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPT  1159
             FGF+TFAD  VA +VL+EE HVID R V++KRTVPR   DT  + VSKT+KIFVGG+PP 
Sbjct  111   FGFVTFADSAVAEKVLEEEEHVIDDRKVDLKRTVPRGDRDTDIKPVSKTRKIFVGGLPPF  170

Query  1158  LTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQ  979
             L EDELK+YF  YG ++EHQI+ DH+TGRSRGFGFVTF  ED+V ++ SDG++HEL  KQ
Sbjct  171   LEEDELKKYFCVYGDIIEHQIVYDHHTGRSRGFGFVTFLAEDSVDRLFSDGKVHELGDKQ  230

Query  978   VEIKRAEPKRAGGDRA  931
             V+IKRAEPKRAG D +
Sbjct  231   VDIKRAEPKRAGRDNS  246



>ref|XP_009149216.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Brassica 
rapa]
Length=371

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 178/256 (70%), Gaps = 33/256 (13%)
 Frame = -2

Query  1635  YGGDRGEGDLQYEEENRQEQLYSRgggggGDLEPP----IHSLD-----GSSA----GHE  1495
             Y   RG GD  Y  + ++EQL            PP    + ++D     G+SA    G +
Sbjct  3     YNSGRGYGDDSYHRQLQEEQL------------PPSDYVVETVDDRSNGGASAVDTGGMQ  50

Query  1494  LKHSIDDS-----TPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             +K S D         S GKLFVGG++WET+EE F +YF K+GEV+DSVIM D+++G+PRG
Sbjct  51    MKQSSDHRHSSSSMCSPGKLFVGGVSWETTEENFGKYFEKFGEVVDSVIMRDRMTGKPRG  110

Query  1329  FGFITFADPEVANRVLQEE-HVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPT  1159
             FGF+TFAD  VA +VL+EE HVID R V++KRTVPR   DT  + VSKT+KIFVGG+PP 
Sbjct  111   FGFVTFADSAVAEKVLEEEEHVIDDRKVDLKRTVPRGDRDTDIKAVSKTRKIFVGGLPPF  170

Query  1158  LTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQ  979
             L EDELK+YF  YG ++EHQI+ DH+TGRSRGFGFVTF  ED+V ++ SDG++HEL  KQ
Sbjct  171   LEEDELKKYFGVYGDIIEHQIVYDHHTGRSRGFGFVTFLAEDSVDRLFSDGKVHELGDKQ  230

Query  978   VEIKRAEPKRAGGDRA  931
             V+IKRAEPKRAG D +
Sbjct  231   VDIKRAEPKRAGRDNS  246



>gb|AAF79476.1|AC022492_20 F1L3.34 [Arabidopsis thaliana]
Length=392

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             KLFVGG++WET+ E F  YF K+GEV+DSVIM D+++G PRGFGF+TFAD  VA +VL+E
Sbjct  90    KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE  149

Query  1275  EHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEH  1102
             +HVID R V++KRT+PR  +DT  + VSKT+KIFVGG+PP L EDELK YF  YG ++EH
Sbjct  150   DHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIEH  209

Query  1101  QIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRA  931
             QIM DH+TGRSRGFGFVTF  ED+V ++ SDG++HEL  KQVEIKRAEPKR G D +
Sbjct  210   QIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTGRDNS  266


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -2

Query  1218  TPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDN  1039
              PF  V   +K+FVGG+    T +    YF  +G VV+  IM D  TG  RGFGFVTF +
Sbjct  81    VPFVFVY-VRKLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFAD  139

Query  1038  EDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
                 +KVL +   H ++ ++V++KR  P+
Sbjct  140   SAVAEKVLEED--HVIDDRKVDLKRTLPR  166



>emb|CDY48318.1| BnaC05g13720D [Brassica napus]
Length=372

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GKLFVGG++WET+EE F +YF K+GEV+DSVIM D+++G+PRGFGF+TFAD  VA +V
Sbjct  66    SPGKLFVGGVSWETTEENFGKYFEKFGEVVDSVIMRDRMTGKPRGFGFVTFADSAVAEKV  125

Query  1284  LQEE-HVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             L+EE HVID R V++KRTVPR   DT  + VSKT+KIFVGG+PP L EDELK+YF  YG 
Sbjct  126   LEEEEHVIDDRKVDLKRTVPRGDRDTDTKAVSKTRKIFVGGLPPFLEEDELKKYFCVYGD  185

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             ++EHQI+ DH+TGRSRGFGFVTF  ED+V ++ SDG++HEL  KQV+IKRAEPKRAG D 
Sbjct  186   IIEHQIVYDHHTGRSRGFGFVTFLAEDSVDRLFSDGKVHELGDKQVDIKRAEPKRAGRDN  245

Query  933   A  931
             +
Sbjct  246   S  246



>gb|AFW86727.1| hypothetical protein ZEAMMB73_661369 [Zea mays]
Length=278

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 143/167 (86%), Gaps = 9/167 (5%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             ++GK+FVGG+AWET+EE F ++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RV
Sbjct  91    ASGKVFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRV  150

Query  1284  LQEEHVIDGRVVEVKRTVPRE----DTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYG  1117
             L++EHVIDGR VEVKRTVP+E    D P     KTKKIFVGGIPP+LTED+LKE+FSSYG
Sbjct  151   LEDEHVIDGRTVEVKRTVPKELSSKDGP-----KTKKIFVGGIPPSLTEDKLKEHFSSYG  205

Query  1116  SVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
              VVEHQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L GKQV
Sbjct  206   KVVEHQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQV  252


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             K+FVGG+    TE+   ++F  YG++ +  IM D +T   RGFGFVTF +   + +VL D
Sbjct  94    KVFVGGVAWETTEETFTKHFQKYGAITDSVIMKDKHTRMPRGFGFVTFSDPSVLDRVLED  153

Query  1008  GRMHELNGKQVEIKRAEPK  952
                H ++G+ VE+KR  PK
Sbjct  154   --EHVIDGRTVEVKRTVPK  170



>gb|KFK43948.1| hypothetical protein AALP_AA1G195500 [Arabis alpina]
Length=357

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 148/193 (77%), Gaps = 2/193 (1%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLFVGG++WET++E F  YF K+GE++DSVIM D+++G+PRGFGF+TFAD  VA++VL+
Sbjct  61    GKLFVGGVSWETTQETFANYFGKFGELVDSVIMTDRMTGKPRGFGFVTFADSAVADKVLE  120

Query  1278  EEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +EHVID R V++KRTVPR   DT  + VSKT+KIFVGG+PP L EDELK+YF  YG ++E
Sbjct  121   DEHVIDDRKVDLKRTVPRGDRDTEIKPVSKTRKIFVGGLPPFLEEDELKKYFCVYGEILE  180

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQI+ DH TGRSRGFGFVTF  ED+V ++ SD ++HE+  KQVEIKRAEPKR G D    
Sbjct  181   HQIVYDHLTGRSRGFGFVTFQTEDSVDRLFSDEKVHEIGDKQVEIKRAEPKRTGRDTNFR  240

Query  924   GRMHRGNSNMHSY  886
                  G  N   Y
Sbjct  241   SYDASGKYNQEDY  253



>ref|XP_006853839.1| hypothetical protein AMTR_s00036p00067000 [Amborella trichopoda]
 gb|ERN15306.1| hypothetical protein AMTR_s00036p00067000 [Amborella trichopoda]
Length=410

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 153/193 (79%), Gaps = 4/193 (2%)
 Frame = -2

Query  1521  LDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSG  1342
             +D  ++  E   S+ DS+P  GK+FVGG++W TSE+ F ++F KYG + DSVIM DK +G
Sbjct  105   VDNVNSAGEDTSSVKDSSP--GKIFVGGVSWSTSEDTFTKHFKKYGAITDSVIMKDKQTG  162

Query  1341  RPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPP  1162
              PRGFGF+TFADP   ++VL++EHVIDGR VEVKRTVPRE +   +  +TKKIFVGGIP 
Sbjct  163   IPRGFGFVTFADPSTLDKVLEDEHVIDGREVEVKRTVPREMS--TKGPRTKKIFVGGIPT  220

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             +LT+DELKEYFSSYG VV+HQIMLDH TGRSRGF FVTF N++ V +++S G++HE+ GK
Sbjct  221   SLTDDELKEYFSSYGEVVDHQIMLDHGTGRSRGFAFVTFKNDETVDEIISKGKVHEIGGK  280

Query  981   QVEIKRAEPKRAG  943
             +VEIK+AEP++  
Sbjct  281   KVEIKKAEPRKPA  293



>gb|ABR16107.1| unknown [Picea sitchensis]
 gb|ACN40521.1| unknown [Picea sitchensis]
 gb|ACN40697.1| unknown [Picea sitchensis]
Length=371

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -2

Query  1470  TPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVAN  1291
             T S GK+F+GG++ ETS   F +YFSKYGE+ DSVIM D+ +G PRGFGF+T+ADP V +
Sbjct  47    TSSPGKIFIGGLSRETSSATFTKYFSKYGELTDSVIMKDRATGNPRGFGFVTYADPSVVD  106

Query  1290  RVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSV  1111
             +V++++H IDG++VE+KRT+PR +    +  KTKKIFVGGIP ++TEDE K+YFS +G V
Sbjct  107   KVIKDKHFIDGKMVEIKRTIPRGNAA-TKGPKTKKIFVGGIPTSITEDEFKDYFSKFGKV  165

Query  1110  VEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             +EHQIM DH TGRSRGFGFVTFD+E+AV+++LS G+M EL GKQVEIK+AEPK+A
Sbjct  166   LEHQIMQDHGTGRSRGFGFVTFDSEEAVEEILSHGKMCELGGKQVEIKKAEPKKA  220



>ref|XP_009615296.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=299

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  1362  MMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKI  1183
             MMDKVSGRPRGFGF+TFADPEV N+VL+E+HVIDGR VEVKRTVP+ED   +   KTKKI
Sbjct  1     MMDKVSGRPRGFGFVTFADPEVVNKVLEEDHVIDGRTVEVKRTVPKEDMQVKGAPKTKKI  60

Query  1182  FVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGR  1003
             FVGG+P +LTEDELKEYFSSYG V+EHQIMLD  TGRSRGFGFVTFD+E A++KVL++GR
Sbjct  61    FVGGLPLSLTEDELKEYFSSYGYVLEHQIMLDRETGRSRGFGFVTFDSEHAIEKVLNNGR  120

Query  1002  MHELNGKQVEIKRAEPKRAGGDRASEGRMH  913
             MHE+ GKQVEIKRAEPKRAG + A+  R H
Sbjct  121   MHEICGKQVEIKRAEPKRAGPEYANGSRQH  150


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 10/113 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDD------STPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H +DG +   E+K ++          P   K+FVGG+    +E+    YFS YG V++  
Sbjct  31    HVIDGRTV--EVKRTVPKEDMQVKGAPKTKKIFVGGLPLSLTEDELKEYFSSYGYVLEHQ  88

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQ--EEHVIDGRVVEVKRTVPREDTP  1213
             IM+D+ +GR RGFGF+TF       +VL     H I G+ VE+KR  P+   P
Sbjct  89    IMLDRETGRSRGFGFVTFDSEHAIEKVLNNGRMHEICGKQVEIKRAEPKRAGP  141



>ref|XP_002892960.1| hypothetical protein ARALYDRAFT_335030 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69219.1| hypothetical protein ARALYDRAFT_335030 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 149/200 (75%), Gaps = 15/200 (8%)
 Frame = -2

Query  1509  SAGHELKHSID-----DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             + G ++KHSI+      S  S GKLFVGG++WET+EE F  YF K+GEV+DSVIM D+++
Sbjct  37    TGGIQMKHSIEHRHSSSSMSSPGKLFVGGVSWETTEETFANYFGKFGEVVDSVIMTDRIT  96

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR--EDTPFRRVSKTKKIFVGG  1171
             G PRGFGF+TFAD  VA +VL+EEHVID R V++KRTVPR   DT  + VSKT+KIFVGG
Sbjct  97    GNPRGFGFVTFADSAVAEKVLEEEHVIDDRKVDLKRTVPRGDRDTDIKAVSKTRKIFVGG  156

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +PP L EDELK YF  YG ++EHQIM DH+TGRSRGFGFVTF  ED+V ++ SD +    
Sbjct  157   LPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDAK----  212

Query  990   NGKQVEIKRAEPKRAGGDRA  931
                 V+IKRAEPKR G D +
Sbjct  213   ----VDIKRAEPKRTGRDNS  228



>gb|ABR17668.1| unknown [Picea sitchensis]
Length=411

 Score =   238 bits (606),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = -2

Query  1491  KHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITF  1312
             K   ++   S GK+F+GG++  T+   F ++FSKYGE+ DSVIM D+++G+PRGFGF+T+
Sbjct  31    KQEKNNDVSSPGKIFIGGLSRSTTSSAFTKHFSKYGELTDSVIMKDRLTGQPRGFGFVTY  90

Query  1311  ADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEY  1132
             ADP V ++V+Q++H++DG+ VE+KRT+PR ++   +  KTKK+FVGGIP ++TEDE K+Y
Sbjct  91    ADPSVIDKVIQDKHILDGKTVEIKRTIPRGNS--SKAPKTKKVFVGGIPTSITEDEFKDY  148

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             FS +G VVEHQIM D NTGRSRGFGF+TF+ E AV++++S GRM EL GKQVEIK+AEPK
Sbjct  149   FSKFGKVVEHQIMQDRNTGRSRGFGFITFETEQAVEEIISQGRMLELGGKQVEIKKAEPK  208

Query  951   R  949
             +
Sbjct  209   K  209



>ref|XP_010689212.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Beta 
vulgaris subsp. vulgaris]
Length=339

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 152/197 (77%), Gaps = 9/197 (5%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             + +D ++P  GK+F+GG+A ETS + F +YF KYGEVIDSVIM D+++GRPRGFGFIT+A
Sbjct  9     NEVDGASP--GKIFIGGLAKETSLDTFTKYFEKYGEVIDSVIMKDRLTGRPRGFGFITYA  66

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELK  1138
             DP V + V++EEH+I+ + VE+KRT+P+   +   F    KTKKIFVGGIP T+TEDELK
Sbjct  67    DPSVVDIVIKEEHIINEKQVEIKRTIPKGAAQSNGF----KTKKIFVGGIPTTVTEDELK  122

Query  1137  EYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAE  958
             E+FS+YG VVEH+I++DH T RSRGFGFV FDNE  V  +L+DG M E+NG +VEIK+AE
Sbjct  123   EFFSNYGKVVEHEIIVDHATKRSRGFGFVVFDNEKVVDDILADGNMIEMNGSRVEIKKAE  182

Query  957   PKRAGGDRASEGRMHRG  907
             PK+A    ++ G   RG
Sbjct  183   PKKASASGSAFGSDSRG  199



>ref|XP_002968957.1| hypothetical protein SELMODRAFT_68338, partial [Selaginella moellendorffii]
 ref|XP_002990004.1| hypothetical protein SELMODRAFT_48637, partial [Selaginella moellendorffii]
 gb|EFJ09017.1| hypothetical protein SELMODRAFT_48637, partial [Selaginella moellendorffii]
 gb|EFJ30073.1| hypothetical protein SELMODRAFT_68338, partial [Selaginella moellendorffii]
Length=162

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+F+GG++W+T+ E    +F KYGE+ D+VIM D+ SG PRGFGF+TFAD +V +RVL+
Sbjct  1     GKIFIGGLSWDTTTEKLESHFKKYGEITDAVIMRDRSSGNPRGFGFVTFADSDVCDRVLR  60

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQ  1099
             ++HV+DGR VE KR++PRE     +  KTKKIFVGGIPP++TE+E K YFSS+G+V+EHQ
Sbjct  61    DKHVLDGRTVECKRSIPRESMLVVKGPKTKKIFVGGIPPSITEEEFKAYFSSFGNVIEHQ  120

Query  1098  IMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             IM DHNTGRSRGFGF+ FD+E  V+ VLS GRMHEL GKQV
Sbjct  121   IMQDHNTGRSRGFGFIVFDSEQTVEDVLSHGRMHELGGKQV  161


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 46/88 (52%), Gaps = 8/88 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDST------PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H LDG +   E K SI   +      P   K+FVGGI    +EE F  YFS +G VI+  
Sbjct  63    HVLDGRTV--ECKRSIPRESMLVVKGPKTKKIFVGGIPPSITEEEFKAYFSSFGNVIEHQ  120

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVL  1282
             IM D  +GR RGFGFI F   +    VL
Sbjct  121   IMQDHNTGRSRGFGFIVFDSEQTVEDVL  148



>gb|EMT12173.1| Heterogeneous nuclear ribonucleoprotein 27C [Aegilops tauschii]
Length=529

 Score =   237 bits (604),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  1416  ECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKR  1237
             E F+++F KYG + DSVIM DK +G PRGFGF+TF+DP V +RVL++EH IDGR VEVKR
Sbjct  222   EKFSKHFQKYGAITDSVIMKDKHTGMPRGFGFVTFSDPSVIDRVLEDEHTIDGRTVEVKR  281

Query  1236  TVPREDTPFRRV-SKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGF  1060
             TVPRE+   +   +KT+KIFVGGIP +LTED+LKE+FSSYG V EHQIM+DH+TGRSRGF
Sbjct  282   TVPREEMSTKDAPNKTRKIFVGGIPASLTEDKLKEHFSSYGKVAEHQIMVDHSTGRSRGF  341

Query  1059  GFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMH  913
             GFVTF++EDAV++V+SDGRMH+L GKQVEIKRAEPK+ GG  +S    H
Sbjct  342   GFVTFESEDAVERVMSDGRMHDLGGKQVEIKRAEPKKPGGGDSSSNSRH  390


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 11/111 (10%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI-------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDS  1369
             H++DG +   E+K ++        D+     K+FVGGI    +E+    +FS YG+V + 
Sbjct  270   HTIDGRTV--EVKRTVPREEMSTKDAPNKTRKIFVGGIPASLTEDKLKEHFSSYGKVAEH  327

Query  1368  VIMMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
              IM+D  +GR RGFGF+TF   +   RV+ +   H + G+ VE+KR  P++
Sbjct  328   QIMVDHSTGRSRGFGFVTFESEDAVERVMSDGRMHDLGGKQVEIKRAEPKK  378



>ref|XP_010227591.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0-like isoform 
X2 [Brachypodium distachyon]
Length=380

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -2

Query  1425  TSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVE  1246
             T  E F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V +RVL++EH IDGR VE
Sbjct  64    TDRETFSKHFQKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDRVLEDEHTIDGRTVE  123

Query  1245  VKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSR  1066
             VKRTVPRE+   +   KT+KIFVGGIP +LTE +LKE+FSSYG V EHQIM+DH+TGRSR
Sbjct  124   VKRTVPREEMSTKDGPKTRKIFVGGIPTSLTEGKLKEHFSSYGKVEEHQIMVDHSTGRSR  183

Query  1065  GFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS  928
             GFGFVTF++EDAV++V+S+GRMH+L GKQVEIKRAEPK+ GG  +S
Sbjct  184   GFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKRAEPKKPGGGDSS  229


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI---DDST---PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++   + ST   P   K+FVGGI    +E     +FS YG+V +  
Sbjct  115   HTIDGRTV--EVKRTVPREEMSTKDGPKTRKIFVGGIPTSLTEGKLKEHFSSYGKVEEHQ  172

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E   H + G+ VE+KR  P++
Sbjct  173   IMVDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKRAEPKK  222



>ref|XP_006416684.1| hypothetical protein EUTSA_v10007978mg [Eutrema salsugineum]
 gb|ESQ35037.1| hypothetical protein EUTSA_v10007978mg [Eutrema salsugineum]
Length=355

 Score =   230 bits (587),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = -2

Query  1416  ECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKR  1237
             E F  YF K+GE++DSVIM D+++G+PRGFGF+TF+D  VA +VL+EEHVID R VE+KR
Sbjct  66    ETFANYFGKFGELVDSVIMTDRMTGKPRGFGFVTFSDSAVAEKVLEEEHVIDDRKVELKR  125

Query  1236  TVPR--EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRG  1063
             TVPR   DT  + VSKTKKIFVGG+PP L EDELK+YF  YG ++EHQIM DH TGRSRG
Sbjct  126   TVPRGDRDTDIKAVSKTKKIFVGGLPPFLEEDELKKYFCVYGDIIEHQIMYDHLTGRSRG  185

Query  1062  FGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRA  931
             FGFVTF +ED+V+++ SDG++HEL  KQVEIKRAEPKR G D +
Sbjct  186   FGFVTFLSEDSVERLFSDGKVHELGDKQVEIKRAEPKRTGRDNS  229


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 5/88 (6%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+     E+   +YF  YG++I+  IM D ++GR RGFGF+TF   +   R+  +
Sbjct  144   KIFVGGLPPFLEEDELKKYFCVYGDIIEHQIMYDHLTGRSRGFGFVTFLSEDSVERLFSD  203

Query  1275  --EHVIDGRVVEVKRTVPR---EDTPFR  1207
                H +  + VE+KR  P+    D  FR
Sbjct  204   GKVHELGDKQVEIKRAEPKRTGRDNSFR  231



>ref|XP_009337721.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=346

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 156/213 (73%), Gaps = 15/213 (7%)
 Frame = -2

Query  1605  QYEEENRQ-EQLYSRgggggGDLEPPIHSLDGSSAGHELKHSIDDSTPSAG---KLFVGG  1438
             Q+EE  RQ EQ +    G   +     H++D  + G++ + S +    +A    KLFV G
Sbjct  31    QFEEFERQSEQQFESWHGFQSN-----HNVD--AEGNDFRDSFNHRDSAAWLVRKLFVRG  83

Query  1437  IAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDG  1258
             ++WET+EE F+ YFSKYGE+ DSVIM+DK +G+PRGFGF+TF DP V + VL+ EHVID 
Sbjct  84    VSWETTEENFSNYFSKYGEIADSVIMIDKHTGKPRGFGFVTFLDPVVVDSVLEVEHVID-  142

Query  1257  RVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNT  1078
                E+KR VPRED  F+  SK KKIFVGGIP  LT+DEL +YFS+YG +VEHQIMLDHNT
Sbjct  143   ---ELKRMVPREDIGFKGASKRKKIFVGGIPTLLTDDELGDYFSTYGIIVEHQIMLDHNT  199

Query  1077  GRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQ  979
             GRSRGFGFVTF+NEDA+ K+ S+G++HEL GKQ
Sbjct  200   GRSRGFGFVTFENEDALDKIFSEGKIHELGGKQ  232



>ref|XP_001773137.1| predicted protein [Physcomitrella patens]
 gb|EDQ61990.1| predicted protein [Physcomitrella patens]
Length=199

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+F+GG++W+TS +    +F KYGE+ID+VIM D+ +G PRGFGF+TFADP V + V+ 
Sbjct  1     GKIFIGGLSWDTSTDNLQSHFKKYGEIIDAVIMKDRSTGHPRGFGFVTFADPAVCDNVVL  60

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQ  1099
             ++HVIDGR VE K++VPRE+    +  KTKKIFVGGIPP++T++E K YF+S+GSVVEHQ
Sbjct  61    DKHVIDGRTVEAKKSVPRENMAASKGPKTKKIFVGGIPPSITDEEFKSYFASFGSVVEHQ  120

Query  1098  IMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             IM DH+TGRSRGFGFVTFD+E  V+ +L+ G+MHEL GKQV
Sbjct  121   IMQDHSTGRSRGFGFVTFDSEQVVEDILAHGKMHELGGKQV  161


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+FVGGI    ++E F  YF+ +G V++  IM D  +GR RGFGF+TF   +V   
Sbjct  87    PKTKKIFVGGIPPSITDEEFKSYFASFGSVVEHQIMQDHSTGRSRGFGFVTFDSEQVVED  146

Query  1287  VL  1282
             +L
Sbjct  147   IL  148



>ref|XP_001754422.1| predicted protein [Physcomitrella patens]
 ref|XP_001754425.1| predicted protein [Physcomitrella patens]
 gb|EDQ80872.1| predicted protein [Physcomitrella patens]
 gb|EDQ80875.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+F+GG++W+TS +    +F KYGE+ID+VIM D+ +G PRGFGF+TFADP V + V+ 
Sbjct  1     GKIFIGGLSWDTSTDNLQSHFKKYGEIIDAVIMKDRSTGHPRGFGFVTFADPAVCDNVVL  60

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQ  1099
             ++HVIDGR VE K++VPRE+    +  KTKKIFVGGIPP++T++E K YF  +GSVVEHQ
Sbjct  61    DKHVIDGRTVEAKKSVPRENMAASKGPKTKKIFVGGIPPSITDEEFKSYFGGFGSVVEHQ  120

Query  1098  IMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             IM DH+TGRSRGFGFVTFDNE  V+ +L+ G+MHEL GKQV
Sbjct  121   IMQDHSTGRSRGFGFVTFDNEQVVEDILAHGKMHELGGKQV  161


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+FVGGI    ++E F  YF  +G V++  IM D  +GR RGFGF+TF + +V   
Sbjct  87    PKTKKIFVGGIPPSITDEEFKSYFGGFGSVVEHQIMQDHSTGRSRGFGFVTFDNEQVVED  146

Query  1287  VL  1282
             +L
Sbjct  147   IL  148



>ref|XP_001752764.1| predicted protein [Physcomitrella patens]
 gb|EDQ82268.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+F+GG++W+TS +    +F KYGE+ID+VIM D+ +G PRGFGF+TFADP+V ++V+ 
Sbjct  1     GKIFIGGLSWDTSTDNLQSHFKKYGEIIDAVIMKDRSTGHPRGFGFVTFADPDVCDKVVL  60

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQ  1099
             ++HVIDGR VE K++VPRE+    +  KTKKIFVGGIPP++T++E K YF+ +GSV+EHQ
Sbjct  61    DKHVIDGRTVEAKKSVPRENLATSKGPKTKKIFVGGIPPSITDEEFKSYFAGFGSVMEHQ  120

Query  1098  IMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             IM DH+TGRSRGFGFVTFD+E  V+ +L+ G++HEL GKQV
Sbjct  121   IMQDHSTGRSRGFGFVTFDSEQVVEDILAHGKLHELAGKQV  161


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  1467  PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANR  1288
             P   K+FVGGI    ++E F  YF+ +G V++  IM D  +GR RGFGF+TF   +V   
Sbjct  87    PKTKKIFVGGIPPSITDEEFKSYFAGFGSVMEHQIMQDHSTGRSRGFGFVTFDSEQVVED  146

Query  1287  VL  1282
             +L
Sbjct  147   IL  148



>gb|EAY85049.1| hypothetical protein OsI_06408 [Oryza sativa Indica Group]
Length=504

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S+GK+FVGG+AWET+EE F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++V
Sbjct  173   SSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV  232

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             L++EHVIDGR ++ +    +     +   + +KIFVGG+P +LTEDEL+E+FS YG +VE
Sbjct  233   LEDEHVIDGRTLKGQS---QGSNVIKDGPRPRKIFVGGLPSSLTEDELREHFSPYGKIVE  289

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIMLDH+TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  290   HQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  345


 Score = 68.2 bits (165),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 3/105 (3%)
 Frame = -2

Query  1527  HSLDGSS-AGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDK  1351
             H +DG +  G     ++    P   K+FVGG+    +E+    +FS YG++++  IM+D 
Sbjct  237   HVIDGRTLKGQSQGSNVIKDGPRPRKIFVGGLPSSLTEDELREHFSPYGKIVEHQIMLDH  296

Query  1350  VSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
              +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  297   STGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  341



>gb|EMT25802.1| Heterogeneous nuclear ribonucleoprotein 27C [Aegilops tauschii]
Length=484

 Score =   229 bits (585),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  1440  GIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID  1261
             G++     E F+++F KYG + DSVIM DK +  PRGFGF+TF+DP V ++VL++EH ID
Sbjct  158   GMSQFLRTESFSKHFGKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLEDEHNID  217

Query  1260  GRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHN  1081
             GR VEVKRTVPRE+   +   KT+KIFVGG+P TLTED+L+++FSSYG+VVEHQIM+DH+
Sbjct  218   GRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVEHQIMVDHS  277

Query  1080  TGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             TGRSRGFGFVTF++ED+V++V+S+GRM +L GKQVEIK+AEPK+ GGD
Sbjct  278   TGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGD  325


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++          P   K+FVGG+    +E+    +FS YG V++  
Sbjct  214   HNIDGRTV--EVKRTVPREEMSSKDGPKTRKIFVGGLPSTLTEDDLRDHFSSYGNVVEHQ  271

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF   +   RV+ E  + D  G+ VE+K+  P++
Sbjct  272   IMVDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK  321



>gb|ABK24684.1| unknown [Picea sitchensis]
Length=375

 Score =   226 bits (576),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG++  T+   F ++FSKYGE+ DSVIM D+ +G+PRGFGF+T+AD  V ++V
Sbjct  44    SPGKIFIGGLSRSTTTVVFTKHFSKYGELTDSVIMKDRHTGQPRGFGFVTYADASVVDKV  103

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++++H++DGR VE+KRT+PR +T   +  KTKKIFVGGIP T+TEDE K+YFS +G V E
Sbjct  104   IEDKHILDGRTVEIKRTIPRGNT--SKGPKTKKIFVGGIPTTITEDEFKDYFSKFGKVAE  161

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGD  937
             HQIM D +TGRSRGFGF+TFD+E  V++++S G+M EL GKQVEIK+AEPK+   D
Sbjct  162   HQIMQDRSTGRSRGFGFITFDSEQVVEEIISQGKMIELGGKQVEIKKAEPKKPSSD  217


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 8/108 (7%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDSTPSAG----KLFVGGIAWETSEECFNRYFSKYGEVIDSVIM  1360
             H LDG +   E+K +I     S G    K+FVGGI    +E+ F  YFSK+G+V +  IM
Sbjct  108   HILDGRTV--EIKRTIPRGNTSKGPKTKKIFVGGIPTTITEDEFKDYFSKFGKVAEHQIM  165

Query  1359  MDKVSGRPRGFGFITFADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
              D+ +GR RGFGFITF   +V   ++ +  +I+  G+ VE+K+  P++
Sbjct  166   QDRSTGRSRGFGFITFDSEQVVEEIISQGKMIELGGKQVEIKKAEPKK  213


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -2

Query  1209  RRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDA  1030
             R  S   KIF+GG+  + T     ++FS YG + +  IM D +TG+ RGFGFVT+ +   
Sbjct  40    REASSPGKIFIGGLSRSTTTVVFTKHFSKYGELTDSVIMKDRHTGQPRGFGFVTYADASV  99

Query  1029  VQKVLSDGRMHELNGKQVEIKRAEPK  952
             V KV+ D   H L+G+ VEIKR  P+
Sbjct  100   VDKVIED--KHILDGRTVEIKRTIPR  123



>ref|NP_001057893.2| Os06g0566100 [Oryza sativa Japonica Group]
 dbj|BAD54495.1| putative Heterogeneous nuclear ribonucleoproteins A1 homolog 
[Oryza sativa Japonica Group]
 dbj|BAD54536.1| putative Heterogeneous nuclear ribonucleoproteins A1 homolog 
[Oryza sativa Japonica Group]
 dbj|BAG86924.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19807.2| Os06g0566100 [Oryza sativa Japonica Group]
Length=285

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  1362  MMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKI  1183
             M DK +  PRGFGF+TF+DP V ++VLQ+EH IDGR VEVKRTVPRE+   +   KT+KI
Sbjct  1     MKDKHTKMPRGFGFVTFSDPSVIDKVLQDEHTIDGRTVEVKRTVPREEMSSKDGPKTRKI  60

Query  1182  FVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGR  1003
             FVGGIPP+LTED+LKE+FSSYG VVEHQIMLDH TGRSRGFGFVTF+NEDAV++V+S+GR
Sbjct  61    FVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAVERVMSEGR  120

Query  1002  MHELNGKQVEIKRAEPKRAGGDRAS  928
             MH+L GKQVEIK+AEPK+ GG  +S
Sbjct  121   MHDLAGKQVEIKKAEPKKPGGGDSS  145


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSI------DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSV  1366
             H++DG +   E+K ++          P   K+FVGGI    +E+    +FS YG+V++  
Sbjct  31    HTIDGRTV--EVKRTVPREEMSSKDGPKTRKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQ  88

Query  1365  IMMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
             IM+D  +GR RGFGF+TF + +   RV+ E   H + G+ VE+K+  P++
Sbjct  89    IMLDHGTGRSRGFGFVTFENEDAVERVMSEGRMHDLAGKQVEIKKAEPKK  138



>ref|XP_003542187.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Glycine 
max]
Length=352

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 141/181 (78%), Gaps = 3/181 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ E F +YF KYGE+ DSVIM D+ +GRPRGFGFIT+A
Sbjct  10    HSGDGASP--GKIFIGGLAKDTTLETFVKYFEKYGEITDSVIMKDRHTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+QE HV++G+ VE+KRT+P+  +      KTKKIFVGGIP +++EDELK +F
Sbjct  68    DPSVVDQVIQENHVVNGKQVEIKRTIPKGSSQANDF-KTKKIFVGGIPTSVSEDELKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG VVEH+I+ DH T RSRGFGF+ FD+E  V  +L+DG M ++ G QVEIK+AEPK+
Sbjct  127   SKYGKVVEHEIIRDHTTKRSRGFGFIVFDSEKVVDNILADGNMIDMGGTQVEIKKAEPKK  186

Query  948   A  946
             +
Sbjct  187   S  187



>ref|XP_008358788.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=351

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 145/189 (77%), Gaps = 5/189 (3%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S+AGH   H+ D ++P  GK+F+GG+A +T+   F ++F KYGE++DSVIM D+ +G PR
Sbjct  5     SNAGHP--HTGDGASP--GKIFIGGLAKDTTNATFTKHFGKYGEIVDSVIMKDRFTGTPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLT  1153
             GFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP +++
Sbjct  61    GFGFITYADPSVVDTVIEETHVINGKQVEIKRTIPKGQGQSKDF-KTKKIFVGGIPSSVS  119

Query  1152  EDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVE  973
             EDELK +FS YG VVEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++ G QVE
Sbjct  120   EDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMEGTQVE  179

Query  972   IKRAEPKRA  946
             IK+AEPK+A
Sbjct  180   IKKAEPKKA  188



>gb|AFW86729.1| hypothetical protein ZEAMMB73_661369 [Zea mays]
Length=270

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 131/156 (84%), Gaps = 10/156 (6%)
 Frame = -2

Query  1338  PRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPRE----DTPFRRVSKTKKIFVGG  1171
             PRGFGF+TF+DP V +RVL++EHVIDGR VEVKRTVP+E    D P     KTKKIFVGG
Sbjct  2     PRGFGFVTFSDPSVLDRVLEDEHVIDGRTVEVKRTVPKELSSKDGP-----KTKKIFVGG  56

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             IPP+LTED+LKE+FSSYG VVEHQIMLDH+TGRSRGFGFVTF++EDAV++V+S+GRMH+L
Sbjct  57    IPPSLTEDKLKEHFSSYGKVVEHQIMLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDL  116

Query  990   NGKQVEIKRAEPKRAG-GDRASEGRMHRGNSNMHSY  886
              GKQVEIK+AEPK+ G GD +S GR  RG  +  SY
Sbjct  117   GGKQVEIKKAEPKKPGAGDSSSNGRHSRGGGHRDSY  152


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 9/109 (8%)
 Frame = -2

Query  1527  HSLDGSSAGHELKHSIDDST-----PSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVI  1363
             H +DG +   E+K ++         P   K+FVGGI    +E+    +FS YG+V++  I
Sbjct  24    HVIDGRTV--EVKRTVPKELSSKDGPKTKKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQI  81

Query  1362  MMDKVSGRPRGFGFITFADPEVANRVLQE--EHVIDGRVVEVKRTVPRE  1222
             M+D  +GR RGFGF+TF   +   RV+ E   H + G+ VE+K+  P++
Sbjct  82    MLDHSTGRSRGFGFVTFESEDAVERVMSEGRMHDLGGKQVEIKKAEPKK  130



>ref|XP_011038851.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Populus 
euphratica]
Length=348

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 156/217 (72%), Gaps = 6/217 (3%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+A +T+   FN++F KYGE+ DSVIM D+ +G+P
Sbjct  2     GSRSKIDNPHTGDGASP--GKIFIGGLAKDTTYATFNKHFGKYGEITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V ++V+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP ++
Sbjct  60    RGFGFITYADPSVVDKVIEDTHVINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSSV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE + +FS YG VVEHQI+ DH T RSRGFGF+ FD+E+ V ++LS+G M ++ G QV
Sbjct  119   TEDEFQNFFSKYGKVVEHQIIRDHETNRSRGFGFIIFDSEEVVDEMLSNGNMIDMAGTQV  178

Query  975   EIKRAEPKRAGG--DRASEGRMHRGNS-NMHSYGNVN  874
             EIK+AEPK+A       S G   RG S N  +YG  N
Sbjct  179   EIKKAEPKKASNPPSAPSYGSNTRGRSFNSDNYGGFN  215



>ref|XP_008366190.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Malus domestica]
Length=394

 Score =   221 bits (564),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 148/201 (74%), Gaps = 9/201 (4%)
 Frame = -2

Query  1539  EPPIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIM  1360
             E PI +  GS +     HS D ++P  GK+F+GG+A +T+   F ++F KYGE++DSVIM
Sbjct  36    ENPIPNAMGSKSNPGHPHSGDGASP--GKIFIGGLAKBTTYATFTKHFGKYGEIVDSVIM  93

Query  1359  MDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTK  1189
              D+ +G PRGFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+   +   FR    TK
Sbjct  94    KDRFTGTPRGFGFITYADPSVVDTVIEETHVINGKEVEIKRTIPKGQGQSKDFR----TK  149

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIFVGGIP +++EDELK +FS YG VVEHQI+ DH T RSRGFGFV FDNE+ V ++LS 
Sbjct  150   KIFVGGIPSSVSEDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDNEEVVDELLSK  209

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
             G M ++ G QVEIK+AEPK+A
Sbjct  210   GNMIDMAGTQVEIKKAEPKKA  230



>ref|XP_007020434.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY11959.1| RNA-binding family protein [Theobroma cacao]
Length=348

 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+   FN+YF+KYGE+IDSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  17    SPGKIFIGGLAKDTTFPQFNKYFAKYGEIIDSVIMKDRYTGQPRGFGFITYADPSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++E+H+I+G+ VE+KRT+P+  +  +   KTKKIFVGGIP ++TEDE + +FS+YG V+E
Sbjct  77    IEEDHIINGKQVEIKRTIPKGSSHSKDF-KTKKIFVGGIPSSVTEDEFRSFFSNYGKVME  135

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             HQI+ DH T RSRGFGF+ FD+E+ V  +LS G M ++ G QVEIK+AEPK+A
Sbjct  136   HQIIRDHATNRSRGFGFIIFDSEEVVDDLLSKGNMIDMAGTQVEIKKAEPKKA  188



>gb|KDP39313.1| hypothetical protein JCGZ_01070 [Jatropha curcas]
Length=347

 Score =   220 bits (560),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  E  HS D ++P  GK+F+GG+A +T+   FN++F KYGE+ DSVIM D+ +G+P
Sbjct  2     GSKSKSENPHSGDGASP--GKIFIGGLAKDTTYATFNKHFGKYGEITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V ++V+++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP ++
Sbjct  60    RGFGFITYADPSVVDQVIEDTHIINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSSV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE K +FS YG VVEHQI+ DH T RSRGFGF+ FD+E+ V ++LS G M ++ G QV
Sbjct  119   TEDEFKNFFSKYGKVVEHQIIRDHETNRSRGFGFIIFDSEEVVDEMLSKGNMIDMAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188



>gb|KHN10640.1| Heterogeneous nuclear ribonucleoprotein 27C [Glycine soja]
Length=352

 Score =   219 bits (559),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ E F +YF KYGE+ DSVIM D+ +GRPRGFGFIT+A
Sbjct  10    HSGDGASP--GKIFIGGLAKDTTLETFVKYFEKYGEITDSVIMKDRHTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+QE HV++G+ VE+KRT+P+  +      KTKKIFVGGIP  ++EDELK +F
Sbjct  68    DPSVVDQVIQENHVVNGKQVEIKRTIPKGSSQANDF-KTKKIFVGGIPTYVSEDELKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG VVEH+I+ DH T RSRGFGF+ FD+E  V  +L+DG M ++ G QVEIK+AEPK+
Sbjct  127   SKYGKVVEHEIIRDHTTKRSRGFGFIVFDSEKVVDNILADGNMIDMGGTQVEIKKAEPKK  186

Query  948   A  946
             +
Sbjct  187   S  187



>ref|XP_009615253.1| PREDICTED: RNA-binding protein squid [Nicotiana tomentosiformis]
Length=375

 Score =   220 bits (561),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 145/195 (74%), Gaps = 4/195 (2%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMD  1354
             P H  D    G    H+ D ++P  GK+F+GG+A ET+   F ++F KYGE+IDSVIM D
Sbjct  28    PDHQND--DVGASQPHTGDGASP--GKIFIGGLARETTSAQFVKHFGKYGEIIDSVIMKD  83

Query  1353  KVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVG  1174
             + +G+PRGFGF+T+ADP V +RV++E+HVI+G+ VE+KRT+PR      +  KTKKIFVG
Sbjct  84    RRTGQPRGFGFVTYADPSVVDRVIEEDHVINGKQVEIKRTIPRGGGSSSKDFKTKKIFVG  143

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             GIP T++EDE K++F  +G V EHQIM DH+TGRSRGFGF+TFD E +V+ +L++G   +
Sbjct  144   GIPTTVSEDEFKDFFLKFGEVNEHQIMRDHSTGRSRGFGFITFDAEKSVEDILANGNRLD  203

Query  993   LNGKQVEIKRAEPKR  949
               G QVEIK+AEPKR
Sbjct  204   FAGTQVEIKKAEPKR  218



>emb|CBI39777.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+A +T+   FN++F KYG++ DSVIM D+ +G+P
Sbjct  2     GSKSKSDNPHTGDGASP--GKIFIGGLAKDTTYATFNKHFGKYGDITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V +RV+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGG+P T+
Sbjct  60    RGFGFITYADPSVVDRVIEDTHVINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGVPSTV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE K +FS YG VVEHQI+ DH T RSRGFGF+ FD+E+ V +++S G M ++ G QV
Sbjct  119   TEDEFKNFFSKYGKVVEHQIIRDHETNRSRGFGFIIFDSEEVVDEMISKGNMIDMAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188


 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T     ++F  YG + +  IM D  TG+ RGFGF+T+ +   V +V+ D
Sbjct  20    KIFIGGLAKDTTYATFNKHFGKYGDITDSVIMKDRYTGQPRGFGFITYADPSVVDRVIED  79

Query  1008  GRMHELNGKQVEIKRAEPKRAG  943
                H +NGKQVEIKR  PK +G
Sbjct  80    --THVINGKQVEIKRTIPKGSG  99



>ref|XP_007146012.1| hypothetical protein PHAVU_006G005300g [Phaseolus vulgaris]
 gb|ESW18006.1| hypothetical protein PHAVU_006G005300g [Phaseolus vulgaris]
Length=353

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ E F +YF KYGE+ DSVIM D+ +GRPRGFGFIT+A
Sbjct  10    HSGDGASP--GKIFIGGLAKDTTLETFVKYFEKYGEITDSVIMKDRQTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+Q+ H+I+G+ VE+KRT+P+  +      KTKKIFVGGIP +++EDE K +F
Sbjct  68    DPSVVDQVIQDNHIINGKQVEIKRTIPKGSSQANDF-KTKKIFVGGIPTSVSEDEFKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S+YG VVEH+I+ DH T RSRGFGF+ FD+E  V  +L DG M ++ G QVEIK+AEPK+
Sbjct  127   SNYGKVVEHEIIRDHTTKRSRGFGFIVFDSEKVVDNILEDGSMIDMAGTQVEIKKAEPKK  186

Query  948   A  946
             +
Sbjct  187   S  187



>ref|XP_009367242.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009367243.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009334671.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=352

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 145/192 (76%), Gaps = 11/192 (6%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S+ GH   HS D ++P  GK+F+GG+A +T+   F ++F KYGE++DSVIM D+ +G PR
Sbjct  5     SNPGHP--HSGDGASP--GKIFIGGLAKDTTYATFTKHFGKYGEIVDSVIMKDRFTGTPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPP  1162
             GFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+   +   FR    TKKIFVGGIP 
Sbjct  61    GFGFITYADPSVVDTVIEETHVINGKEVEIKRTIPKGQGQSKDFR----TKKIFVGGIPS  116

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             +++EDELK +FS YG VVEHQI+ DH T RSRGFGFV FDNE+ V ++LS G M ++ G 
Sbjct  117   SVSEDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDNEEVVDELLSKGNMIDMAGT  176

Query  981   QVEIKRAEPKRA  946
             QVEIK+AEPK+A
Sbjct  177   QVEIKKAEPKKA  188



>ref|XP_010109275.1| Heterogeneous nuclear ribonucleoprotein 27C [Morus notabilis]
 gb|EXC21514.1| Heterogeneous nuclear ribonucleoprotein 27C [Morus notabilis]
Length=352

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  HS D ++P  GK+F+GG+A +T    FN++F KYGE++DSVIM D+ +G+P
Sbjct  2     GSKSKGDNPHSGDGASP--GKIFIGGLAKDTHYATFNKHFGKYGEIVDSVIMKDRFTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V + V+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP T+
Sbjct  60    RGFGFITYADPSVVDMVIEDTHVINGKQVEIKRTIPKGQGHTKDF-KTKKIFVGGIPSTV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDELK +FS YG VVEHQI+ DH T RSRGFGFV F++E+ V ++LS G M ++ G QV
Sbjct  119   TEDELKSFFSEYGKVVEHQIIHDHETNRSRGFGFVIFESEEVVDELLSKGNMVDIAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188



>ref|XP_008366191.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Malus domestica]
Length=352

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 11/192 (6%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S+ GH   HS D ++P  GK+F+GG A +T+   F ++F KYGE++DSVIM D+ +G PR
Sbjct  5     SNPGHS--HSGDGASP--GKIFIGGFAKDTTYATFTKHFGKYGEIVDSVIMKDRFTGTPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPP  1162
             GFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+   +   FR    TKKIFVGGIP 
Sbjct  61    GFGFITYADPSVVDTVIEETHVINGKEVEIKRTIPKGQGQSKDFR----TKKIFVGGIPS  116

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             +++EDELK +FS YG VVEHQI+ DH T RSRGFGFV FDNE+ V ++LS G M ++ G 
Sbjct  117   SVSEDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDNEEVVDELLSKGNMIDMAGT  176

Query  981   QVEIKRAEPKRA  946
             QVEIK+AEPK+A
Sbjct  177   QVEIKKAEPKKA  188



>ref|XP_002271592.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
 emb|CAN78130.1| hypothetical protein VITISV_036088 [Vitis vinifera]
Length=348

 Score =   218 bits (554),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+A +T+   FN++F KYG++ DSVIM D+ +G+P
Sbjct  2     GSKSKSDNPHTGDGASP--GKIFIGGLAKDTTYATFNKHFGKYGDITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V +RV+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGG+P T+
Sbjct  60    RGFGFITYADPSVVDRVIEDTHVINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGVPSTV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE K +FS YG VVEHQI+ DH T RSRGFGF+ FD+E+ V +++S G M ++ G QV
Sbjct  119   TEDEFKNFFSKYGKVVEHQIIRDHETNRSRGFGFIIFDSEEVVDEMISKGNMIDMAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T     ++F  YG + +  IM D  TG+ RGFGF+T+ +   V +V+ D
Sbjct  20    KIFIGGLAKDTTYATFNKHFGKYGDITDSVIMKDRYTGQPRGFGFITYADPSVVDRVIED  79

Query  1008  GRMHELNGKQVEIKRAEPKRAG  943
                H +NGKQVEIKR  PK +G
Sbjct  80    --THVINGKQVEIKRTIPKGSG  99



>emb|CBI28469.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 148/209 (71%), Gaps = 9/209 (4%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+FVGG+A ET+ + F +YF KYGE+ DSV+M D+ +GRPRGFGFIT+A
Sbjct  10    HSDDGASP--GKIFVGGLAKETNLDTFTKYFEKYGEITDSVVMKDRQTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V + V+QE H+I+G+ VE+KRT+PR  +      KT+KIFVGGI  +++EDE K +F
Sbjct  68    DPSVVDEVIQETHIINGKQVEIKRTIPRGSSQSNDF-KTRKIFVGGILTSVSEDEFKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG VVEH+I+ DH T RSRGFGF+ FDNE  V  +L++G M ++ G QVEIK+AEPK+
Sbjct  127   SKYGKVVEHEIIHDHVTKRSRGFGFIVFDNEQVVDDLLTNGNMIDMEGTQVEIKKAEPKK  186

Query  948   AGGD--RAS----EGRMHRGNSNMHSYGN  880
             +  +  RA     + RM   N     YG+
Sbjct  187   SSSNPGRAPSFGGDSRMQMYNDGFSGYGS  215



>emb|CBI18525.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS       H+ D ++P  GK+F+GG+A +T+   FN++F KYGE+ DSVIM D+ +G+P
Sbjct  2     GSKLKGNTTHTGDGASP--GKIFIGGLAKDTTYAAFNKHFEKYGEITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGF+T+ADP V + V+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGG+P T+
Sbjct  60    RGFGFVTYADPSVVDSVIEDTHVINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGLPSTV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE K++FS YG V EHQI+ DH T RSRGFGF+ F++E+ V ++LS+G M ++ G QV
Sbjct  119   TEDEFKDFFSKYGKVEEHQIIRDHETNRSRGFGFIIFESEEVVDEILSEGNMIDMAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T     ++F  YG + +  IM D  TG+ RGFGFVT+ +   V  V+ D
Sbjct  20    KIFIGGLAKDTTYAAFNKHFEKYGEITDSVIMKDRYTGQPRGFGFVTYADPSVVDSVIED  79

Query  1008  GRMHELNGKQVEIKRAEPKRAG  943
                H +NGKQVEIKR  PK +G
Sbjct  80    --THVINGKQVEIKRTIPKGSG  99



>ref|XP_007049396.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007049397.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007049398.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007049399.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX93553.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX93554.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX93555.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX93556.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=344

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  1479  DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPE  1300
             D+   S GK+F+GG+A +T+ + F +YF KYGE+ D VIM D+ +GRPRGFGFITFADP 
Sbjct  8     DNDGASPGKIFIGGLAKDTTLDTFTKYFEKYGEITDFVIMKDRHTGRPRGFGFITFADPS  67

Query  1299  VANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             V + V+QE+HVI+G+ VE+KRT+P+  +      KTKKIFVGGIP ++TEDE K +FS Y
Sbjct  68    VVDTVMQEDHVINGKQVEIKRTIPKGSSQSNDF-KTKKIFVGGIPTSVTEDEFKNFFSKY  126

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G VVEH+I+ DH T RSRGFGF+ FD+E  V  +L++G M ++ G QVEIK+AEPK+A
Sbjct  127   GKVVEHEIIRDHATKRSRGFGFIVFDSEKVVDNMLANGNMIDMEGTQVEIKKAEPKKA  184



>gb|KHG12728.1| hypothetical protein F383_19605 [Gossypium arboreum]
Length=337

 Score =   217 bits (552),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  1479  DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPE  1300
             D+   S GK+F+GG+A +T+ E F +YF KYGE+ D VIM D+ +GRPRGFGFITFADP 
Sbjct  8     DNDGASPGKIFIGGLAKDTTLETFTKYFEKYGEITDYVIMKDRHTGRPRGFGFITFADPS  67

Query  1299  VANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             V + V+QE+HVI+G+ VE+KRTVP+  +      KTKKIFVGGIP ++TEDE K +F  Y
Sbjct  68    VVDTVMQEDHVINGKQVEIKRTVPKGSSQSNDF-KTKKIFVGGIPTSVTEDEFKNFFLKY  126

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G VVEH+I+ DH T RSRGFGF+ FDNE  V  +L++G M ++ G +VEIK+AEPK++
Sbjct  127   GKVVEHEIICDHATKRSRGFGFIVFDNEKVVDNMLANGNMIDMEGTRVEIKKAEPKKS  184



>ref|XP_008218498.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Prunus 
mume]
Length=350

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 144/189 (76%), Gaps = 5/189 (3%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S+AGH   H+ D ++P  GK+F+GG+A +T+   F ++F KYGE++DSVIM D+ +G PR
Sbjct  5     SNAGHP--HTGDGASP--GKIFIGGLAKDTTYATFTKHFGKYGEIVDSVIMKDRFTGTPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLT  1153
             GFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP ++ 
Sbjct  61    GFGFITYADPSVVDTVIEETHVINGKQVEIKRTIPKGQGQSKDF-KTKKIFVGGIPSSVI  119

Query  1152  EDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVE  973
             E+E+K +FS YG VVEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++ G QVE
Sbjct  120   EEEMKSFFSKYGKVVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMAGTQVE  179

Query  972   IKRAEPKRA  946
             IK+AEPK+A
Sbjct  180   IKKAEPKKA  188



>ref|XP_004502113.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=350

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ E F +YF +YGE+ DSVIM D+ +GRPRGFGFIT+A
Sbjct  10    HSGDGASP--GKIFIGGLAKDTTLETFVKYFERYGEITDSVIMKDRHTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+QE H+I+ + VE+KRT+P+  +      KTKKIFVGGIP  ++EDELK +F
Sbjct  68    DPNVVDQVIQENHIINDKQVEIKRTIPKGSSQTNDF-KTKKIFVGGIPTAVSEDELKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S +G VVEH+I+ DH T RSRGFGFV FDN+  V  +L+DG M +++G QVEIK+AEPK+
Sbjct  127   SKHGKVVEHEIIRDHTTKRSRGFGFVVFDNDKVVDNLLADGNMIDMDGTQVEIKKAEPKK  186

Query  948   A  946
             +
Sbjct  187   S  187



>ref|XP_009772282.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nicotiana 
sylvestris]
Length=381

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 145/195 (74%), Gaps = 4/195 (2%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMD  1354
             P H  D    G    H+ D ++P  GK+F+GG+A ET+   F ++F KYGE+IDSVIM D
Sbjct  28    PDHQND--DVGASQPHTGDGASP--GKIFIGGLARETTSAQFVKHFGKYGEIIDSVIMKD  83

Query  1353  KVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVG  1174
             + +G+PRGFGF+T+ DP V ++V++E+H+I+G+ VE+KRT+PR      +  KTKKIFVG
Sbjct  84    RRTGQPRGFGFVTYLDPSVVDKVIEEDHIINGKQVEIKRTIPRGGGSSSKDFKTKKIFVG  143

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             GIP T++EDE K++F  +G V EHQIM DH+TGRSRGFGF+TFD+E +V+ +L++G   +
Sbjct  144   GIPTTVSEDEFKDFFLKFGEVNEHQIMRDHSTGRSRGFGFITFDSEKSVEDILANGNRLD  203

Query  993   LNGKQVEIKRAEPKR  949
               G QVEIK+AEPKR
Sbjct  204   FAGTQVEIKKAEPKR  218



>ref|XP_010061433.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 gb|KCW68379.1| hypothetical protein EUGRSUZ_F02033 [Eucalyptus grandis]
Length=346

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 136/173 (79%), Gaps = 1/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A + +   FN++F +YGE+ DSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  16    SPGKIFIGGLAKDVTYATFNKHFGQYGEITDSVIMKDRFTGQPRGFGFITYADPSVVDKV  75

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++EHV++G+ VE+KRT+P+     +   KTKKIFVGGIP T+TEDELK +FS YG VVE
Sbjct  76    IEDEHVLNGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSTVTEDELKNFFSKYGEVVE  134

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             HQI+ DH T RSRGFGF+ FD+E+ V  +LS G M E+ G +VEIK+AEPK+A
Sbjct  135   HQIIRDHETNRSRGFGFIIFDSEEVVDDMLSKGNMIEMAGTKVEIKKAEPKKA  187



>ref|XP_008384591.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Malus domestica]
Length=394

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 146/201 (73%), Gaps = 9/201 (4%)
 Frame = -2

Query  1539  EPPIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIM  1360
             E PI +  GS +     HS D ++P  GK+F+GG+A +T+   F ++  KYGE++DSVIM
Sbjct  36    ENPIPNAMGSKSNPGHPHSGDGASP--GKIFIGGLAKDTTYATFTKHXGKYGEIVDSVIM  93

Query  1359  MDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTK  1189
              D+ +G PRGFGFIT+ADP V + V++E HVI+G+ VE+KRT+P    +   FR    TK
Sbjct  94    KDRFTGTPRGFGFITYADPSVVDTVIEETHVINGKEVEIKRTIPXGQGQSKDFR----TK  149

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIFVGGIP +++EDELK +FS YG VVEHQI+ DH T RSRGFGFV FDNE+ V ++LS 
Sbjct  150   KIFVGGIPSSVSEDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDNEEVVDELLSK  209

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
             G M ++ G QVEIK+AEPK+A
Sbjct  210   GNMIDMAGTQVEIKKAEPKKA  230



>ref|XP_010934253.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=459

 Score =   219 bits (557),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 139/216 (64%), Gaps = 26/216 (12%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YFSKYGEV+ +VIM DK +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETTEEKMKEYFSKYGEVLQTVIMRDKTTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------------KTKKIFVGGIPPTLTE  1150
             + H IDGR VE KR + RE+    +                   +TKKIFVGG+PPTLTE
Sbjct  66    DSHTIDGRTVEAKRALSREEQQASKSGNPAVGRTGGGHVSGGNFRTKKIFVGGLPPTLTE  125

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             +  ++YF  YG V +  +M D NT R RGFGF++F +EDAV +VL     HELNGK VE+
Sbjct  126   EAFRQYFQGYGDVTDVVVMYDQNTQRPRGFGFISFSSEDAVDRVLHK-TFHELNGKLVEV  184

Query  969   KRAEPKRA----GGDRASEGRMHRGNS----NMHSY  886
             KRA PK A    GG R   G  ++ NS    NM SY
Sbjct  185   KRALPKDANPSSGGGRPVAGGPYQSNSASGVNMSSY  220



>ref|XP_007205326.1| hypothetical protein PRUPE_ppa006963mg [Prunus persica]
 gb|EMJ06525.1| hypothetical protein PRUPE_ppa006963mg [Prunus persica]
Length=388

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -2

Query  1539  EPPIHSLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIM  1360
             E PI +  GS +     H+ D ++P  GK+F+GG+A +T+   F ++F KYGE++DSVIM
Sbjct  32    ENPILNAMGSKSNAGHPHTGDGASP--GKIFIGGLAKDTTYATFAKHFGKYGEIVDSVIM  89

Query  1359  MDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIF  1180
              D+ +G PRGFGFIT+ADP V + V++E HVI+G+ VE+KRT+P+     +   KTKKIF
Sbjct  90    KDRFTGTPRGFGFITYADPSVVDTVIEETHVINGKQVEIKRTIPKGQGQSKDF-KTKKIF  148

Query  1179  VGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRM  1000
             VGGIP ++ E+E+K +FS YG VVEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M
Sbjct  149   VGGIPSSVIEEEMKSFFSKYGKVVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNM  208

Query  999   HELNGKQVEIKRAEPKRA  946
              ++ G QVEIK+AEPK+A
Sbjct  209   IDMAGTQVEIKKAEPKKA  226



>ref|XP_002522793.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
 gb|EEF39644.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
Length=348

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 141/181 (78%), Gaps = 3/181 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+   FN++F +YGE+ DSVIM D+ +G+PRGFGFIT+A
Sbjct  11    HSGDGASP--GKIFIGGLAKDTTYATFNKHFGRYGEITDSVIMKDRYTGQPRGFGFITYA  68

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+++ HVI G+ VE+KRT+P+     +   KTKKIFVGGIP ++TEDE K +F
Sbjct  69    DPSVVDKVIEDTHVIHGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSSVTEDEFKGFF  127

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG VVEHQI+ DH T RSRGFGF+ FD+E+ V ++LS+G M ++ G QVEIK+AEPK+
Sbjct  128   SKYGQVVEHQIIRDHETNRSRGFGFIIFDSEETVDEMLSNGNMIDMAGTQVEIKKAEPKK  187

Query  948   A  946
             A
Sbjct  188   A  188



>ref|XP_002267309.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=360

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 148/209 (71%), Gaps = 9/209 (4%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+FVGG+A ET+ + F +YF KYGE+ DSV+M D+ +GRPRGFGFIT+A
Sbjct  10    HSDDGASP--GKIFVGGLAKETNLDTFTKYFEKYGEITDSVVMKDRQTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V + V+QE H+I+G+ VE+KRT+PR  +      KT+KIFVGGI  +++EDE K +F
Sbjct  68    DPSVVDEVIQETHIINGKQVEIKRTIPRGSSQSNDF-KTRKIFVGGILTSVSEDEFKNFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG VVEH+I+ DH T RSRGFGF+ FDNE  V  +L++G M ++ G QVEIK+AEPK+
Sbjct  127   SKYGKVVEHEIIHDHVTKRSRGFGFIVFDNEQVVDDLLTNGNMIDMEGTQVEIKKAEPKK  186

Query  948   AGGD--RAS----EGRMHRGNSNMHSYGN  880
             +  +  RA     + RM   N     YG+
Sbjct  187   SSSNPGRAPSFGGDSRMQMYNDGFSGYGS  215



>ref|XP_008384592.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Malus domestica]
Length=352

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 143/192 (74%), Gaps = 11/192 (6%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S+ GH   HS D ++P  GK+F+GG+A +T+   F ++  KYGE++DSVIM D+ +G PR
Sbjct  5     SNPGHS--HSGDGASP--GKIFIGGLAKDTTYATFTKHXGKYGEIVDSVIMKDRFTGTPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPP  1162
             GFGFIT+ADP V + V++E HVI+G+ VE+KRT+P    +   FR    TKKIFVGGIP 
Sbjct  61    GFGFITYADPSVVDTVIEETHVINGKEVEIKRTIPXGQGQSKDFR----TKKIFVGGIPS  116

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             +++EDELK +FS YG VVEHQI+ DH T RSRGFGFV FDNE+ V ++LS G M ++ G 
Sbjct  117   SVSEDELKSFFSEYGKVVEHQIIRDHETNRSRGFGFVIFDNEEVVDELLSKGNMIDMAGT  176

Query  981   QVEIKRAEPKRA  946
             QVEIK+AEPK+A
Sbjct  177   QVEIKKAEPKKA  188



>ref|XP_008229783.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
Length=355

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 150/211 (71%), Gaps = 14/211 (7%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ + F +YF+KYGE+IDSVIM D+ +GRPRGFGFIT+A
Sbjct  11    HSGDGASP--GKIFIGGLAKDTTLDTFVKYFAKYGEIIDSVIMKDRQTGRPRGFGFITYA  68

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELK  1138
             DP V ++V++E HVI+ + VE+KRT+P+   +   F    KTKKIFVGGIP T+TEDE K
Sbjct  69    DPLVVDQVMEETHVINDKQVEIKRTIPKGSGQGNDF----KTKKIFVGGIPTTVTEDEFK  124

Query  1137  EYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAE  958
              +FS +G VVEH+I+ DH T RSRGFGFV FDNE  V  VL++G   ++ G QVEIK+AE
Sbjct  125   SFFSQFGKVVEHEIIRDHVTKRSRGFGFVVFDNEKVVDNVLANGNRIDMAGTQVEIKKAE  184

Query  957   PKRAGGDR-----ASEGRMHRGNSNMHSYGN  880
             PK+A          S+ R H  N +   +G+
Sbjct  185   PKKASNPAHVPAFGSDSRAHPYNDSFGGFGD  215



>ref|XP_010252818.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nelumbo 
nucifera]
Length=360

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -2

Query  1524  SLDGSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVS  1345
             SL+  S   + +H+ + ++P  GK+F+GG+A +TS   F +YF KYGE+ DSVIM D+ +
Sbjct  9     SLENDSKPSDGQHTGEGASP--GKIFIGGLAKDTSLATFTKYFGKYGEITDSVIMKDRYT  66

Query  1344  GRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIP  1165
             G+PRGFGFIT+ADP V ++V++E HVI+G+ VE+KRT+P+     +   KTKKIFVGG+P
Sbjct  67    GQPRGFGFITYADPSVVDKVIEETHVINGKQVEIKRTIPKGSVQSKDF-KTKKIFVGGVP  125

Query  1164  PTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNG  985
              T+TEDE K +FS YG VV+HQI+ DH T RSRGFGF+ FD E  V  +LS G M ++ G
Sbjct  126   TTVTEDEFKNFFSKYGKVVDHQIIRDHATNRSRGFGFIIFDIEQVVDDILSKGNMIDMAG  185

Query  984   KQVEIKRAEPKR  949
              +VEIK+AEPK+
Sbjct  186   TKVEIKKAEPKK  197



>ref|XP_011091261.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Sesamum 
indicum]
Length=404

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF  YGEV+ +V+M DK+SG+PRGFGF+ FADP + + VLQ
Sbjct  6     GKLFIGGISWETNEEKLKEYFQGYGEVVQAVVMRDKISGKPRGFGFVVFADPNILDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             + HVIDGR VE KR + RE+    RV              ++TKKIFVGG+PPTL+ED  
Sbjct  66    DRHVIDGRTVEAKRALSREEQQVSRVGNSGGARNFGGGGSTRTKKIFVGGLPPTLSEDGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF +YG V +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KRA
Sbjct  126   RQYFEAYGMVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLQK-TFHDLNGKQVEVKRA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>emb|CDP14410.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   214 bits (545),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+ + F +YF  YGE+ DSVIM D+ +GRPRGFGFIT+ADP V + V
Sbjct  13    SPGKIFIGGLAKDTTLDQFVKYFGNYGEITDSVIMKDRSTGRPRGFGFITYADPAVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+G+ VE+KRT+P+  +  R   KTKKIFVGGIP ++ EDELK +FS YG VVE
Sbjct  73    IAETHIINGKQVEIKRTIPKGSSESRDF-KTKKIFVGGIPTSVNEDELKSFFSKYGKVVE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH T RSRGFGFV FDNE  V  +LSDG M ++ G QVEIK+AEPK+
Sbjct  132   HEIIRDHVTKRSRGFGFVVFDNEQVVDSLLSDGNMIDMAGTQVEIKKAEPKK  183



>ref|XP_002277226.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=348

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS       H+ D ++P  GK+F+GG+A +T+   FN++F KYGE+ DSVIM D+ +G+P
Sbjct  2     GSKLKGNTTHTGDGASP--GKIFIGGLAKDTTYAAFNKHFEKYGEITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGF+T+ADP V + V+++ HVI+G+ VE+KRT+P+     +   KTKKIFVGG+P T+
Sbjct  60    RGFGFVTYADPSVVDSVIEDTHVINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGLPSTV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             TEDE K++FS YG V EHQI+ DH T RSRGFGF+ F++E+ V ++LS+G M ++ G QV
Sbjct  119   TEDEFKDFFSKYGKVEEHQIIRDHETNRSRGFGFIIFESEEVVDEILSEGNMIDMAGTQV  178

Query  975   EIKRAEPKRA  946
             EIK+AEPK+A
Sbjct  179   EIKKAEPKKA  188


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T     ++F  YG + +  IM D  TG+ RGFGFVT+ +   V  V+ D
Sbjct  20    KIFIGGLAKDTTYAAFNKHFEKYGEITDSVIMKDRYTGQPRGFGFVTYADPSVVDSVIED  79

Query  1008  GRMHELNGKQVEIKRAEPKRAG  943
                H +NGKQVEIKR  PK +G
Sbjct  80    --THVINGKQVEIKRTIPKGSG  99



>gb|KHG09084.1| Nuclear polyadenylated RNA-binding 4 [Gossypium arboreum]
Length=336

 Score =   214 bits (544),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  1491  KHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITF  1312
             + S D+   S GK+F+GG+A +T+ E F +YF KYG++ D VIM D+ +GRPRGFGFITF
Sbjct  4     RRSNDNDGASPGKIFIGGLARDTTSETFIKYFEKYGDITDFVIMKDRHTGRPRGFGFITF  63

Query  1311  ADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEY  1132
             ADP V + V+Q++HVI+G+ VE+KRT+P+  +    + KTKK+FVGGI  ++TEDE K +
Sbjct  64    ADPSVVDTVMQKDHVINGKQVEIKRTIPKGSSQSNDI-KTKKLFVGGILTSVTEDEFKNF  122

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             FS YG VVEH+I+ DH T RSRGFGF+ FD+E+ V  +L++G + ++ G QVEIK+AEPK
Sbjct  123   FSKYGEVVEHEIIRDHATKRSRGFGFIVFDSEEVVDNMLANGNLIDMEGTQVEIKKAEPK  182

Query  951   RAGGDRASEGRMHRGNSNMHSY  886
             RA     + G  +   SN+ SY
Sbjct  183   RA--SNPAPGPGYGRESNIRSY  202



>ref|XP_011091262.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011091263.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Sesamum indicum]
Length=404

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF  YGEV+ +V+M DK+SG+PRGFGF+ FADP + + VLQ
Sbjct  6     GKLFIGGISWETNEEKLKEYFQGYGEVVQAVVMRDKISGKPRGFGFVVFADPNILDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             + HVIDGR VE KR + RE+    RV              ++TKKIFVGG+PPTL+ED  
Sbjct  66    DRHVIDGRTVEAKRALSREEQQVSRVGNSGGARNFGGGGSTRTKKIFVGGLPPTLSEDGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF +YG V +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KRA
Sbjct  126   RQYFEAYGMVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLHK-TFHDLNGKQVEVKRA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>ref|XP_007215611.1| hypothetical protein PRUPE_ppa007812mg [Prunus persica]
 gb|EMJ16810.1| hypothetical protein PRUPE_ppa007812mg [Prunus persica]
Length=355

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 148/211 (70%), Gaps = 14/211 (7%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ + F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+A
Sbjct  11    HSGDGASP--GKIFIGGLAKDTTLDTFVKYFEKYGEIIDSVIMKDRQTGRPRGFGFITYA  68

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELK  1138
             DP V ++V++E HVI+ + VE+KRT+P+   +   F    KTKKIFVGGIP T+TEDE K
Sbjct  69    DPSVVDQVMEETHVINDKQVEIKRTIPKGSGQGNDF----KTKKIFVGGIPTTVTEDEFK  124

Query  1137  EYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAE  958
              +FS +G VVEH+I+ DH T RSRGFGFV FDNE  V  VL++G   ++ G QVEIK+A 
Sbjct  125   SFFSQFGKVVEHEIIRDHVTKRSRGFGFVVFDNEKVVDNVLANGNRIDMAGTQVEIKKAS  184

Query  957   PKRAGGDR-----ASEGRMHRGNSNMHSYGN  880
             PK+A          S+ R H  N +   +G+
Sbjct  185   PKKASNPAHVPAFGSDSRAHPYNDSFGGFGD  215



>gb|KDO54113.1| hypothetical protein CISIN_1g035855mg [Citrus sinensis]
Length=456

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YFS+YG+V+ +V+M +K +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETSEERLREYFSQYGDVLQTVVMREKTTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H +DGR VE KR + RE+  F   S               +TKKIFVGG+PPTLTED 
Sbjct  66    DKHSLDGRTVEAKRAMSREEQQFSARSGNTNSGRSNGGGGTIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDTEDAVDRVLQK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_002300392.2| hypothetical protein POPTR_0001s37920g [Populus trichocarpa]
 gb|EEE85197.2| hypothetical protein POPTR_0001s37920g [Populus trichocarpa]
Length=349

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+A +T+   FN++F KYGE+ DSVIM D+ +G+P
Sbjct  2     GSRSKIDNPHTGDGASP--GKIFIGGLAKDTTYATFNKHFGKYGEITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRV-VEVKRTVPREDTPFRRVSKTKKIFVGGIPPT  1159
             RGFGFIT+ADP V ++V+++ HVI+G+  VE+KRT+P+     +   KTKKIFVGGIP +
Sbjct  60    RGFGFITYADPSVVDKVIEDTHVINGKQQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSS  118

Query  1158  LTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQ  979
             +TEDE + +FS +G VVEHQI+ DH T RSRGFGF+ FD+E+ V ++LS+G M ++ G Q
Sbjct  119   VTEDEFQNFFSKHGKVVEHQIIRDHETNRSRGFGFIIFDSEEVVDEMLSNGNMIDMAGTQ  178

Query  978   VEIKRAEPKRAGGDRA--SEGRMHRGNS-NMHSYGNVN  874
             VEIK+AEPK+A    +  S G   RG S N  +YG  N
Sbjct  179   VEIKKAEPKKASNPPSAPSYGSNTRGRSFNSDNYGGFN  216



>ref|XP_006489648.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
Length=456

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YFS+YG+V+ +V+M +K +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETSEERLREYFSQYGDVLQTVVMREKTTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H +DGR VE KR + RE+  F   S               +TKKIFVGG+PPTLTED 
Sbjct  66    DKHSLDGRTVEAKRAMSREEQQFSARSGNTNSGRSNGGGGTIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDTEDAVDRVLQK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_006420325.1| hypothetical protein CICLE_v10004941mg [Citrus clementina]
 gb|ESR33565.1| hypothetical protein CICLE_v10004941mg [Citrus clementina]
Length=456

 Score =   216 bits (550),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YFS+YG+V+ +V+M +K +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETSEERLREYFSQYGDVLQTVVMREKTTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H +DGR VE KR + RE+  F   S               +TKKIFVGG+PPTLTED 
Sbjct  66    DKHSLDGRTVEAKRAMSREEQQFSARSGNTNSGRSNGGGGTIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDTEDAVDRVLQK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_009763753.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=473

 Score =   216 bits (551),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 131/185 (71%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF  YG+V+ +V+M DK+SG+PRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETSEEKLKEYFQGYGDVLQTVVMRDKISGKPRGFGFVVFADPNVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             +EHVIDGR V+ KR + RE+    +               ++TKKIFVGG+PPTL ED  
Sbjct  66    DEHVIDGRTVDAKRALSREEQQGSKSGNANSARNFGGGGNTRTKKIFVGGLPPTLAEDGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF ++GSV +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KRA
Sbjct  126   RQYFEAFGSVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLQK-TFHDLNGKQVEVKRA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>ref|XP_004294926.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Fragaria 
vesca subsp. vesca]
Length=353

 Score =   213 bits (542),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 142/191 (74%), Gaps = 9/191 (5%)
 Frame = -2

Query  1509  SAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRG  1330
             S  H   HS D ++P  GK+F+GG+A + +   F ++F KYGE++DSVIM D+ +G PRG
Sbjct  3     SKSHGGPHSGDGASP--GKIFIGGLAKDATYATFTKHFGKYGEIVDSVIMKDRFTGTPRG  60

Query  1329  FGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPT  1159
             FGFIT+ADP V ++V+++ HVI+G+ VE+KRT+P+   +   FR    TKKIFVGGIP  
Sbjct  61    FGFITYADPSVVDKVIEDTHVINGKQVEIKRTIPKGQGQSKDFR----TKKIFVGGIPSA  116

Query  1158  LTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQ  979
             ++E+ELK +FS YG VVEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++ G Q
Sbjct  117   VSEEELKSFFSKYGEVVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMEGTQ  176

Query  978   VEIKRAEPKRA  946
             VEIK+AEPK++
Sbjct  177   VEIKKAEPKKS  187



>ref|XP_011029769.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=458

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF++YG+V+ +V+M DK +GRPRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETSEEKLGEYFTQYGDVLQTVVMKDKTTGRPRGFGFVVFADPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             + H IDGR VE KR + RE+           P R  S     +TKKIFVGG+PPTLT+D 
Sbjct  66    DTHTIDGRTVEAKRALSREEQQTNARAGNLNPARNTSSGGNIRTKKIFVGGLPPTLTDDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF ++G V +  IM D +T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAFGLVTDVVIMYDQSTQRPRGFGFISFDSEDAVDRVLQR-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKEA  190



>ref|XP_004296398.1| PREDICTED: uncharacterized protein LOC101310107 [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DK++ RPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKITQRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             E+H IDGR VE KR + RE+           P R V      +TKKIFVGG+PPTL E+E
Sbjct  66    EKHTIDGRTVEAKRALSREEQQTSVRAGNPNPGRNVGSGGNVRTKKIFVGGLPPTLNEEE  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D NTGR RGFGF++FD EDAV +VL     H+L+GKQVE+KR
Sbjct  126   FREYFEAYGHVTDVVVMFDQNTGRPRGFGFISFDTEDAVDRVLHK-TFHDLSGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_002455956.1| hypothetical protein SORBIDRAFT_03g027920 [Sorghum bicolor]
 gb|EES01076.1| hypothetical protein SORBIDRAFT_03g027920 [Sorghum bicolor]
Length=349

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 137/179 (77%), Gaps = 4/179 (2%)
 Frame = -2

Query  1482  IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADP  1303
             +D ++P+  K+F+GG++ +TS   F  +F KYG++ID+VIM D+ + +PRGFGFITFADP
Sbjct  8     LDGASPA--KIFIGGLSKDTSMSTFKEHFGKYGDIIDAVIMKDRYTQKPRGFGFITFADP  65

Query  1302  EVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSS  1123
              V +RV+++EHVI+G++VE+KRT+P+   P +   KTKKIFVGG+P  L EDE KE+FS 
Sbjct  66    AVVDRVIEDEHVINGKLVEIKRTIPKGAAPLKDF-KTKKIFVGGLPSALKEDEFKEFFSK  124

Query  1122  YGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS-DGRMHELNGKQVEIKRAEPKR  949
             +G VVEH+I+ DH T RSRGFGF+ FD E  V  +L+  G M +LNG QVEIK+AEPK+
Sbjct  125   FGKVVEHEIIRDHTTNRSRGFGFIVFDAEKTVDDLLAKKGNMIDLNGSQVEIKKAEPKK  183


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    +    KE+F  YG +++  IM D  T + RGFGF+TF +   V +V+ D
Sbjct  15    KIFIGGLSKDTSMSTFKEHFGKYGDIIDAVIMKDRYTQKPRGFGFITFADPAVVDRVIED  74

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
                H +NGK VEIKR  PK A
Sbjct  75    --EHVINGKLVEIKRTIPKGA  93



>ref|NP_683559.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAB03120.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL85976.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67536.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94504.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75315.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=358

 Score =   213 bits (541),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G+PRGFGFITFADP V ++V
Sbjct  17    SPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPR-EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVV  1108
             +++ HVI+G+ VE+KRT+P+       +  KTKKIFVGGIP T+TEDELK++F+ YG+VV
Sbjct  77    IEDTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVV  136

Query  1107  EHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA-GGDRA  931
             EHQ++ DH T RSRGFGFV FD+E+ V ++LS G M ++   QVEIK+AEPK++      
Sbjct  137   EHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPP  196

Query  930   SEGRMHRGNSNMHSYGN  880
             S G   RG S+  SY +
Sbjct  197   SYGSHPRGRSSNDSYAS  213



>ref|XP_009625541.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   216 bits (549),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 131/185 (71%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF  YG+V+ +V+M DK+SG+PRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETSEEKLKDYFQGYGDVLQTVVMRDKISGKPRGFGFVVFADPNVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             +EHVIDGR V+ KR + RE+    +               ++TKKIFVGG+PPTL ED  
Sbjct  66    DEHVIDGRTVDAKRALSREEQQGSKSGNANSARNFGGGGNTRTKKIFVGGLPPTLAEDGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF ++GSV +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KRA
Sbjct  126   RQYFEAFGSVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLQK-TFHDLNGKQVEVKRA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>ref|XP_006338617.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum tuberosum]
Length=389

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+IDSVIM ++ +G+PRGFGF+T+ADP V ++V
Sbjct  46    SPGKIFIGGLARETTSAQFVKHFGKYGEIIDSVIMKERRTGQPRGFGFVTYADPSVVDKV  105

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++++HVI+G+ VE+KRT+PR      +  KTKKIFVGGIP T++EDE +++F  +G V E
Sbjct  106   IEDDHVINGKQVEIKRTIPRGGGSSSKDFKTKKIFVGGIPTTISEDEFRDFFLKFGEVKE  165

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             HQIM DH+T RSRGFGF+TFD E +V+ +L++G   + +G QVEIK+AEPKR
Sbjct  166   HQIMRDHSTSRSRGFGFITFDTEKSVEDILANGNKLDFSGTQVEIKKAEPKR  217


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 7/103 (7%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGGI    SE+ F  +F K+GEV +  IM D  + R RGFGFITF   +    +L  
Sbjct  138   KIFVGGIPTTISEDEFRDFFLKFGEVKEHQIMRDHSTSRSRGFGFITFDTEKSVEDILAN  197

Query  1275  EHVID--GRVVEVKRTVPR-----EDTPFRRVSKTKKIFVGGI  1168
              + +D  G  VE+K+  P+     +  PFRR    +  F GG+
Sbjct  198   GNKLDFSGTQVEIKKAEPKRPNAPQPAPFRRQGNPRAAFGGGL  240



>ref|XP_009358003.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=467

 Score =   215 bits (548),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DKVSGRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKVSGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTSGRVGNANPTRSAGSGGNVRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF SYG V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFESYGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_004231850.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=389

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+IDSVIM ++ +G+PRGFGF+T+ADP V ++V
Sbjct  46    SPGKIFIGGLARETTSAQFVKHFGKYGEIIDSVIMKERRTGQPRGFGFVTYADPSVVDKV  105

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++++HVI+G+ VE+KRT+PR      +  KTKKIFVGGIP T++EDE +++F  +G V E
Sbjct  106   IEDDHVINGKQVEIKRTIPRGGGSSSKDFKTKKIFVGGIPTTISEDEFRDFFLKFGEVKE  165

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             HQIM DH+T RSRGFGF+TFD E +V+ +L++G   + +G QVEIK+AEPKR
Sbjct  166   HQIMRDHSTSRSRGFGFITFDTEKSVEDILANGNKLDFSGTQVEIKKAEPKR  217


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 7/103 (7%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGGI    SE+ F  +F K+GEV +  IM D  + R RGFGFITF   +    +L  
Sbjct  138   KIFVGGIPTTISEDEFRDFFLKFGEVKEHQIMRDHSTSRSRGFGFITFDTEKSVEDILAN  197

Query  1275  EHVID--GRVVEVKRTVPR-----EDTPFRRVSKTKKIFVGGI  1168
              + +D  G  VE+K+  P+     +  PFRR    +  F GG 
Sbjct  198   GNKLDFSGTQVEIKKAEPKRPNAPQPAPFRRQGNPRAAFGGGF  240



>ref|XP_006407249.1| hypothetical protein EUTSA_v10021050mg [Eutrema salsugineum]
 gb|ESQ48702.1| hypothetical protein EUTSA_v10021050mg [Eutrema salsugineum]
Length=348

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  17    SPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITYADPSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPR-----EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             +++ H+I+G+ VE+KRT+P+     +   F    KTKKIFVGGIP T+TEDELK++F+ Y
Sbjct  77    IEDTHIINGKQVEIKRTIPKGAGGNQSKDF----KTKKIFVGGIPSTVTEDELKDFFAKY  132

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G++VEHQI+ DH T RSRGFGFV FD+E+ V ++LS G+M ++   QVEIK+AEPK++
Sbjct  133   GTIVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGKMIDMADTQVEIKKAEPKKS  190



>ref|XP_006378320.1| hypothetical protein POPTR_0010s07790g [Populus trichocarpa]
 gb|ERP56117.1| hypothetical protein POPTR_0010s07790g [Populus trichocarpa]
Length=459

 Score =   214 bits (546),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF +YG+V+ +V+M DK +GRPRGFGF+ FADP V + VLQ
Sbjct  6     GKLFIGGISWETSEEKLRDYFGQYGDVLQAVVMKDKTTGRPRGFGFVVFADPAVLDMVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR+VE KR + RE+           P R  S     +TKKIFVGG+PPTLTED 
Sbjct  66    DKHTIDGRMVEAKRALSREEQQTNARAGNLNPARNTSGGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF ++G V +  IM D +T R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAFGFVADVVIMYDQSTQRPRGFGFISFDTEDAVDRVLQR-SFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKEA  190



>ref|XP_011089468.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Sesamum 
indicum]
Length=344

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+ + F +YF KYGE+ DSVIM D+ +GRPRGFGFIT+ADP V + V
Sbjct  13    SPGKIFIGGLAKDTTLDTFVKYFGKYGEITDSVIMKDRHTGRPRGFGFITYADPSVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP  +TEDE K +FS YG VVE
Sbjct  73    IAETHVINGKQVEIKRTIPKGAGDSKDF-KTKKIFVGGIPTAVTEDEFKTFFSKYGKVVE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH T RSRGFGF+ FD+E  V  +L+DG M ++ G QVEIK+AEPK+
Sbjct  132   HEIIRDHVTKRSRGFGFIVFDSEQVVDSLLADGNMIDMAGTQVEIKKAEPKK  183



>ref|XP_008660278.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Zea 
mays]
 tpg|DAA46949.1| TPA: hypothetical protein ZEAMMB73_935024 [Zea mays]
Length=348

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = -2

Query  1482  IDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADP  1303
             +D ++P+  K+F+GG++ +TS   F  +F KYG++ID+VIM D+ + +PRGFGFITFADP
Sbjct  8     LDGASPA--KIFIGGLSKDTSMSTFKEHFGKYGDIIDAVIMKDRYTQKPRGFGFITFADP  65

Query  1302  EVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSS  1123
              V +RV+++EHVI+G+ VE+KRT+P+   P +   KTKKIFVGG+P  L EDE KE+FS 
Sbjct  66    TVVDRVIEDEHVINGKPVEIKRTIPKGAAPLKDF-KTKKIFVGGLPSALKEDEFKEFFSK  124

Query  1122  YGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVL-SDGRMHELNGKQVEIKRAEPKR  949
             +G VVEH+I+ DH T RSRGFGF+ FD E AV  +L   G M +LNG QVEIK+AEPK+
Sbjct  125   FGKVVEHEIIRDHATNRSRGFGFIVFDAEKAVDDLLHKKGNMIDLNGSQVEIKKAEPKK  183


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    +    KE+F  YG +++  IM D  T + RGFGF+TF +   V +V+ D
Sbjct  15    KIFIGGLSKDTSMSTFKEHFGKYGDIIDAVIMKDRYTQKPRGFGFITFADPTVVDRVIED  74

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
                H +NGK VEIKR  PK A
Sbjct  75    --EHVINGKPVEIKRTIPKGA  93



>ref|XP_004247759.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=475

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF  YG+V+ +V+M DK+SG+PRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETTEEKLKEYFQGYGDVLQTVVMRDKISGKPRGFGFVVFADPNVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             +EHVIDGR V+ KR + RE+    +               ++TKKIFVGG+PPTLTE+  
Sbjct  66    DEHVIDGRTVDAKRALSREEQQGSKSGNTNSARNFGGGGNTRTKKIFVGGLPPTLTEEGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF S+G+V +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+K+A
Sbjct  126   RQYFESFGNVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLQK-PFHDLNGKQVEVKKA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>ref|XP_006354447.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum tuberosum]
Length=475

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF  YG+V+ +V+M DK+SG+PRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETTEEKLKEYFQGYGDVLQTVVMRDKISGKPRGFGFVVFADPNVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             +EHVIDGR V+ KR + RE+    +               ++TKKIFVGG+PPTLTE+  
Sbjct  66    DEHVIDGRTVDAKRALSREEQQGSKSGNTNSARNFGGGGNTRTKKIFVGGLPPTLTEEGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF S+G+V +  IM D  T R RGFGF++FD+EDAV +VL     H+LNGKQVE+K+A
Sbjct  126   RQYFESFGNVTDVVIMYDQQTNRPRGFGFISFDSEDAVDRVLQK-PFHDLNGKQVEVKKA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKDA  189



>ref|XP_010262417.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nelumbo 
nucifera]
Length=461

 Score =   214 bits (544),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 127/185 (69%), Gaps = 15/185 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLFVGGI+W+TSEE    YF  YGEV+ +VIM DKV+GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFVGGISWDTSEEKLKEYFGNYGEVVQTVIMRDKVTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS--------------KTKKIFVGGIPPTLTEDEL  1141
             ++H IDGR VE KR + RE+    R                KTKKIFVGG+PPTLTE+  
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTSRSGNPNAGRNLGGAGNIKTKKIFVGGLPPTLTEEGF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             ++YF +YG V +  +M D  T R RGFGF++FD E+AV +VL     HELNGK VE+KRA
Sbjct  126   RQYFETYGHVTDVVVMYDQTTQRPRGFGFISFDTEEAVDRVLHK-TFHELNGKLVEVKRA  184

Query  960   EPKRA  946
              PK A
Sbjct  185   LPKEA  189



>ref|XP_007215536.1| hypothetical protein PRUPE_ppa007179mg [Prunus persica]
 gb|EMJ16735.1| hypothetical protein PRUPE_ppa007179mg [Prunus persica]
Length=379

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 136/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             H+ D ++P  GK+F+GG+A ET+   F ++F KYGE+IDSVIM D+ +G+PRGFGF+T+A
Sbjct  36    HTGDGASP--GKIFIGGLARETTTAQFIKHFGKYGEIIDSVIMKDRKTGQPRGFGFVTYA  93

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+ E HVI+G+ VE+KRT+PR     +   KTKKIFVGGIP T+ EDE  ++F
Sbjct  94    DPSVVDKVIDETHVINGKQVEIKRTIPRGAMGSKDF-KTKKIFVGGIPTTVNEDEFSDFF  152

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S +G V EHQIM DH+TGRSRGFGF+TFD E +V ++L  G   E  G QVEIK+AEPK+
Sbjct  153   SQFGEVKEHQIMRDHSTGRSRGFGFITFDTEQSVDELLDKGNKLEFAGAQVEIKKAEPKK  212



>ref|XP_008351334.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=467

 Score =   214 bits (544),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DK+SGRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKISGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DQHTIDGRTVEAKRALSREEQQTTGRVGNANPTRSAGSGGNVRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFEAYGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|KEH24789.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=383

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 9/219 (4%)
 Frame = -2

Query  1500  HELKH----SIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             HE +H    S+     S GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ +G+PR
Sbjct  27    HEQQHHNSQSLTGDGASPGKIFIGGLARETTIAQFIKHFGKYGEITDSVIMKDRKTGQPR  86

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLT  1153
             GFGFIT+ADP V ++V+++ H+I+ + VE+KRT+PR     +   +TKKIFVGGIP  +T
Sbjct  87    GFGFITYADPSVVDKVIEDSHIINSKQVEIKRTIPRGAVGSKDF-RTKKIFVGGIPSNVT  145

Query  1152  EDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVE  973
             EDE +++F+ YG V +HQIM DH+T RSRGFGFVTFD E+AV  +LS G   E  G QVE
Sbjct  146   EDEFRDFFTRYGEVKDHQIMRDHSTNRSRGFGFVTFDTEEAVDDLLSMGNKIEFAGTQVE  205

Query  972   IKRAEPKRAGGDRASEGRMHRGNSNMHSYGNVN-GDAED  859
             IK+AEPK+A     S  R    N +  SYG+   GDA D
Sbjct  206   IKKAEPKKANAPPPSSKRY---NDSRSSYGSGGYGDAYD  241



>ref|XP_002528377.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF34049.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=470

 Score =   214 bits (544),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+E+    YF +YG+V+ +V+M DK +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETTEDKLKDYFVQYGDVVQTVVMRDKTTGRPRGFGFVVFADPNILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE K+ + RE+           P R        +TKKIFVGG+PP LT+DE
Sbjct  66    DKHTIDGRTVEAKKALSREEQQTNARSGNLNPPRNSGSGGNIRTKKIFVGGLPPALTDDE  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FDNEDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGLVTDVVIMYDQNTQRPRGFGFISFDNEDAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_011041422.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=456

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF +YG+V+ +V+M DK +GRPRGFGF+ FADP V + VLQ
Sbjct  6     GKLFIGGISWETSEEKLRDYFGQYGDVLQAVVMKDKTTGRPRGFGFVVFADPAVLDMVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR+VE KR + RE+           P R  S     +TKKIFVGG+PPTLTED 
Sbjct  66    DKHTIDGRMVEAKRALSREEQQTNARAGSLNPARNTSGGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF ++G V +  IM D +T R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAFGFVTDVVIMYDQSTQRPRGFGFISFDTEDAVDRVLQR-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKEA  190



>emb|CDO99280.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 131/187 (70%), Gaps = 17/187 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF KYG+V+ +V+M DKVSG+PRGFGF+ FADP + + VLQ
Sbjct  6     GKLFIGGISWETSEDKLKDYFGKYGDVLQTVVMRDKVSGKPRGFGFVVFADPNILDGVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV----------------SKTKKIFVGGIPPTLTED  1147
             + HVIDGR VE KR + RE+    +V                ++TKKIFVGG+PPTLT++
Sbjct  66    DRHVIDGRTVEAKRALSREEQQISKVGNANTGRSFGGGGGGNTRTKKIFVGGLPPTLTDE  125

Query  1146  ELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIK  967
               ++YF SYG V +  IM D  T R RGFGF++FD+E+AV +VL     H+LNGKQVE+K
Sbjct  126   AFRQYFESYGDVTDVVIMFDQQTNRPRGFGFISFDSEEAVDRVLHK-TFHDLNGKQVEVK  184

Query  966   RAEPKRA  946
             RA PK A
Sbjct  185   RALPKDA  191



>ref|XP_007150930.1| hypothetical protein PHAVU_004G006700g [Phaseolus vulgaris]
 gb|ESW22924.1| hypothetical protein PHAVU_004G006700g [Phaseolus vulgaris]
Length=374

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  40    SPGKIFIGGLARETTIAQFIKHFGKYGEITDSVIMKDRKTGQPRGFGFITYADPSVVDKV  99

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ HVI+G+ VE+KRT+PR     +   +TKKIFVGGIP  +TEDE +++F+ YG V +
Sbjct  100   IEDTHVINGKQVEIKRTIPRGAVGSKDF-RTKKIFVGGIPSNVTEDEFRDFFTRYGEVKD  158

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIM DH+T RSRGFGF+TFD+E+AV  +LS G   E  G QVEIK+AEPK+      S 
Sbjct  159   HQIMRDHSTNRSRGFGFITFDSEEAVDDLLSMGNKIEFAGAQVEIKKAEPKKPNSAPPSS  218

Query  924   GRMHRGNSNMHSYGNVNGDAED  859
              R +   S+  S G   GDA D
Sbjct  219   KRYNDSRSSYSSAG--YGDAYD  238



>ref|NP_001061525.1| Os08g0320100 [Oryza sativa Japonica Group]
 dbj|BAC92448.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAD10426.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF23439.1| Os08g0320100 [Oryza sativa Japonica Group]
 dbj|BAH00665.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83358.1| hypothetical protein OsI_28764 [Oryza sativa Indica Group]
 dbj|BAI39889.1| ribonucleoprotein-like [Oryza sativa Indica Group]
Length=350

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 142/209 (68%), Gaps = 12/209 (6%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S  K+F+GG+  +T+   F  YF KYGE++D+VIM D+ + +PRGFGFITFADP V +RV
Sbjct  13    SPAKIFIGGLPKDTTMGTFKEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ HVI+G+ VE+KRT+P+   P +   KTKKIFVGG+P  L EDE KE+FS +G VVE
Sbjct  73    IEDNHVINGKEVEIKRTIPKGAAPLKDF-KTKKIFVGGLPSALKEDEFKEFFSKFGKVVE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS-DGRMHELNGKQVEIKRAEPKRAGG----  940
             H+I+ DH+T RSRGFGFV FD E  V ++L+  G M +LNG QVEIK+AEPK+       
Sbjct  132   HEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKGNMIDLNGSQVEIKKAEPKKPSNPPHR  191

Query  939   --DRASEGRMHR----GNSNMHSYGNVNG  871
               D    GR H     G  N ++YG   G
Sbjct  192   SFDSEPRGRPHADGYDGLGNSYNYGGSFG  220



>ref|XP_010088351.1| Heterogeneous nuclear ribonucleoprotein 27C [Morus notabilis]
 gb|EXB34469.1| Heterogeneous nuclear ribonucleoprotein 27C [Morus notabilis]
Length=353

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+ + F +YF +YGE+ DSVIM D+ +GRPRGFGFIT+ADP V ++V
Sbjct  17    SPGKIFIGGLAKDTTLDTFVKYFEEYGEITDSVIMKDRQTGRPRGFGFITYADPSVVDQV  76

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++E HVI+G+ VE+KRT+P+         KTKKIFVGGIP ++ EDELK +FS YG+VVE
Sbjct  77    IKETHVINGKQVEIKRTIPKGSQQANDF-KTKKIFVGGIPTSVAEDELKNFFSKYGNVVE  135

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRA--  931
             H+I+ DH T +SRGFGFV F++E  V  +L +G M ++ G QVEIK+AEPK+A       
Sbjct  136   HEIIRDHATKKSRGFGFVVFESEKVVDSLLVNGNMIDMGGTQVEIKKAEPKKASNPAPVS  195

Query  930   ---SEGRMHRGNSNMHSYGNV  877
                S+ R    N +  ++GN+
Sbjct  196   AFRSDSRARPYNDSFSAHGNL  216



>ref|XP_009401201.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=456

 Score =   213 bits (542),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 139/218 (64%), Gaps = 20/218 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    +F  YGEV+D++IM DK +GRPRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETTEEKLKDHFGDYGEVLDAIIMRDKATGRPRGFGFVVFADPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------------KTKKIFVGGIPPTLTE  1150
             ++H IDGR VE KR + RE+      S                 +TKKIFVGG+PPTLTE
Sbjct  66    DKHSIDGRTVEAKRALSREEQQTSARSGNPVVGRSVGTTAGANIRTKKIFVGGLPPTLTE  125

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             D  +EYF SYG V +  +M D NT R RGFGF++FD+ED V KVL     H+L+GK VE+
Sbjct  126   DGFREYFESYGPVTDAVVMYDQNTHRPRGFGFISFDSEDTVDKVLQK-SFHDLDGKLVEV  184

Query  969   KRAEPKRAGGDRASEGRMHRGNSNMHSYGNVNGDAEDF  856
             KRA PK A  +  S   M  G+     YG  +G+   +
Sbjct  185   KRALPKDANPNTGSGRSM--GSGPYQPYGGSSGNTSSY  220



>ref|XP_008340642.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Malus domestica]
Length=467

 Score =   213 bits (542),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DKVSGRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKVSGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTTGRVGNANPTRSAGSGGNVRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF S+G V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFESFGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_006298001.1| hypothetical protein CARUB_v10014046mg [Capsella rubella]
 gb|EOA30899.1| hypothetical protein CARUB_v10014046mg [Capsella rubella]
Length=359

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 137/178 (77%), Gaps = 9/178 (5%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G+PRGFGFITFADP V ++V
Sbjct  17    SPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPR-----EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             +++ HVI+G+ VE+KRT+P+     +   F    KTKKIFVGGIP T+TED+LK++F+ Y
Sbjct  77    IEDNHVINGKQVEIKRTIPKGAGGNQSKDF----KTKKIFVGGIPSTVTEDDLKDFFAKY  132

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G+V EHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++   QVEIK+AEPK++
Sbjct  133   GNVAEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKS  190



>ref|XP_007035223.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 ref|XP_007035224.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY06149.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY06150.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=463

 Score =   213 bits (542),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF +YG V+ +V+M DKV+GRPRGFGF+ F+DP V + VLQ
Sbjct  6     GKLFIGGISWETSEDKLGEYFGQYGNVLQTVVMRDKVTGRPRGFGFVVFSDPSVLDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLTED 
Sbjct  66    EKHTIDGRTVEAKRALSREEQQTSARSGNLNQGRNSGSGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V++  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVIDVVIMYDQNTQRPRGFGFISFDAEDAVDRVLHK-SFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_006357669.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=342

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 3/196 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFITFADP V + V
Sbjct  13    SPGKIFIGGLAKETTREQFVKYFEKYGEIIDSVIMKDRQTGRPRGFGFITFADPTVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KT+KIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSADSKDF-KTRKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE+ V  +L++G   ++ G QVEIK+AEPK+     ++ 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEEVVDNLLAEGNRMDMMGTQVEIKKAEPKKPSNPASAP  191

Query  924   --GRMHRGNSNMHSYG  883
               G   RG     SYG
Sbjct  192   AYGSNSRGRGYGDSYG  207


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  1491  KHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITF  1312
             K S D       K+FVGGI    +E+ F  +FSK+G+V +  I+ D VS R RGFGFI F
Sbjct  92    KGSADSKDFKTRKIFVGGIPTTMTEDEFKNFFSKFGKVTEYEIIRDHVSKRSRGFGFIVF  151

Query  1311  ADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
              + EV + +L E + +D  G  VE+K+  P++
Sbjct  152   DNEEVVDNLLAEGNRMDMMGTQVEIKKAEPKK  183



>ref|XP_004243590.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=343

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 3/196 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFITFADP V + V
Sbjct  13    SPGKIFIGGVAKETTREQFVKYFEKYGEIIDSVIMKDRQTGRPRGFGFITFADPTVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KT+KIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSADSKDF-KTRKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE+ V  +L++G   ++ G QVEIK+AEPK+     ++ 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEEVVDNLLAEGNRMDMMGTQVEIKKAEPKKPSNPASAP  191

Query  924   --GRMHRGNSNMHSYG  883
               G   RG     SYG
Sbjct  192   AYGSNSRGRGFGDSYG  207


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  1491  KHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITF  1312
             K S D       K+FVGGI    +E+ F  +FSK+G+V +  I+ D VS R RGFGFI F
Sbjct  92    KGSADSKDFKTRKIFVGGIPTTMTEDEFKNFFSKFGKVTEYEIIRDHVSKRSRGFGFIVF  151

Query  1311  ADPEVANRVLQEEHVID--GRVVEVKRTVPRE  1222
              + EV + +L E + +D  G  VE+K+  P++
Sbjct  152   DNEEVVDNLLAEGNRMDMMGTQVEIKKAEPKK  183



>ref|XP_008785173.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
Length=468

 Score =   213 bits (542),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 128/188 (68%), Gaps = 18/188 (10%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YFSKYGEV+ +VIM DK++GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETTEEKMKEYFSKYGEVLQTVIMRDKMTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------------KTKKIFVGGIPPTLTE  1150
             + H IDGR VE KR + RE+    +                   +TKKIFVGG+PPTLTE
Sbjct  66    DSHTIDGRTVEAKRALSREEQQASKSGNPAVGRTGGGHVSGGNFRTKKIFVGGLPPTLTE  125

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             +  ++YF  YG V +  +M D NT R RGFGF++F +EDAV +VL     HELNGK VE+
Sbjct  126   EAFRQYFQGYGDVTDVVVMYDQNTQRPRGFGFISFSSEDAVDRVLHK-TFHELNGKLVEV  184

Query  969   KRAEPKRA  946
             KRA PK A
Sbjct  185   KRALPKDA  192



>ref|XP_009334212.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=467

 Score =   213 bits (541),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DK SGRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKTSGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDT----------PFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DQHTIDGRTVEAKRALSREEQQTTGRVGNAYPTRSAGSGGNVRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFEAYGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|KFK38657.1| hypothetical protein AALP_AA3G143300 [Arabis alpina]
Length=356

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ SG+PRGFGFIT+AD  V ++V
Sbjct  17    SPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHSGQPRGFGFITYADASVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPRE---DTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             ++E H+I+G+ VE+KRT+P+    + P  +  KTKKIFVGGIP  +TEDELKE+F+ YG+
Sbjct  77    MEESHIINGKQVEIKRTIPKGAGGNQP--KDIKTKKIFVGGIPSAVTEDELKEFFAKYGT  134

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             VVEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++   QVEIK+AEPK++    
Sbjct  135   VVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSSNRS  194

Query  933   ASE-GRMHRGNSNMHSYGNVNGDAEDF  856
                 G   RG S   SY    G    F
Sbjct  195   PPPYGSHPRGRSINDSYAGPYGGPYGF  221



>ref|XP_002312594.2| hypothetical protein POPTR_0008s17030g [Populus trichocarpa]
 gb|EEE89961.2| hypothetical protein POPTR_0008s17030g [Populus trichocarpa]
Length=448

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 130/178 (73%), Gaps = 8/178 (4%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSEE    YF++YG+V+ +V+M DK +GRPRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETSEEKLGEYFTQYGDVLQTVVMKDKTTGRPRGFGFVVFADPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFRRVS-----KTKKIFVGGIPPTLTEDELKEYFSSY  1120
             + H IDGR V+ ++T  R     P R  S     +TKKIFVGG+PPTLT+D  ++YF ++
Sbjct  66    DTHTIDGRTVKEQQTNARAGNLNPARNTSSGGNIRTKKIFVGGLPPTLTDDGFRQYFEAF  125

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G V +  IM D +T R RGFGF++FD+EDAV +VL     H+LNGKQVE+KRA PK A
Sbjct  126   GLVTDVVIMYDQSTQRPRGFGFISFDSEDAVDRVLQR-TFHDLNGKQVEVKRALPKEA  182



>emb|CBI34862.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 11/206 (5%)
 Frame = -2

Query  1545  DLEPPIHSLDGSSAGHELKHSIDD--STP--------SAGKLFVGGIAWETSEECFNRYF  1396
             D +P    LDG +   +  H  DD  S P        S GK+F+GG+A ET+   F ++F
Sbjct  2     DSQPTEAILDGETNDVKSSHHTDDNDSKPHPHTGDGASPGKIFIGGLARETTSAQFIKHF  61

Query  1395  SKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDT  1216
              KYGE+ DSVIM D+ +G+PRGFGF+T+AD  V ++V+Q+ HVI+G+ VE+KRT+P+   
Sbjct  62    GKYGEITDSVIMKDRKTGQPRGFGFVTYADLSVVDQVIQDTHVINGKQVEIKRTIPKGAI  121

Query  1215  PFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNE  1036
               +   KTKKIFVGGIP T+TE+E K++F+ YG V +HQIM DH+T RSRGFGFVTFD E
Sbjct  122   GAKDF-KTKKIFVGGIPATVTEEEFKDFFTQYGEVKDHQIMRDHSTSRSRGFGFVTFDTE  180

Query  1035  DAVQKVLSDGRMHELNGKQVEIKRAE  958
              AV  +LS G   EL G QVEIK+AE
Sbjct  181   QAVDDLLSQGNKLELAGAQVEIKKAE  206



>gb|KHG04742.1| Hrb27C [Gossypium arboreum]
Length=335

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 132/178 (74%), Gaps = 7/178 (4%)
 Frame = -2

Query  1479  DDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPE  1300
             D++  S GK+F+GG+A +T+ E F +YF KYGE+ D VIM D+ +GRPRGFGFITFADP 
Sbjct  8     DNNGASPGKIFIGGLAKDTTLETFTKYFEKYGEITDFVIMKDRHTGRPRGFGFITFADPS  67

Query  1299  VANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             V + VLQE+HV      E+KRT+P+  +      KTKKIFVGGIP ++TEDE K +FS Y
Sbjct  68    VVDTVLQEDHV------EIKRTIPKGSSQSNDF-KTKKIFVGGIPTSVTEDEFKNFFSKY  120

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             G VVEH+I+ DH T RSRGFGF+ FDNE  V+ +L +G M ++ G QVEIK+AEPK+A
Sbjct  121   GKVVEHEIIRDHATKRSRGFGFIVFDNEKVVENLLGNGNMIDMEGSQVEIKKAEPKKA  178



>ref|XP_011003137.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011015036.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=373

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 11/204 (5%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTP--------SAGKLFVGGIAWETSEECFNRYFSKYGEV  1378
             PIH  DG     +  H   D  P        S GK+F+GG+A ET+   F ++F KYGE+
Sbjct  8     PIH--DGEPNDVKSTHIPKDDKPQPLSGDGASPGKIFIGGLARETTTAQFIKHFGKYGEI  65

Query  1377  IDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVS  1198
              DSVIM D+ +G+PRGFGF+T+ADP V ++V+Q+ H+I+G+ VE+KRT+P+     +   
Sbjct  66    TDSVIMKDRKTGQPRGFGFVTYADPSVVDQVIQDTHIINGKQVEIKRTIPKGAVGSKDF-  124

Query  1197  KTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKV  1018
             +T+KIFVGGIP  +TEDE  E+F+ +G V EHQIM DH+T RSRGFGF+TFD E AV  +
Sbjct  125   RTRKIFVGGIPAVVTEDEFNEFFTQFGEVTEHQIMRDHSTNRSRGFGFITFDTEQAVDDL  184

Query  1017  LSDGRMHELNGKQVEIKRAEPKRA  946
             L+ G   EL G QVEIK+AEPK+A
Sbjct  185   LARGNKLELAGTQVEIKKAEPKKA  208


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 6/118 (5%)
 Frame = -2

Query  1275  EHVIDGRVVEVKRT-VPREDTPFRRV---SKTKKIFVGGIPPTLTEDELKEYFSSYGSVV  1108
             E + DG   +VK T +P++D P       +   KIF+GG+    T  +  ++F  YG + 
Sbjct  7     EPIHDGEPNDVKSTHIPKDDKPQPLSGDGASPGKIFIGGLARETTTAQFIKHFGKYGEIT  66

Query  1107  EHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             +  IM D  TG+ RGFGFVT+ +   V +V+ D   H +NGKQVEIKR  PK A G +
Sbjct  67    DSVIMKDRKTGQPRGFGFVTYADPSVVDQVIQD--THIINGKQVEIKRTIPKGAVGSK  122



>gb|EPS72088.1| g-strand specific single-stranded telomere-binding protein 1 
[Genlisea aurea]
Length=350

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +TS + F +YF KYGE+ DSVIM D+ +GRPRGFGFIT+A+P V + V
Sbjct  13    SPGKIFIGGLAKDTSLDTFVKYFGKYGEITDSVIMKDRQTGRPRGFGFITYAEPAVVDVV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+G+ VE+KRT+P+     R   KTKKIFVGGI   +TEDE K +FS YG VVE
Sbjct  73    IAETHIINGKQVEIKRTIPKGSGDSRDF-KTKKIFVGGISTAVTEDEFKSFFSKYGKVVE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH T RSRGFGF+ FDNE  V  +L+DG M ++ G QVEIK+AEPK+
Sbjct  132   HEIIRDHLTKRSRGFGFIVFDNEQVVDDLLADGNMIDMAGTQVEIKKAEPKK  183



>ref|XP_004151998.1| PREDICTED: DAZ-associated protein 1-like [Cucumis sativus]
 ref|XP_004163583.1| PREDICTED: DAZ-associated protein 1-like [Cucumis sativus]
 gb|KGN58288.1| hypothetical protein Csa_3G608180 [Cucumis sativus]
Length=436

 Score =   211 bits (538),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 128/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGIAW+TSEE    YFS++GEVI +VIM DK +GRPRGFGF+ F+DP + ++VLQ
Sbjct  6     GKLFIGGIAWDTSEEKLRDYFSQFGEVIQAVIMRDKTTGRPRGFGFVVFSDPSLLDQVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+      S               +TKKIFVGG+P  LTED 
Sbjct  66    DKHTIDGRQVEAKRALSREEQQTSTRSGINNSGRSSGGSGYFRTKKIFVGGLPSALTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF SYG V +  IM D NT R RGFGF+TFDNEDAV +VL     HELNGK VE+KR
Sbjct  126   FRQYFESYGQVTDVVIMYDQNTQRPRGFGFITFDNEDAVDRVLYK-SFHELNGKLVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_010251079.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Nelumbo nucifera]
Length=369

 Score =   209 bits (533),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ SG+PRGFGF+T+ADP V ++V
Sbjct  38    SPGKIFIGGLAKETTSAQFTKHFGKYGEITDSVIMKDRRSGQPRGFGFVTYADPSVVDKV  97

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +Q+ HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP  +TEDE K++F+ +G V E
Sbjct  98    IQDTHVINGKQVEIKRTIPKGAIGSKDF-KTKKIFVGGIPTAVTEDEFKDFFAKFGEVKE  156

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             HQIM DH T RSRGFGF+TF+ E AV  +L+ G   E  G QVEIK+AEPK+A
Sbjct  157   HQIMRDHATSRSRGFGFITFETEQAVDDLLAKGNKLEFAGAQVEIKKAEPKKA  209


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T  +  ++F  YG + +  IM D  +G+ RGFGFVT+ +   V KV+ D
Sbjct  41    KIFIGGLAKETTSAQFTKHFGKYGEITDSVIMKDRRSGQPRGFGFVTYADPSVVDKVIQD  100

Query  1008  GRMHELNGKQVEIKRAEPKRAGGDR  934
                H +NGKQVEIKR  PK A G +
Sbjct  101   --THVINGKQVEIKRTIPKGAIGSK  123



>ref|XP_009334135.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1 isoform 
X1 [Pyrus x bretschneideri]
Length=384

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 136/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             H+ D ++P  GK+F+GG+A ET+   F ++F  YGE+IDSVIM D+ +G+PRGFGF+T+A
Sbjct  38    HTGDGASP--GKIFIGGLARETTTAQFIKHFGAYGEIIDSVIMKDRKTGQPRGFGFVTYA  95

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+++ HVI+G+ VE+KRT+PR     +   KTKKIFVGGIP T+ E+E  ++F
Sbjct  96    DPSVVDKVIEDAHVINGKQVEIKRTIPRGAMGSKDF-KTKKIFVGGIPTTVNEEEFSDFF  154

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S YG V EHQIM DH+TGRSRGFGFVTFD E AV ++L  G   E  G QVEIK+AEPK+
Sbjct  155   SQYGEVKEHQIMRDHSTGRSRGFGFVTFDTEQAVDELLDKGNKLEFAGAQVEIKKAEPKK  214



>ref|XP_007222942.1| hypothetical protein PRUPE_ppa005309mg [Prunus persica]
 gb|EMJ24141.1| hypothetical protein PRUPE_ppa005309mg [Prunus persica]
Length=467

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DKV+GRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKVTGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTTGRVGNANPTRSAGNGGNIRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFETYGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_008447387.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
Length=436

 Score =   211 bits (538),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 128/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGIAW+TSEE    YFS++GEVI +VIM DK +GRPRGFGF+ F+DP + ++VLQ
Sbjct  6     GKLFIGGIAWDTSEEKLRDYFSQFGEVIQAVIMRDKTTGRPRGFGFVVFSDPSLLDQVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+      S               +TKKIFVGG+P  LTED 
Sbjct  66    DKHTIDGRQVEAKRALSREEQQTSTRSGINNSGRSSGGSGYFRTKKIFVGGLPSALTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF SYG V +  IM D NT R RGFGF+TFDNEDAV +VL     HELNGK VE+KR
Sbjct  126   FRQYFESYGQVTDVVIMYDQNTQRPRGFGFITFDNEDAVDRVLYK-SFHELNGKLVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_010500202.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like [Camelina sativa]
Length=359

 Score =   209 bits (532),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G+PRGFGFIT+AD  V ++V
Sbjct  17    SPGKIFIGGLHKDTTSTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITYADSSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPR-EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVV  1108
             +++ HVI+G+ VE+KRT+P+       +  KTKKIFVGGIP T+TEDELK++F+ YG+VV
Sbjct  77    IEDNHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVV  136

Query  1107  EHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             EHQI+ DH T RSRGFGFV FD+ED V ++LS G M ++   QVEIK+AEPK++
Sbjct  137   EHQIIRDHETNRSRGFGFVIFDSEDVVDELLSKGNMIDMADTQVEIKKAEPKKS  190



>ref|XP_010942879.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=343

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+  +TS   F ++F KYG++ID VIM DK + +PRGFGFIT+ADP V ++V
Sbjct  16    SPGKIFVGGLPKDTSIATFTKHFGKYGKIIDHVIMKDKYTSQPRGFGFITYADPSVVDKV  75

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP T+TEDE K +FS YG VV+
Sbjct  76    IEDTHIINGKQVEIKRTIPKGSLQSKDF-KTKKIFVGGIPSTVTEDEFKNFFSKYGEVVD  134

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQI+ DH T R RGFGF+ FD+E  V  +L++G M EL G QVEIK+AEPK+A       
Sbjct  135   HQIIRDHATNRPRGFGFIIFDSEQVVDDLLANGNMIELAGSQVEIKKAEPKKASNPPPP-  193

Query  924   GRMHRGNSNMHSYGNVNGD  868
                + G     S+G+  GD
Sbjct  194   --AYGGEPRARSFGDRFGD  210



>gb|AES71775.2| RNA recognition motif [Medicago truncatula]
Length=352

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A +T+ E F +YF +YGE+ DSVIM D+ +GRPRGFGFIT+A
Sbjct  10    HSGDGASP--GKIFIGGLAKDTTLEEFVKYFERYGEITDSVIMKDRHTGRPRGFGFITYA  67

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             D  V ++V+QE H+I+ + VE+KRT+P+  +      KTKKIFVGGIP T++EDELK +F
Sbjct  68    DASVVDQVIQENHIINDKQVEIKRTIPKGASQTNDF-KTKKIFVGGIPATVSEDELKIFF  126

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             S +G+VVEH+I+ DH T RSRGFGFV FD++ AV  +L+DG M +++  QVEIK+AEPK+
Sbjct  127   SKHGNVVEHEIIRDHTTKRSRGFGFVVFDSDKAVDNLLADGNMIDMDDTQVEIKKAEPKK  186



>ref|XP_006357668.1| PREDICTED: fibroin heavy chain-like [Solanum tuberosum]
Length=534

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 140/202 (69%), Gaps = 3/202 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFITFADP V + V
Sbjct  13    SPGKIFIGGVAKETTREQFVKYFEKYGEIIDSVIMKDRQTGRPRGFGFITFADPTVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KT+KIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSADSKDF-KTRKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE+ V  +L++G   ++ G QVEIK+AEPK+      + 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEEVVDNLLAEGNRMDMMGTQVEIKKAEPKKP--SNPAS  189

Query  924   GRMHRGNSNMHSYGNVNGDAED  859
                +  NS    YG+  G   D
Sbjct  190   APAYGSNSRGRGYGDSYGGFAD  211



>ref|XP_010109739.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXC24410.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=450

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 127/184 (69%), Gaps = 16/184 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF  YG+V+ +V+M +K +GRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETTEEKLKEYFENYGDVLQTVVMREKFTGRPRGFGFVVFTDPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDT----------PFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             + H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTLTE+ 
Sbjct  66    DNHSIDGRTVEAKRALSREEQQTSGRAGNSYPARNSGDGGNVRTKKIFVGGLPPTLTEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D NTGR RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFEAYGRVTDVVVMYDQNTGRPRGFGFISFDAEDAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPK  952
             A PK
Sbjct  185   ALPK  188


 Score = 84.3 bits (207),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -2

Query  1500  HELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGF  1321
             +  ++S D       K+FVGG+    +EE F  YF  YG V D V+M D+ +GRPRGFGF
Sbjct  96    YPARNSGDGGNVRTKKIFVGGLPPTLTEEGFREYFEAYGRVTDVVVMYDQNTGRPRGFGF  155

Query  1320  ITFADPEVANRVLQEE-HVIDGRVVEVKRTVPREDTP  1213
             I+F   +  +RVL +  H ++G+ VEVKR +P++  P
Sbjct  156   ISFDAEDAVDRVLHKTFHDLNGKQVEVKRALPKDVNP  192



>ref|XP_002298541.2| hypothetical protein POPTR_0001s35360g [Populus trichocarpa]
 gb|EEE83346.2| hypothetical protein POPTR_0001s35360g [Populus trichocarpa]
Length=373

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 11/204 (5%)
 Frame = -2

Query  1533  PIHSLDGSSAGHELKHSIDDSTP--------SAGKLFVGGIAWETSEECFNRYFSKYGEV  1378
             PIH  DG     +  H   D  P        S GK+F+GG+A ET+   F ++F KYGE+
Sbjct  8     PIH--DGEPNDVKSTHIPKDDKPQPLSGDGASPGKIFIGGLARETTTAQFIKHFGKYGEI  65

Query  1377  IDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVS  1198
              DSVIM D+ +G+PRGFGF+T+ADP V ++V+Q+ H+I+G+ VE+KRT+P+     +   
Sbjct  66    TDSVIMKDRKTGQPRGFGFVTYADPSVVDQVIQDTHIINGKQVEIKRTIPKGVVGSKDF-  124

Query  1197  KTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKV  1018
             +T+KIFVGGIP  +TEDE  E+F+ +G V EHQIM DH+T RSRGFGF+TFD E AV  +
Sbjct  125   RTRKIFVGGIPAVVTEDEFNEFFTQFGEVTEHQIMRDHSTNRSRGFGFITFDTEQAVDDL  184

Query  1017  LSDGRMHELNGKQVEIKRAEPKRA  946
             L+ G   EL G QVEIK+AEPK+A
Sbjct  185   LARGNKLELAGTQVEIKKAEPKKA  208


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 6/112 (5%)
 Frame = -2

Query  1275  EHVIDGRVVEVKRT-VPREDTPFRRV---SKTKKIFVGGIPPTLTEDELKEYFSSYGSVV  1108
             E + DG   +VK T +P++D P       +   KIF+GG+    T  +  ++F  YG + 
Sbjct  7     EPIHDGEPNDVKSTHIPKDDKPQPLSGDGASPGKIFIGGLARETTTAQFIKHFGKYGEIT  66

Query  1107  EHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             +  IM D  TG+ RGFGFVT+ +   V +V+ D   H +NGKQVEIKR  PK
Sbjct  67    DSVIMKDRKTGQPRGFGFVTYADPSVVDQVIQD--THIINGKQVEIKRTIPK  116



>ref|XP_004147161.1| PREDICTED: heterogeneous nuclear ribonucleoprotein D-like [Cucumis 
sativus]
Length=462

 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 17/187 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YGEV+ +V+M DK++ RPRGFGF+ F+DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDKITSRPRGFGFVVFSDPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFRRVS--------------KTKKIFVGGIPPTLTED  1147
             ++H IDG+ VE KR + RE+  TP R  +              +TKKIFVGG+PPTLTE+
Sbjct  66    DKHTIDGKTVEAKRALSREEQQTPARASNSNGRNSGGSGGGNMRTKKIFVGGLPPTLTEE  125

Query  1146  ELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIK  967
               KEYF +YG V +  +M D NT R RGFGF++FD E+AV +VL     H+LNGKQVE+K
Sbjct  126   GFKEYFEAYGHVTDVVVMYDQNTRRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVK  184

Query  966   RAEPKRA  946
             RA PK A
Sbjct  185   RALPKDA  191



>ref|XP_004234048.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=427

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 15/183 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GG++WETSEE    YF  YG+V+ +V+M DK++G+PRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGVSWETSEEKMKEYFQGYGDVVQTVVMRDKITGKPRGFGFVVFADPSVIDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDEL  1141
             + HVIDGR VE KR + RE+    +               ++TKKIFVGG+PPTLTED+ 
Sbjct  66    DTHVIDGRTVEAKRALSREEQQGPKSGNMGGGRSFGGSGNTRTKKIFVGGLPPTLTEDDF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             + YF +YG+V +  IM D  T R RGFGF++FD+EDAV +VL     H+L+GKQVE+KRA
Sbjct  126   RIYFETYGNVTDVAIMYDQQTNRPRGFGFISFDSEDAVDRVLHKA-YHDLSGKQVEVKRA  184

Query  960   EPK  952
              PK
Sbjct  185   LPK  187



>ref|XP_006356068.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=442

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 128/182 (70%), Gaps = 15/182 (8%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             KLF+GGI+WETSEE    YF  YG+V+ +V+M DK++G+PRGFGF+ FADP V +RVLQ+
Sbjct  7     KLFIGGISWETSEERMKEYFQGYGDVLQTVVMRDKITGKPRGFGFVVFADPSVLDRVLQD  66

Query  1275  EHVIDGRVVEVKRTVPREDTPFRRV--------------SKTKKIFVGGIPPTLTEDELK  1138
              HVIDGR VE KR + RE+    +               +KTKKIFVGG+PPTLTED  +
Sbjct  67    THVIDGRTVEAKRALSREEQQGPKSGNMGSARSFGGGGNTKTKKIFVGGLPPTLTEDGFR  126

Query  1137  EYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAE  958
              YF +YG+V +  IM D  T R RGFGF++FD+EDAV +VL     H+L+GKQVE+KRA 
Sbjct  127   TYFETYGNVTDVAIMFDQQTNRPRGFGFISFDSEDAVDRVLHK-TYHDLSGKQVEVKRAL  185

Query  957   PK  952
             PK
Sbjct  186   PK  187


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  1200  SKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQK  1021
             S   K+F+GGI    +E+ +KEYF  YG V++  +M D  TG+ RGFGFV F +   + +
Sbjct  3     SDQAKLFIGGISWETSEERMKEYFQGYGDVLQTVVMRDKITGKPRGFGFVVFADPSVLDR  62

Query  1020  VLSDGRMHELNGKQVEIKRA  961
             VL D   H ++G+ VE KRA
Sbjct  63    VLQD--THVIDGRTVEAKRA  80



>gb|EYU18975.1| hypothetical protein MIMGU_mgv1a019468mg [Erythranthe guttata]
Length=372

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+ + F +YF KYGE+ DSVIM D+ + RPRGFGFIT+AD  V + V
Sbjct  13    SPGKIFIGGLAKDTTLDTFVKYFGKYGEITDSVIMKDRHTSRPRGFGFITYADAAVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+G+ VE+KRT+P+     +   KTKK+FVGGIP ++TEDELK +FS+YG VVE
Sbjct  73    IAETHIINGKQVEIKRTIPKGAGDSKDF-KTKKVFVGGIPTSVTEDELKSFFSNYGKVVE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH T RSRGFGFV FDNE  V  +L+DG M ++ G QVEIK+AEPK+
Sbjct  132   HEIIRDHVTKRSRGFGFVVFDNEQVVDTLLADGNMIDMAGTQVEIKKAEPKK  183



>ref|XP_008460677.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
Length=461

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 133/187 (71%), Gaps = 17/187 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YGEV+ +V+M DK++ RPRGFGF+ F+DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDKITSRPRGFGFVVFSDPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFRRVS--------------KTKKIFVGGIPPTLTED  1147
             ++H IDG+ VE KR + RE+  TP R  +              +TKKIFVGG+PPTLTE+
Sbjct  66    DKHTIDGKTVEAKRALSREEQQTPARASNSNGRNSGGSGGGNMRTKKIFVGGLPPTLTEE  125

Query  1146  ELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIK  967
               KEYF +YG V +  +M D NT R RGFGF++FD+E+AV +VL     H+LNGKQVE+K
Sbjct  126   GFKEYFEAYGHVTDVVVMYDQNTRRPRGFGFISFDSEEAVDRVLHK-TFHDLNGKQVEVK  184

Query  966   RAEPKRA  946
             RA PK A
Sbjct  185   RALPKDA  191



>ref|XP_006659294.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza 
brachyantha]
Length=350

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S  K+F+GG+  +T+   F  YF KYGE++D+VIM D+ + +PRGFGFITFADP V +RV
Sbjct  13    SPAKIFIGGLPKDTTMGTFKEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ HVI+G+ VE+KRT+P+   P +   KTKKIFVGG+P  L EDE KE+FS +G V+E
Sbjct  73    IEDNHVINGKEVEIKRTIPKGAAPLKDF-KTKKIFVGGLPSALKEDEFKEFFSRFGKVLE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS-DGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH+T RSRGFGFV FD E  V ++L+  G M +LNG QVEIK+AEPK+
Sbjct  132   HEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKGNMIDLNGSQVEIKKAEPKK  184



>ref|XP_004303580.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 143/192 (74%), Gaps = 9/192 (5%)
 Frame = -2

Query  1512  SSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPR  1333
             S  G    HS D ++P  GK+F+GG+A  T+ E F +YF KYGE+IDSVIM D+ +G PR
Sbjct  3     SKKGDYNPHSGDGASP--GKIFIGGLAKNTTLETFIKYFEKYGEIIDSVIMKDRQTGLPR  60

Query  1332  GFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPP  1162
             GFGFIT++DP V ++V+QE HVI+ + VE+KRT+P+   +   F    KTKK+FVGGIP 
Sbjct  61    GFGFITYSDPSVVDQVIQETHVINDKQVEIKRTIPKGAGQANDF----KTKKVFVGGIPR  116

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             T+TEDELK++FS +G+V EHQI+ +H T RSRGFGFV F++E  V  +L++G   +++G 
Sbjct  117   TVTEDELKDFFSKFGNVEEHQIIREHATNRSRGFGFVVFESEKVVDNLLANGNKIDMDGT  176

Query  981   QVEIKRAEPKRA  946
             QVEIK+AEPK+A
Sbjct  177   QVEIKKAEPKKA  188


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    T +   +YF  YG +++  IM D  TG  RGFGF+T+ +   V +V+ +
Sbjct  20    KIFIGGLAKNTTLETFIKYFEKYGEIIDSVIMKDRQTGLPRGFGFITYSDPSVVDQVIQE  79

Query  1008  GRMHELNGKQVEIKRAEPKRAG  943
                H +N KQVEIKR  PK AG
Sbjct  80    --THVINDKQVEIKRTIPKGAG  99



>emb|CAN67089.1| hypothetical protein VITISV_033546 [Vitis vinifera]
Length=145

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  1362  MMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKI  1183
             MMD+ +GRPRGFGFITFADP VA++VL+E+HVIDGR VEVK+TVPRE    R VSKT+KI
Sbjct  1     MMDRHTGRPRGFGFITFADPAVADKVLEEDHVIDGRAVEVKKTVPREGMEVRGVSKTRKI  60

Query  1182  FVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGR  1003
             FVGGIP +LTEDELK+YFSSYG++VE+QIMLDH TGRSRGFGFVTF +EDAV+++ S+G+
Sbjct  61    FVGGIPSSLTEDELKDYFSSYGAIVENQIMLDHVTGRSRGFGFVTFVSEDAVERLFSEGK  120

Query  1002  MHELNGKQVEIK  967
              HEL GK V ++
Sbjct  121   THELGGKLVTLR  132


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGGI    +E+    YFS YG ++++ IM+D V+GR RGFGF+TF   +   R+  E
Sbjct  59    KIFVGGIPSSLTEDELKDYFSSYGAIVENQIMLDHVTGRSRGFGFVTFVSEDAVERLFSE  118

Query  1275  --EHVIDGRVVEVKRTVPRED  1219
                H + G++V ++ T+  E+
Sbjct  119   GKTHELGGKLVTLRGTLMNEN  139



>ref|XP_007035222.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY06148.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=533

 Score =   213 bits (541),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF +YG V+ +V+M DKV+GRPRGFGF+ F+DP V + VLQ
Sbjct  6     GKLFIGGISWETSEDKLGEYFGQYGNVLQTVVMRDKVTGRPRGFGFVVFSDPSVLDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLTED 
Sbjct  66    EKHTIDGRTVEAKRALSREEQQTSARSGNLNQGRNSGSGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V++  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVIDVVIMYDQNTQRPRGFGFISFDAEDAVDRVLHK-SFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_010539319.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Tarenaya hassleriana]
Length=453

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 140/211 (66%), Gaps = 21/211 (10%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLFVGGI+W+T EE    YFSKYGEV+++VIM D+ +GR RGFGFI FADP VA RV+ 
Sbjct  6     GKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDRATGRARGFGFIVFADPCVAERVIM  65

Query  1278  EEHVIDGRVVEVKRTVPRED--------TPFRRVS-------KTKKIFVGGIPPTLTEDE  1144
             E+H+IDGR VE K+ VPR+D        +P   +S       +TKKIFVGG+P ++TE E
Sbjct  66    EKHMIDGRTVEAKKAVPRDDQQGLKQHASPVHHMSPPGHGGGRTKKIFVGGLPSSITEAE  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              K YF+ +GS+ +  +M DHNT R RGFGF+T+D+ED+V +VL     HELNGK VE+KR
Sbjct  126   FKNYFNQFGSISDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHK-TFHELNGKMVEVKR  184

Query  963   AEPKRAGGDRASEGRMHRGNSNMHSYGNVNG  871
             A PK      A   R     S +  YGN  G
Sbjct  185   AVPKELSPSPAPSNR-----SPVLGYGNYGG  210



>ref|XP_008224160.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Prunus 
mume]
Length=467

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YG+V+ +V+M DKV+GRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDKVTGRPRGFGFVVFVDPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+           P R        +TKKIFVGG+PPTL+E+ 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTTGRVGNANPTRSGGNGGNIRTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +EYF +YG V +  +M D +TGR RGFGF++FD E+AV +VL     H+LNGKQVE+KR
Sbjct  126   FREYFETYGHVTDVVVMYDQSTGRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_010069110.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 gb|KCW57346.1| hypothetical protein EUGRSUZ_H00136 [Eucalyptus grandis]
Length=456

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF +YG+V+ +V+M DKV+GRPRGFGF+ FADP V +RVLQ
Sbjct  6     GKLFIGGISWETNEERLKEYFGQYGDVLQAVVMRDKVTGRPRGFGFVVFADPAVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLT+D 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTNARSGNQNPDRGSGAGGNIRTKKIFVGGLPPTLTDDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD E+AV +VL     H+L+GKQVE+KR
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDTEEAVDRVLHK-TFHDLSGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_009769829.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=346

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 4/206 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT++DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYSDPTVVDNV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP ++ EDE K +FS YG VV+
Sbjct  73    IAETHIINDKQVEIKRTIPKGSAESKDF-KTKKIFVGGIPTSMNEDEFKGFFSKYGKVVD  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS-  928
              +I+ DH + RSRGFGF+ FDNE  V  VLS+G M ++ G QVEIK+AEPK+     +S 
Sbjct  132   CEIIRDHVSKRSRGFGFIVFDNEQVVDNVLSEGNMIDMLGTQVEIKKAEPKKPSNPASSG  191

Query  927   --EGRMHRGNSNMHSYGNVNGDAEDF  856
                G   RG     SYG        F
Sbjct  192   HGYGSESRGRGYSDSYGGFGNSYSSF  217



>ref|XP_010539320.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
Length=460

 Score =   210 bits (535),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 140/211 (66%), Gaps = 21/211 (10%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLFVGGI+W+T EE    YFSKYGEV+++VIM D+ +GR RGFGFI FADP VA RV+ 
Sbjct  13    GKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDRATGRARGFGFIVFADPCVAERVIM  72

Query  1278  EEHVIDGRVVEVKRTVPRED--------TPFRRVS-------KTKKIFVGGIPPTLTEDE  1144
             E+H+IDGR VE K+ VPR+D        +P   +S       +TKKIFVGG+P ++TE E
Sbjct  73    EKHMIDGRTVEAKKAVPRDDQQGLKQHASPVHHMSPPGHGGGRTKKIFVGGLPSSITEAE  132

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              K YF+ +GS+ +  +M DHNT R RGFGF+T+D+ED+V +VL     HELNGK VE+KR
Sbjct  133   FKNYFNQFGSISDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHK-TFHELNGKMVEVKR  191

Query  963   AEPKRAGGDRASEGRMHRGNSNMHSYGNVNG  871
             A PK      A   R     S +  YGN  G
Sbjct  192   AVPKELSPSPAPSNR-----SPVLGYGNYGG  217



>ref|XP_006401444.1| hypothetical protein EUTSA_v10013607mg [Eutrema salsugineum]
 gb|ESQ42897.1| hypothetical protein EUTSA_v10013607mg [Eutrema salsugineum]
Length=431

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 15/183 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T EE    YFSKYG+V+++VIM D+ +GR RGFGFI FADP VA RV+ 
Sbjct  6     GKLFIGGISWDTDEEKLRDYFSKYGDVVEAVIMRDRATGRARGFGFIVFADPCVAERVIM  65

Query  1278  EEHVIDGRVVEVKRTVPRED----TPFRRVS----------KTKKIFVGGIPPTLTEDEL  1141
             E+H+IDGR VE K+ VPR+D    +P + +S          +TKKIFVGG+P ++TE E 
Sbjct  66    EKHIIDGRTVEAKKAVPRDDQRHASPIQLMSPVVHGGGGGGRTKKIFVGGLPSSITEAEF  125

Query  1140  KEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRA  961
             K+YF  +G++ +  +M DHNT R RGFGF+TFD++DAV  VL     HELNGK VE+KRA
Sbjct  126   KKYFDQFGNIADVVVMYDHNTQRPRGFGFITFDSDDAVDSVLHK-TFHELNGKLVEVKRA  184

Query  960   EPK  952
              PK
Sbjct  185   VPK  187


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+    +E  F +YF ++G + D V+M D  + RPRGFGFITF   +  + VL +
Sbjct  110   KIFVGGLPSSITEAEFKKYFDQFGNIADVVVMYDHNTQRPRGFGFITFDSDDAVDSVLHK  169

Query  1275  E-HVIDGRVVEVKRTVPREDTPFRR  1204
               H ++G++VEVKR VP+E +P  R
Sbjct  170   TFHELNGKLVEVKRAVPKEISPVSR  194



>ref|XP_010264924.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nelumbo 
nucifera]
Length=467

 Score =   210 bits (535),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+TSE+    YFSKYGEV+ +VIM DKV+GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWDTSEDKLKEYFSKYGEVVQTVIMRDKVTGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLTE+ 
Sbjct  66    DKHTIDGRTVEAKRALSREEQQTSSRSGNPNAGRSVGGAGNVRTKKIFVGGLPPTLTEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  +M D  T R RGFGF++FD E+AV +VL     HELNGK VE+KR
Sbjct  126   FRQYFETYGHVTDVVVMYDQTTQRPRGFGFISFDTEEAVDRVLHK-TFHELNGKLVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|KHG10024.1| DAZ-associated 1 [Gossypium arboreum]
Length=499

 Score =   211 bits (537),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF +YG+++ +V+M DKV+GRPRGFGF+ F+DP V + VLQ
Sbjct  6     GKLFIGGISWETSEDRLKEYFGQYGDILQTVVMRDKVTGRPRGFGFVVFSDPSVLDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLTED 
Sbjct  66    EKHTIDGRTVEAKRALSREEQQTSARSGNFNQARNSGGGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDTEDAVDRVLHK-SFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|KHN27548.1| Nuclear polyadenylated RNA-binding protein 4 [Glycine soja]
Length=333

 Score =   206 bits (525),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 148/225 (66%), Gaps = 19/225 (8%)
 Frame = -2

Query  1527  HSLDGSSAG--HELKHSIDDSTP--------SAGKLFVGGIAWETSEECFNRYFSKYGEV  1378
             H++DG +        H  DD  P        S GK+F+GG+A ET+   F ++F KYGE+
Sbjct  9     HAVDGDANDLVRPFSHRDDDGKPQPLTGDGASPGKIFIGGLARETTIAQFIKHFGKYGEI  68

Query  1377  IDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR-----EDTP  1213
              DSVIM D+ +G+PRGFGFIT+ADP V + V+++ H+I+G+ VE+KRT+PR         
Sbjct  69    TDSVIMKDRKTGQPRGFGFITYADPSVVDTVIEDTHIINGKQVEIKRTIPRGAVGSNSKD  128

Query  1212  FRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNED  1033
             FR    TKKIFVGGIP T+TEDE +++F+ YG V +HQIM DH+T RSRGFGF+T+D+E+
Sbjct  129   FR----TKKIFVGGIPSTVTEDEFRDFFTRYGEVKDHQIMRDHSTNRSRGFGFITYDSEE  184

Query  1032  AVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMHRGNSN  898
             AV  +LS G   E  G QVEIK+AEPK+      S  R +   S+
Sbjct  185   AVDDLLSVGNKIEFAGAQVEIKKAEPKKPNPPAPSSKRYNDSRSS  229



>gb|KDP46415.1| hypothetical protein JCGZ_10255 [Jatropha curcas]
Length=376

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             H+ D ++P  GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ +G+PRGFGF+T+A
Sbjct  31    HTGDGASP--GKIFIGGLARETTSAQFVKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYA  88

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP  +TEDE KE+F
Sbjct  89    DPSVVDQVIEDTHIINGKQVEIKRTIPKGAMGSKDF-KTKKIFVGGIPTAVTEDEFKEFF  147

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             + YG V+EHQIM DH T RSRGFGF+TFD+E AV  +L+ G   +L G QVEIK+AEPK+
Sbjct  148   TQYGEVIEHQIMRDHATNRSRGFGFITFDSEQAVDDLLARGNKLDLAGTQVEIKKAEPKK  207

Query  948   AGGDRASEGRMHRGNSNMHSYGNVNGDAED  859
                      R    N + H++G   G++ D
Sbjct  208   PNPPLPPSKRY---NDSRHAFGGGFGESYD  234



>ref|XP_010465141.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like [Camelina sativa]
Length=359

 Score =   207 bits (527),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G+PRGFGFIT+AD  V ++V
Sbjct  17    SPGKIFIGGLHKDTTSTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITYADSSVVDKV  76

Query  1284  LQEEHVIDGRVVEVKRTVPR-EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVV  1108
             +++ HVI+G+ VE+KRT+P+       +  KTKKIFVGGIP T+TEDELK++F+ YG+VV
Sbjct  77    IEDNHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVV  136

Query  1107  EHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             EHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++   QVEIK+AEPK++
Sbjct  137   EHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKS  190



>ref|XP_010928065.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=346

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 135/195 (69%), Gaps = 13/195 (7%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+  +TS   F ++F KYGE+ID VIM DK + +PRGFGFIT+ADP V ++V
Sbjct  16    SPGKIFVGGLPKDTSIATFTKHFGKYGEIIDHVIMKDKYTSQPRGFGFITYADPSVVDKV  75

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + + H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP  +TEDE K++FS YG VV+
Sbjct  76    IDDTHIINGKQVEIKRTIPKGSVQSKDF-KTKKIFVGGIPSMVTEDEFKDFFSKYGKVVD  134

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQI+ DH T R RGFGF+ FD+E  V  +L+ G M +L G QVEIK+AEPK+A       
Sbjct  135   HQIIRDHATNRPRGFGFIIFDSEQVVDDLLATGNMIDLAGSQVEIKKAEPKKA-------  187

Query  924   GRMHRGNSNMHSYGN  880
                   N   H+YG+
Sbjct  188   -----SNPPPHAYGS  197



>ref|XP_010920312.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Elaeis 
guineensis]
Length=463

 Score =   210 bits (534),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 139/217 (64%), Gaps = 28/217 (13%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YFS YGEV+ +VIM DK +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETTEEKMKEYFSNYGEVLQTVIMRDKATGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------------KTKKIFVGGIPPTLTE  1150
             ++H IDGR VE KR + RE+    +                   +TKKIFVGG+PPTLTE
Sbjct  66    DKHNIDGRTVEAKRALSREEQQASKSGNPNVGRSGGGPVSGGNFRTKKIFVGGLPPTLTE  125

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             +   +YF SYG V +  +M D NT R RGFGFV+F +EDAV +VL     HELNGK VE+
Sbjct  126   EIFCQYFQSYGEVEDVVVMYDQNTHRPRGFGFVSFKSEDAVDRVLHK-TFHELNGKLVEV  184

Query  969   KRAEPKRAGGDRASEGRMHRG-----NS----NMHSY  886
             KRA PK A    AS GR+  G     NS    NM SY
Sbjct  185   KRALPKDANPSNAS-GRLVAGGPYQTNSASGVNMSSY  220



>ref|XP_010908651.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Elaeis guineensis]
Length=478

 Score =   210 bits (535),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 131/180 (73%), Gaps = 12/180 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+E+    YF  YGEV+++VIM D+ +GR RGFGF+ FADP VA RV+ 
Sbjct  7     GKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVAERVIM  66

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H+IDGR+VE K+ VPR+D      S           +TKKIFVGG+P T+TE + K+Y
Sbjct  67    EKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITESDFKKY  126

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++++  +M DHNT R RGFGF+T+D+EDAV KVL +   HELNGK VE+KRA PK
Sbjct  127   FDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN-TFHELNGKMVEVKRAVPK  185


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+    +E  F +YF ++G +ID V+M D  + RPRGFGFIT+   +  ++VL  
Sbjct  108   KIFVGGLPSTITESDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN  167

Query  1275  E-HVIDGRVVEVKRTVPREDTP  1213
               H ++G++VEVKR VP+E +P
Sbjct  168   TFHELNGKMVEVKRAVPKELSP  189



>gb|KDP40375.1| hypothetical protein JCGZ_02373 [Jatropha curcas]
Length=466

 Score =   210 bits (534),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YF++YG+V+ +V+M DK +GRPRGFGF+ FADP + + VLQ
Sbjct  6     GKLFIGGISWETTEEKLKDYFTQYGDVLQTVVMRDKTTGRPRGFGFVVFADPAILDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED----------TPFRRVS-----KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR VE K+ + RE+           P R        +TKKIFVGG+PP LT+D 
Sbjct  66    DKHTIDGRTVEAKKALSREEQQTNTRNGNINPARNPGSGGNIRTKKIFVGGLPPNLTDDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF SYG V +  IM D NT R RGFGF++FD+EDAV  VL     H+LNGKQVE+KR
Sbjct  126   FRQYFESYGHVTDVVIMYDQNTQRPRGFGFISFDSEDAVDHVLHK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_010908650.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Elaeis guineensis]
Length=484

 Score =   210 bits (535),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 131/180 (73%), Gaps = 12/180 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+E+    YF  YGEV+++VIM D+ +GR RGFGF+ FADP VA RV+ 
Sbjct  7     GKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVAERVIM  66

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H+IDGR+VE K+ VPR+D      S           +TKKIFVGG+P T+TE + K+Y
Sbjct  67    EKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITESDFKKY  126

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++++  +M DHNT R RGFGF+T+D+EDAV KVL +   HELNGK VE+KRA PK
Sbjct  127   FDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN-TFHELNGKMVEVKRAVPK  185


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+    +E  F +YF ++G +ID V+M D  + RPRGFGFIT+   +  ++VL  
Sbjct  108   KIFVGGLPSTITESDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN  167

Query  1275  E-HVIDGRVVEVKRTVPREDTP  1213
               H ++G++VEVKR VP+E +P
Sbjct  168   TFHELNGKMVEVKRAVPKELSP  189



>ref|XP_004973208.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria 
italica]
Length=350

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S  K+F+GG++ +TS   F  +F KYG++ D+VIM D+ + +PRGFGFITFADP V +RV
Sbjct  12    SPAKIFIGGLSKDTSMGTFKEHFGKYGDITDAVIMKDRYTQKPRGFGFITFADPAVVDRV  71

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++EHVI+G+ VE+KRT+P+   P +   KTKKIFVGG+P  L EDE KE+FS +G VVE
Sbjct  72    IEDEHVINGKPVEIKRTIPKGAAPLKDF-KTKKIFVGGLPTALKEDEFKEFFSKFGKVVE  130

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS-DGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH T RSRGFGF+ FD E  V ++L+  G M +LNG QVEIK+AEPK+
Sbjct  131   HEIIRDHATNRSRGFGFIVFDAEKTVDELLAKKGNMIDLNGSQVEIKKAEPKK  183


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+    +    KE+F  YG + +  IM D  T + RGFGF+TF +   V +V+ D
Sbjct  15    KIFIGGLSKDTSMGTFKEHFGKYGDITDAVIMKDRYTQKPRGFGFITFADPAVVDRVIED  74

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
                H +NGK VEIKR  PK A
Sbjct  75    --EHVINGKPVEIKRTIPKGA  93



>ref|XP_009614654.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=337

 Score =   206 bits (523),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 137/196 (70%), Gaps = 3/196 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+ DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYEDPSVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSAELKDF-KTKKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE  V  +L++G   ++ G QVEIK+AEPK+     ++ 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEQVVDNLLAEGNRTDMMGTQVEIKKAEPKKPSNPASAP  191

Query  924   --GRMHRGNSNMHSYG  883
               G   RG     SYG
Sbjct  192   AYGSDSRGRGYGDSYG  207



>ref|XP_009380127.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   210 bits (535),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 137/203 (67%), Gaps = 17/203 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+E+    YFS YGEV+++VIM D+ +GR RGFGF+ FADP VA RV+ 
Sbjct  6     GKLFIGGISWDTNEDRLREYFSNYGEVVEAVIMKDRTTGRARGFGFVVFADPAVAERVVM  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H+IDGR+VE K+ VPR+D      +           +TKKIFVGG+P T+TE + K Y
Sbjct  66    EKHLIDGRMVEAKKAVPRDDQQILNRNNSSIHGSPGPGRTKKIFVGGLPSTITESDFKNY  125

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++ +  +M DHNT R RGFGF+T+D+EDAV KVL     HELNGK VE+KRA PK
Sbjct  126   FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLFK-SFHELNGKMVEVKRAVPK  184

Query  951   RAGGDRASEGRMHRGNSNMHSYG  883
                    S G   R  S  ++YG
Sbjct  185   -----ELSPGPNMRSPSAGYTYG  202



>ref|XP_003547716.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Glycine 
max]
Length=372

 Score =   207 bits (526),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 148/225 (66%), Gaps = 19/225 (8%)
 Frame = -2

Query  1527  HSLDGSSAG--HELKHSIDDSTP--------SAGKLFVGGIAWETSEECFNRYFSKYGEV  1378
             H++DG +        H  DD  P        S GK+F+GG+A ET+   F ++F KYGE+
Sbjct  9     HAVDGDANDLVRPFSHRDDDGKPQPLTGDGASPGKIFIGGLARETTIAQFIKHFGKYGEI  68

Query  1377  IDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR-----EDTP  1213
              DSVIM D+ +G+PRGFGFIT+ADP V + V+++ H+I+G+ VE+KRT+PR         
Sbjct  69    TDSVIMKDRKTGQPRGFGFITYADPSVVDTVIEDTHIINGKQVEIKRTIPRGAVGSNSKD  128

Query  1212  FRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNED  1033
             FR    TKKIFVGGIP T+TEDE +++F+ YG V +HQIM DH+T RSRGFGF+T+D+E+
Sbjct  129   FR----TKKIFVGGIPSTVTEDEFRDFFTRYGEVKDHQIMRDHSTNRSRGFGFITYDSEE  184

Query  1032  AVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASEGRMHRGNSN  898
             AV  +LS G   E  G QVEIK+AEPK+      S  R +   S+
Sbjct  185   AVDDLLSVGNKIEFAGAQVEIKKAEPKKPNPPAPSSKRYNDSRSS  229



>ref|XP_004173706.1| PREDICTED: LOW QUALITY PROTEIN: heterogeneous nuclear ribonucleoprotein 
D-like [Cucumis sativus]
Length=462

 Score =   209 bits (532),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 131/187 (70%), Gaps = 17/187 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YGEV+ +V+M DK++ RPRGFGF+ F+DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDKITSRPRGFGFVVFSDPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFRRVS--------------KTKKIFVGGIPPTLTED  1147
             ++H IDG+ VE KR + RE+  TP R  +              +TKK FVGG+PPTLTE+
Sbjct  66    DKHTIDGKTVEAKRALSREEQQTPARASNSNGRNSGGSGGGNMRTKKXFVGGLPPTLTEE  125

Query  1146  ELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIK  967
               KEYF +YG V +  +M D NT R RGFGF++FD E+AV +VL     H+LNGKQVE+K
Sbjct  126   GFKEYFEAYGHVTDVVVMYDQNTRRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVK  184

Query  966   RAEPKRA  946
             RA PK A
Sbjct  185   RALPKDA  191



>gb|ADN95983.1| G-strand specific single-stranded telomere-binding protein 1 
[Nicotiana tabacum]
Length=346

 Score =   206 bits (524),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 4/206 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT++DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYSDPTVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP ++ EDE K +FS YG VV+
Sbjct  73    IAETHIINDKQVEIKRTIPKGSAESKDF-KTKKIFVGGIPTSMNEDEFKGFFSKYGKVVD  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS-  928
              +I+ DH + RSRGFGF+ FDNE  V  VLS+G M ++ G QVEIK+AEPK+     +S 
Sbjct  132   CEIIRDHVSKRSRGFGFIVFDNELVVDNVLSEGNMIDMLGTQVEIKKAEPKKPSNPASSG  191

Query  927   --EGRMHRGNSNMHSYGNVNGDAEDF  856
                G   RG     SYG        F
Sbjct  192   HGYGSESRGRGYSDSYGGFGNSYSSF  217



>ref|XP_010676082.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Beta vulgaris 
subsp. vulgaris]
Length=347

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   F ++F KYGE+ DSVIM D+ SG+PRGFGFIT+ADP V ++V
Sbjct  16    SPGKIFIGGLPKDTTSTIFLKHFGKYGEITDSVIMKDRYSGQPRGFGFITYADPSVVDKV  75

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ HVI+G+ VE+KRT+P+     +   KTKKIFVGGIP +++E+E + +FS +G+V E
Sbjct  76    MEDSHVINGKQVEIKRTIPKGAAQSKDF-KTKKIFVGGIPSSVSEEEFRGFFSQFGTVAE  134

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             HQI+ DH T RSRGFGF+ FD+E+ V ++L+ G M ++ G QVEIK+AEPK+
Sbjct  135   HQIIRDHETNRSRGFGFIVFDSEEVVDEILTKGNMIDMEGTQVEIKKAEPKK  186


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  1188  KIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSD  1009
             KIF+GG+P   T     ++F  YG + +  IM D  +G+ RGFGF+T+ +   V KV+ D
Sbjct  19    KIFIGGLPKDTTSTIFLKHFGKYGEITDSVIMKDRYSGQPRGFGFITYADPSVVDKVMED  78

Query  1008  GRMHELNGKQVEIKRAEPKRA  946
                H +NGKQVEIKR  PK A
Sbjct  79    --SHVINGKQVEIKRTIPKGA  97



>gb|KDO55125.1| hypothetical protein CISIN_1g016617mg [Citrus sinensis]
Length=386

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 145/203 (71%), Gaps = 6/203 (3%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             H+ D ++P  GK+F+GG+A ETS   F ++F KYGE+ DSVIM D+ +G+PRGFGF+T+A
Sbjct  33    HTGDGASP--GKIFIGGLARETSSAQFIKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYA  90

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V+++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP ++ EDE K++F
Sbjct  91    DPSVVDKVIEDTHIINGKQVEIKRTIPKGAVGSKDF-KTKKIFVGGIPSSVNEDEFKDFF  149

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
               +G V EHQIM DH+T RSRGFGF+TFD E AV  +L+ G   EL G QVE+K+AEPK+
Sbjct  150   MQFGDVQEHQIMRDHSTSRSRGFGFITFDTEQAVDDLLAKGNKLELAGAQVEVKKAEPKK  209

Query  948   AGGDRASEGRMHRGNSNMHSYGN  880
                 + S     R N+   +YG+
Sbjct  210   PNLPQPS---YRRYNNPKPAYGS  229



>gb|KCW52930.1| hypothetical protein EUGRSUZ_J02246 [Eucalyptus grandis]
Length=383

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = -2

Query  1488  HSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFA  1309
             HS D ++P  GK+F+GG+A ET+   F +YFSKYG++ DSVIM D+ +G+PRGFGF+T+A
Sbjct  31    HSGDGASP--GKIFIGGLARETTTAQFVKYFSKYGDITDSVIMRDRKTGQPRGFGFVTYA  88

Query  1308  DPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYF  1129
             DP V ++V++E H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP  +TEDE K++F
Sbjct  89    DPSVVDKVIEETHIINGKQVEIKRTIPKGAAGSKDF-KTKKIFVGGIPTAVTEDEFKDFF  147

Query  1128  SSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAE  958
             + +G V EHQIM DH+T RSRGFGF+TF++E AV  +L+ G   EL G QVEIK+AE
Sbjct  148   TQFGEVKEHQIMRDHSTNRSRGFGFITFESELAVDDLLAKGNRLELAGAQVEIKKAE  204



>ref|XP_009420757.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 129/193 (67%), Gaps = 23/193 (12%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+E+    +F  YGEV+D+VIM DKV+GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETTEDKLKDHFGNYGEVLDAVIMRDKVTGRPRGFGFVVFADPALLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS----------------------KTKKIFVGGIP  1165
             + H IDGR V+ KR + RE+      S                      +TKKIFVGG+P
Sbjct  66    DNHTIDGRTVDAKRALSREEQQMSARSGNTTSGNPTSGRSAGAGAGANIRTKKIFVGGLP  125

Query  1164  PTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNG  985
             PTLTED  ++YF S+G+V +  +M D NT R RGFGF++FD+ED V KVL     H+LNG
Sbjct  126   PTLTEDGFRQYFESFGTVTDAVVMYDQNTHRPRGFGFISFDSEDTVDKVLQK-TFHDLNG  184

Query  984   KQVEIKRAEPKRA  946
             K VE+KRA PK A
Sbjct  185   KPVEVKRALPKDA  197



>gb|KDO59188.1| hypothetical protein CISIN_1g018875mg [Citrus sinensis]
Length=349

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+  +T+   FN++F KYG++ DSVIM D+ +G+P
Sbjct  2     GSKSKSDNPHTGDGASP--GKIFIGGLPKDTTYATFNKHFGKYGDITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V ++V+++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP ++
Sbjct  60    RGFGFITYADPSVVDKVIEDTHIINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSSV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             +EDELK +FS YG V+EHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++ G QV
Sbjct  119   SEDELKNFFSKYGKVLEHQIIRDHETNRSRGFGFVIFDSEEVVDEMLSKGNMIDMAGTQV  178

Query  975   EIKRAE  958
             EIK+AE
Sbjct  179   EIKKAE  184



>ref|XP_006474836.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Citrus 
sinensis]
Length=349

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS +  +  H+ D ++P  GK+F+GG+  +T+   FN++F KYG++ DSVIM D+ +G+P
Sbjct  2     GSKSKADNPHTGDGASP--GKIFIGGLPKDTTYATFNKHFGKYGDITDSVIMKDRYTGQP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTL  1156
             RGFGFIT+ADP V ++V+++ H+I+G+ VE+KRT+P+     +   KTKKIFVGGIP ++
Sbjct  60    RGFGFITYADPSVVDKVIEDTHIINGKQVEIKRTIPKGSGQSKDF-KTKKIFVGGIPSSV  118

Query  1155  TEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQV  976
             +EDELK +FS YG V+EHQI+ DH T RSRGFGFV FD+E+ V ++LS G M ++ G QV
Sbjct  119   SEDELKNFFSKYGKVLEHQIIRDHETNRSRGFGFVIFDSEEVVDEMLSKGNMIDMAGTQV  178

Query  975   EIKRAE  958
             EIK+AE
Sbjct  179   EIKKAE  184



>ref|XP_009598594.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=346

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 4/206 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT++DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYSDPTVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP ++ EDE K +FS YG VV+
Sbjct  73    IAETHIINDKQVEIKRTIPKGSAESKDF-KTKKIFVGGIPTSMNEDEFKGFFSKYGKVVD  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRAS-  928
              +I+ DH + RSRGFGF+ FDNE  V  VLS+G M ++ G QVEIK+AEPK+     +S 
Sbjct  132   CEIIRDHVSKRSRGFGFIVFDNELVVDNVLSEGNMIDMLGTQVEIKKAEPKKPSNPASSG  191

Query  927   --EGRMHRGNSNMHSYGNVNGDAEDF  856
                G   RG     SYG        F
Sbjct  192   HGYGSESRGRGYSDSYGGFGNSYSSF  217



>ref|XP_008346177.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=429

 Score =   208 bits (529),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 132/186 (71%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GG+AW+T+E+    YF++YG+V  +VIM DKV+GRPRGFGF+ F+DP + +RVL 
Sbjct  6     GKLFIGGLAWDTNEDKLTDYFNQYGDVTQTVIMRDKVTGRPRGFGFVVFSDPSLIDRVLN  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFR-------RVS------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR+VE KR + RE+  T +R       R S      KTKKIFVGG+P TLTED 
Sbjct  66    DKHTIDGRLVEAKRAISREEQQTSYRTGNFNTTRSSGGGGNFKTKKIFVGGLPSTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +E+F +YG+V +  IM D NT R RGFGF+TFD EDAV  VL     HELNGK VE+KR
Sbjct  126   FREFFENYGTVTDVVIMYDQNTQRPRGFGFITFDTEDAVDGVLQK-NYHELNGKLVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_006857465.1| hypothetical protein AMTR_s00067p00185510 [Amborella trichopoda]
 gb|ERN18932.1| hypothetical protein AMTR_s00067p00185510 [Amborella trichopoda]
Length=471

 Score =   209 bits (531),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 21/192 (11%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF KYGEV  +VIM DK++GRPRGFGF+ F DP V +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKDYFGKYGEVSQTVIMRDKITGRPRGFGFVVFTDPSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------------KTKKIFVGGIPP  1162
             ++H IDGR VE KR + RE+      S                     +TKKIFVGG+PP
Sbjct  66    DKHTIDGRTVEAKRALSREEQHNAARSGNPNSARNFGAGSGAAAGSNVRTKKIFVGGLPP  125

Query  1161  TLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGK  982
             TLTE+  ++YF  +G+V +  +M D NT R RGFGF++FD+EDAV +VL     H+LNGK
Sbjct  126   TLTEEGFRQYFEQFGNVTDVVVMYDQNTQRPRGFGFISFDSEDAVDRVLQKSNFHDLNGK  185

Query  981   QVEIKRAEPKRA  946
              VE+KRA PK A
Sbjct  186   YVEVKRALPKDA  197



>ref|XP_006363028.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006363029.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006363030.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Solanum tuberosum]
Length=472

 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 12/180 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+EE    YFS YGEV+++VIM D+ +GR RGFGFI FADP VA+RV++
Sbjct  6     GKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVADRVIK  65

Query  1278  EEHVIDGRVVEVKRTVPRED-TPFRRVS----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H IDGR+VE K+ VPR+D +   R S          +T+KIFVGG+  T+TE + KEY
Sbjct  66    EKHNIDGRMVEAKKAVPRDDQSTISRSSPSIQGSPGPGRTRKIFVGGLASTVTETDFKEY  125

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++ +  +M DHNT R RGFGF+T+D+EDAV KVL     HELNGK VE+KRA PK
Sbjct  126   FEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK-PFHELNGKMVEVKRAVPK  184


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+A   +E  F  YF ++G + D V+M D  + RPRGFGFIT+   +  ++VL +
Sbjct  107   KIFVGGLASTVTETDFKEYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  166

Query  1275  E-HVIDGRVVEVKRTVPREDTPFRRV  1201
               H ++G++VEVKR VP+E +P  R+
Sbjct  167   PFHELNGKMVEVKRAVPKELSPGPRL  192



>ref|XP_008342253.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008343167.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=345

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 140/203 (69%), Gaps = 12/203 (6%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+   F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+ DP V +++
Sbjct  17    SPGKIFIGGLAKDTTLNTFVQYFEKYGEIIDSVIMKDRETGRPRGFGFITYEDPAVVDQL  76

Query  1284  LQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             ++E HVI+G+ VE+KRT+P+   +   F    KTKKIFVGGIPPT TEDE K +FS +G 
Sbjct  77    IEETHVINGKQVEIKRTIPKGAGQGNDF----KTKKIFVGGIPPTFTEDEFKSFFSQFGK  132

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             VVEH+I+ DH T R RGFGFV FD+   V   L++G   ++ G QVEIK+AEPK+A    
Sbjct  133   VVEHEIIRDHVTKRPRGFGFVVFDSNHDVDNALANGNRIDMAGTQVEIKKAEPKKASNPA  192

Query  933   -----ASEGRMHRGNSNMHSYGN  880
                   ++ R H  N    ++G+
Sbjct  193   RVPAFGTDSRAHPYNDRFSAFGD  215



>ref|XP_006413156.1| hypothetical protein EUTSA_v10025172mg [Eutrema salsugineum]
 gb|ESQ54609.1| hypothetical protein EUTSA_v10025172mg [Eutrema salsugineum]
Length=453

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 132/193 (68%), Gaps = 19/193 (10%)
 Frame = -2

Query  1476  DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEV  1297
             +S    GKLF+GGI+W+T EE    YFSKYG+++++VIM D+ +GR RGFGFI FADP V
Sbjct  6     ESVSDLGKLFIGGISWDTDEERLREYFSKYGDLVEAVIMRDRTTGRARGFGFIVFADPSV  65

Query  1296  ANRVLQEEHVIDGRVVEVKRTVPRED--------TPFRRVS----------KTKKIFVGG  1171
             A RV+ E+H+IDGR VE K+ VPR+D        +P   +S          +TKKIFVGG
Sbjct  66    AERVIMEKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGGSGRTKKIFVGG  125

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +P ++TE E K YF  +G++ +  +M DHNT R RGFGF+TFD+E++V  VL     HEL
Sbjct  126   LPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK-TFHEL  184

Query  990   NGKQVEIKRAEPK  952
             NGK VE+KRA PK
Sbjct  185   NGKMVEVKRAVPK  197



>ref|XP_010908648.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010908649.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
Length=501

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 131/180 (73%), Gaps = 12/180 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+E+    YF  YGEV+++VIM D+ +GR RGFGF+ FADP VA RV+ 
Sbjct  7     GKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVAERVIM  66

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H+IDGR+VE K+ VPR+D      S           +TKKIFVGG+P T+TE + K+Y
Sbjct  67    EKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITESDFKKY  126

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++++  +M DHNT R RGFGF+T+D+EDAV KVL +   HELNGK VE+KRA PK
Sbjct  127   FDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN-TFHELNGKMVEVKRAVPK  185


 Score = 81.6 bits (200),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+    +E  F +YF ++G +ID V+M D  + RPRGFGFIT+   +  ++VL  
Sbjct  108   KIFVGGLPSTITESDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN  167

Query  1275  E-HVIDGRVVEVKRTVPREDTP  1213
               H ++G++VEVKR VP+E +P
Sbjct  168   TFHELNGKMVEVKRAVPKELSP  189



>ref|XP_004243541.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323871.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=472

 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 12/180 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+EE    YFS YGEV+++VIM D+ +GR RGFGFI FADP VA+RV++
Sbjct  6     GKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVADRVIK  65

Query  1278  EEHVIDGRVVEVKRTVPRED-TPFRRVS----------KTKKIFVGGIPPTLTEDELKEY  1132
             E+H IDGR+VE K+ VPR+D +   R S          +T+KIFVGG+  T+TE + KEY
Sbjct  66    EKHNIDGRMVEAKKAVPRDDQSTISRSSPSIQGSPGPGRTRKIFVGGLASTVTETDFKEY  125

Query  1131  FSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK  952
             F  +G++ +  +M DHNT R RGFGF+T+D+EDAV KVL     HELNGK VE+KRA PK
Sbjct  126   FEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK-PFHELNGKMVEVKRAVPK  184


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  1455  KLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQE  1276
             K+FVGG+A   +E  F  YF ++G + D V+M D  + RPRGFGFIT+   +  ++VL +
Sbjct  107   KIFVGGLASTVTETDFKEYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  166

Query  1275  E-HVIDGRVVEVKRTVPREDTPFRRV  1201
               H ++G++VEVKR VP+E +P  R+
Sbjct  167   PFHELNGKMVEVKRAVPKELSPGPRL  192



>emb|CDY46690.1| BnaA03g48180D [Brassica napus]
Length=428

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 19/200 (10%)
 Frame = -2

Query  1476  DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEV  1297
             +S    GKLF+GGI+W+T EE    YFSKYG++++SVIM D+ +GR RGFGFI FADP V
Sbjct  2     ESVSDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDRTTGRARGFGFIVFADPSV  61

Query  1296  ANRVLQEEHVIDGRVVEVKRTVPRED--------TPFRRVS----------KTKKIFVGG  1171
             A RV+ E+H+IDGR VE K+ VPR+D        +P   +S          +TKKIFVGG
Sbjct  62    AERVILEKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISSPSQHGGGSNRTKKIFVGG  121

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +P ++TE E K YF  +G++ +  +M DHNT R RGFGF+TFD+E++V  VL     HEL
Sbjct  122   LPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK-TFHEL  180

Query  990   NGKQVEIKRAEPKRAGGDRA  931
             NGK VE+KRA PK      A
Sbjct  181   NGKMVEVKRAVPKEPSSSSA  200



>ref|XP_008372374.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=429

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GG+AW+T+E+    YF++YG+V  +VIM DKV+GRPRGFGF+ F+DP + +RVL 
Sbjct  6     GKLFIGGLAWDTNEDKLTDYFNQYGDVTQTVIMRDKVTGRPRGFGFVVFSDPSLIDRVLN  65

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFR-------RVS------KTKKIFVGGIPPTLTEDE  1144
             ++H IDGR+VE KR   RE+  T +R       R S      KTKKIFVGG+P TLTED 
Sbjct  66    DKHTIDGRLVEAKRAJSREEQQTSYRTGNFNTTRSSGGGGNFKTKKIFVGGLPSTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              +E+F +YG+V +  IM D NT R RGFGF+TFD EDAV  VL     HELNGK VE+KR
Sbjct  126   FREFFENYGTVTDVVIMYDQNTQRPRGFGFITFDTEDAVDGVLQK-NYHELNGKLVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|ADN95984.1| G-strand specific single-stranded telomere-binding protein 2 
[Nicotiana tabacum]
Length=337

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 137/196 (70%), Gaps = 3/196 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+ DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYEDPSVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSAESKDF-KTKKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE  V  +L++G   ++ G QVEIK+AEPK+     ++ 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEQVVDNLLAEGNRTDMMGTQVEIKKAEPKKPSNPASAP  191

Query  924   --GRMHRGNSNMHSYG  883
               G   RG     SYG
Sbjct  192   AYGSDSRGRGYGDSYG  207



>ref|XP_009361531.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=379

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 141/203 (69%), Gaps = 12/203 (6%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A +T+   F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+ DP V +++
Sbjct  51    SPGKIFIGGLAKDTTLNTFVQYFEKYGEIIDSVIMKDRETGRPRGFGFITYEDPAVVDQL  110

Query  1284  LQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             ++E HVI+G+ VE+KRT+P+   +   F    KTKKIFVGGIPPT  EDE K +FS +G 
Sbjct  111   IEETHVINGKQVEIKRTIPKGAGQGNDF----KTKKIFVGGIPPTFPEDEFKSFFSQFGK  166

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             VVEH+I+ DH T R RGFGFV FD++  V  VL++G   ++ G QVEIK+AEPK+A    
Sbjct  167   VVEHEIIRDHVTKRPRGFGFVVFDSDHVVDNVLANGNRIDMAGTQVEIKKAEPKKASNPA  226

Query  933   -----ASEGRMHRGNSNMHSYGN  880
                   ++ R H  N    ++G+
Sbjct  227   RVPAFGTDSRAHPYNDRFGAFGD  249



>emb|CAN68016.1| hypothetical protein VITISV_025150 [Vitis vinifera]
Length=464

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF  YGEV  +V+M DK +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFGSYGEVSQAVVMRDKATGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H+IDGR VE KR + RE+      +               KTKKIFVGG+PPTL+E+ 
Sbjct  66    EKHIIDGRTVEAKRALSREEQQTSSRAGNFNSARNSGGGGNVKTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF ++G V +  +M D +T R RGFGFV+FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAFGHVTDVVVMYDQSTQRPRGFGFVSFDTEDAVDRVLYK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>gb|ADE75708.1| unknown [Picea sitchensis]
Length=396

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 9/188 (5%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+F+GGI+W+TSE+    YF  YG+V+D VIM D+ +GR RGFGF+ F DP VA+RV+Q
Sbjct  6     GKIFIGGISWDTSEDRLKDYFGNYGQVVDVVIMKDRTTGRARGFGFVVFGDPSVADRVIQ  65

Query  1278  EEHVIDGRVVEVKRTVPR-EDTPFRRVS-----KTKKIFVGGIPPTLTEDELKEYFSSYG  1117
             E+H IDGR VE KR VPR E    +R S     +TKKIFVGG+ PT+TED+ ++YF  +G
Sbjct  66    EKHTIDGRAVEAKRVVPRDEQQNVQRTSNMAGPRTKKIFVGGLAPTVTEDDFRKYFEQFG  125

Query  1116  SVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPK--RAG  943
             ++ +  +M DH T R RGFGF+T+D+EDAV KVL     H+L  K VE+KRA PK    G
Sbjct  126   NITDVVVMYDHTTQRHRGFGFITYDSEDAVDKVLQQ-TFHQLKEKTVEVKRAIPKDMSPG  184

Query  942   GDRASEGR  919
               R S GR
Sbjct  185   NTRGSAGR  192


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -2

Query  1500  HELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGF  1321
               ++ + + + P   K+FVGG+A   +E+ F +YF ++G + D V+M D  + R RGFGF
Sbjct  87    QNVQRTSNMAGPRTKKIFVGGLAPTVTEDDFRKYFEQFGNITDVVVMYDHTTQRHRGFGF  146

Query  1320  ITFADPEVANRVLQEE-HVIDGRVVEVKRTVPREDTP  1213
             IT+   +  ++VLQ+  H +  + VEVKR +P++ +P
Sbjct  147   ITYDSEDAVDKVLQQTFHQLKEKTVEVKRAIPKDMSP  183



>ref|XP_006857740.1| hypothetical protein AMTR_s00061p00188860 [Amborella trichopoda]
 gb|ERN19207.1| hypothetical protein AMTR_s00061p00188860 [Amborella trichopoda]
Length=354

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 133/173 (77%), Gaps = 1/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+  +T+   F ++F KYGE+ DSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  23    SQGKIFIGGLPKDTTPATFTKHFGKYGEITDSVIMKDRYTGQPRGFGFITYADPSVVDKV  82

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             ++++H+I+G+ VE+KRT+P+  T   +V KTKKIFVGG+P  +TEDE K +FS YG VV+
Sbjct  83    IEDDHIINGKQVEIKRTIPK-GTLQSKVFKTKKIFVGGVPTNVTEDEFKNFFSKYGKVVD  141

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             HQI+ DH+T RSRGFGF+ FD+E  V  +++ G M +    QVE+++AEPK++
Sbjct  142   HQIIRDHSTNRSRGFGFIIFDSEKVVDDLVAKGNMIDFGDTQVEVRKAEPKKS  194



>emb|CDX92807.1| BnaC07g40650D [Brassica napus]
Length=450

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 19/200 (10%)
 Frame = -2

Query  1476  DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEV  1297
             +S    GKLF+GGI+W+T EE    YFSKYG++++SVIM D+ +GR RGFGFI FADP V
Sbjct  2     ESVSDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDRTTGRARGFGFIVFADPSV  61

Query  1296  ANRVLQEEHVIDGRVVEVKRTVPRED--------TPFRRVS----------KTKKIFVGG  1171
             A RV+ E+H+IDGR VE K+ VPR+D        +P   +S          +TKKIFVGG
Sbjct  62    AERVILEKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISSPSQHGGGSNRTKKIFVGG  121

Query  1170  IPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHEL  991
             +P ++TE E K YF  +G++ +  +M DHNT R RGFGF+TFD+E++V  VL     HEL
Sbjct  122   LPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK-TFHEL  180

Query  990   NGKQVEIKRAEPKRAGGDRA  931
             NGK VE+KRA PK      A
Sbjct  181   NGKMVEVKRAVPKEPSSSSA  200



>ref|XP_003553735.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Glycine 
max]
 gb|KHN28505.1| Nuclear polyadenylated RNA-binding protein 4 [Glycine soja]
Length=374

 Score =   206 bits (523),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ +G+PRGFGFIT+ADP V + V
Sbjct  42    SPGKIFIGGLARETTIAQFIKHFGKYGEITDSVIMKDRKTGQPRGFGFITYADPSVVDTV  101

Query  1284  LQEEHVIDGRVVEVKRTVPR-----EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSY  1120
             +++ H+I+G+ VE+KRT+PR         FR    TKKIFVGGIP T+TEDE +++F+ Y
Sbjct  102   IEDTHIINGKQVEIKRTIPRGAAGSNSKDFR----TKKIFVGGIPSTVTEDEFRDFFTRY  157

Query  1119  GSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKR  949
             G V +HQIM DH+T RSRGFGF+T+D+E+AV  +LS G   E  G QVEIK+AEPK+
Sbjct  158   GEVKDHQIMRDHSTNRSRGFGFITYDSEEAVDDLLSVGNKIEFAGAQVEIKKAEPKK  214



>ref|XP_009140012.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2 [Brassica rapa]
Length=424

 Score =   207 bits (526),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             SAGK+FVGG+A ET+   F ++F KYGE+ DSVIM D+ +G+PRGFGF+T+AD  V +++
Sbjct  40    SAGKIFVGGLARETTSAEFVKHFEKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKL  99

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +Q+ H+I+G+ VE+KRT+PR         KTKKIFVGGIP T+ +DE KE+F  +G + E
Sbjct  100   IQDNHIINGKQVEIKRTIPRGSMSSSNEIKTKKIFVGGIPSTVDDDEFKEFFMQFGELKE  159

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIM DH TGRSRGFGFVT+++E+ V  +L+ G   EL+G QVEIK+AEPK+        
Sbjct  160   HQIMRDHATGRSRGFGFVTYESEEMVDLLLAKGNRIELSGTQVEIKKAEPKKPNSVTTPS  219

Query  924   GRMHRGNSNM  895
              R     SN 
Sbjct  220   RRFGDSRSNF  229



>gb|KGN61572.1| hypothetical protein Csa_2G171930 [Cucumis sativus]
Length=568

 Score =   210 bits (535),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 17/187 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YFS YGEV+ +V+M DK++ RPRGFGF+ F+DP V +RVLQ
Sbjct  112   GKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDKITSRPRGFGFVVFSDPSVLDRVLQ  171

Query  1278  EEHVIDGRVVEVKRTVPRED--TPFRRVS--------------KTKKIFVGGIPPTLTED  1147
             ++H IDG+ VE KR + RE+  TP R  +              +TKKIFVGG+PPTLTE+
Sbjct  172   DKHTIDGKTVEAKRALSREEQQTPARASNSNGRNSGGSGGGNMRTKKIFVGGLPPTLTEE  231

Query  1146  ELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIK  967
               KEYF +YG V +  +M D NT R RGFGF++FD E+AV +VL     H+LNGKQVE+K
Sbjct  232   GFKEYFEAYGHVTDVVVMYDQNTRRPRGFGFISFDTEEAVDRVLHK-TFHDLNGKQVEVK  290

Query  966   RAEPKRA  946
             RA PK A
Sbjct  291   RALPKDA  297



>ref|XP_002285419.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=464

 Score =   208 bits (529),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF  YGEV  +V+M DK +GRPRGFGF+ FADP + +RVLQ
Sbjct  6     GKLFIGGISWETSEDKLKEYFGSYGEVSQAVVMRDKATGRPRGFGFVVFADPSILDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H+IDGR VE KR + RE+      +               KTKKIFVGG+PPTL+E+ 
Sbjct  66    EKHIIDGRTVEAKRALSREEQQTSSRAGNFNSARNSGGGGNVKTKKIFVGGLPPTLSEEG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF ++G V +  +M D +T R RGFGFV+FD EDAV +VL     H+LNGKQVE+KR
Sbjct  126   FRQYFEAFGHVTDVVVMYDQSTQRPRGFGFVSFDTEDAVDRVLYK-TFHDLNGKQVEVKR  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>ref|XP_009137608.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brassica 
rapa]
Length=462

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 20/201 (10%)
 Frame = -2

Query  1476  DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEV  1297
             +S    GKLF+GGI+W+T EE    YFSKYG++++SVIM D+ +GR RGFGFI FADP V
Sbjct  6     ESVSDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDRTTGRARGFGFIVFADPSV  65

Query  1296  ANRVLQEEHVIDGRVVEVKRTVPRED--------TPFRRVS-----------KTKKIFVG  1174
             A RV+ E+H+IDGR VE K+ VPR+D        +P   +S           +TKKIFVG
Sbjct  66    AERVILEKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISSSPSQHGGGSNRTKKIFVG  125

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             G+P ++TE E K YF  +G++ +  +M DHNT R RGFGF+TFD+E++V  VL     HE
Sbjct  126   GLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK-TFHE  184

Query  993   LNGKQVEIKRAEPKRAGGDRA  931
             LNGK VE+KRA PK      A
Sbjct  185   LNGKMVEVKRAVPKEPSSSSA  205



>emb|CDY46689.1| BnaA03g48190D [Brassica napus]
Length=463

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 20/201 (10%)
 Frame = -2

Query  1476  DSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEV  1297
             +S    GKLF+GGI+W+T EE    YFSKYG++++SVIM D+ +GR RGFGFI FADP V
Sbjct  2     ESVSDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDRTTGRARGFGFIVFADPSV  61

Query  1296  ANRVLQEEHVIDGRVVEVKRTVPRED--------TPFRRVS-----------KTKKIFVG  1174
             A RV+ E+H+IDGR VE K+ VPR+D        +P   +S           +TKKIFVG
Sbjct  62    AERVILEKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISSSPSQHGGGSNRTKKIFVG  121

Query  1173  GIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHE  994
             G+P ++TE E K YF  +G++ +  +M DHNT R RGFGF+TFD+E++V  VL     HE
Sbjct  122   GLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK-TFHE  180

Query  993   LNGKQVEIKRAEPKRAGGDRA  931
             LNGK VE+KRA PK      A
Sbjct  181   LNGKMVEVKRAVPKEPSSSSA  201



>ref|XP_009404108.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404109.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=477

 Score =   208 bits (529),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 13/181 (7%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T+E+    YF  YGEV+++VIM D+ +GR RGFGFI FADP VA RV+ 
Sbjct  6     GKLFIGGISWDTNEDRLREYFRNYGEVVEAVIMKDRTTGRARGFGFIVFADPAVAERVVM  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS------------KTKKIFVGGIPPTLTEDELKE  1135
             E+H+IDGR+VE K+ VPR+D      +            +TKKIFVGG+P TLTE + K+
Sbjct  66    EKHLIDGRMVEAKKAVPRDDQQILNRNNSSVHGSPGPGGRTKKIFVGGLPSTLTESDFKK  125

Query  1134  YFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEP  955
             YF  +G++ +  +M DHNT R RGFGF+T+D+EDAV +VL     HELNGK VE+KRA P
Sbjct  126   YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLFK-SFHELNGKMVEVKRAVP  184

Query  954   K  952
             K
Sbjct  185   K  185



>ref|XP_009764592.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=339

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 137/196 (70%), Gaps = 3/196 (2%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+ E F +YF KYGE+IDSVIM D+ +GRPRGFGFIT+ DP V + V
Sbjct  13    SPGKIFIGGLAKETTLEQFVKYFEKYGEIIDSVIMKDRHTGRPRGFGFITYEDPSVVDTV  72

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             + E H+I+ + VE+KRT+P+     +   KTKKIFVGGIP T+TEDE K +FS +G V E
Sbjct  73    IAENHIINDKQVEIKRTIPKGSAESKDF-KTKKIFVGGIPTTMTEDEFKNFFSKFGKVTE  131

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             ++I+ DH + RSRGFGF+ FDNE  V  +L++G   ++ G QVEIK+AEPK+     ++ 
Sbjct  132   YEIIRDHVSKRSRGFGFIVFDNEQVVDNLLAEGNRIDMMGTQVEIKKAEPKKPSNPASAP  191

Query  924   --GRMHRGNSNMHSYG  883
               G   RG     SYG
Sbjct  192   AYGSDSRGRGYGDSYG  207



>ref|XP_008802392.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Phoenix 
dactylifera]
Length=459

 Score =   207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 138/217 (64%), Gaps = 18/217 (8%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WET+EE    YFS+YGEV+ +VIM DK++GRPRGFGF+ FAD  V +RVLQ
Sbjct  6     GKLFIGGISWETTEEKMKEYFSEYGEVLQTVIMRDKMTGRPRGFGFVVFADLSVLDRVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS-----------------KTKKIFVGGIPPTLTE  1150
             ++H IDGR VE KR + RE+    +                   +TKKIFVGG+PPTLTE
Sbjct  66    DKHTIDGRTVEAKRALSREEQQASKSGNPNVGRSGGGPVSGGNFRTKKIFVGGLPPTLTE  125

Query  1149  DELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEI  970
             +  ++YF  YG V +  +M D NT R RGFGF++F +EDAV +VL     HELNGK VE+
Sbjct  126   ETFRQYFQGYGEVDDVVVMYDQNTHRPRGFGFISFKSEDAVDRVLHK-TFHELNGKLVEV  184

Query  969   KRAEPKRAGGDRASEGRMHRGNSNMHSYGNVNGDAED  859
             KRA PK A    AS   +  G    +S   VN  + D
Sbjct  185   KRALPKDANPSNASGRSITGGPYQTNSVSGVNMSSYD  221



>emb|CDY24201.1| BnaC01g37810D [Brassica napus]
Length=362

 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 151/216 (70%), Gaps = 14/216 (6%)
 Frame = -2

Query  1515  GSSAGHELKHSIDDSTPSAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRP  1336
             GS + +E   S D ++P  GK+F+GG+  +T+   FN++F KYGE+ DSVIM D+ +G P
Sbjct  2     GSRSRNENFQSGDGASP--GKIFIGGLHKDTTNTEFNKHFGKYGEITDSVIMRDRHTGLP  59

Query  1335  RGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPR-------EDTPFRRVSKTKKIFV  1177
             RGFGFITFADP V ++V+++ H  +G+ VE+KRT+P+       +   F    KTKKIFV
Sbjct  60    RGFGFITFADPSVVDQVIEDTHTFNGKQVEIKRTIPKGAAGGGNQSKDF----KTKKIFV  115

Query  1176  GGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMH  997
             GGIP ++TEDELK++F+ YG++VEHQI+ DH T RSRGFGFV FD+E+ V ++LS G M 
Sbjct  116   GGIPSSVTEDELKDFFAKYGTIVEHQIIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMV  175

Query  996   ELNGKQVEIKRAEPKRAGG-DRASEGRMHRGNSNMH  892
             ++   QVEIK+AEPK++      S G   RG S+ +
Sbjct  176   DMADTQVEIKKAEPKKSSNRSPPSYGSHPRGRSSFN  211



>gb|KHG09558.1| DAZ-associated protein 1 [Gossypium arboreum]
Length=457

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+WETSE+    YF +YG+++ +V+M DKV+GRPRGFGF+ F+DP V + VLQ
Sbjct  6     GKLFIGGISWETSEDRLKEYFGQYGDILQTVVMRDKVTGRPRGFGFVVFSDPSVIDTVLQ  65

Query  1278  EEHVIDGRVVEVKRTVPREDTPFRRVS---------------KTKKIFVGGIPPTLTEDE  1144
             E+H IDGR VE KR + RE+      S               +TKKIFVGG+PPTLTED 
Sbjct  66    EKHTIDGRTVEAKRALSREEQQTSARSGNFNQGRNSGGGGNIRTKKIFVGGLPPTLTEDG  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              ++YF +YG V +  IM D NT R RGFGF++FD+E+AV +VL     H+LNGKQVE+K 
Sbjct  126   FRQYFEAYGHVTDVVIMYDQNTQRPRGFGFISFDSEEAVDRVLHK-SFHDLNGKQVEVKP  184

Query  963   AEPKRA  946
             A PK A
Sbjct  185   ALPKDA  190



>emb|CDY11989.1| BnaC03g14150D [Brassica napus]
Length=432

 Score =   207 bits (526),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 128/184 (70%), Gaps = 16/184 (9%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GKLF+GGI+W+T EE    YF+ YG+V+++VIM D+ +GR RGFGFI FADP VA RV+ 
Sbjct  6     GKLFIGGISWDTDEERLREYFTNYGDVVEAVIMRDRATGRARGFGFIVFADPSVAERVIL  65

Query  1278  EEHVIDGRVVEVKRTVPRED---------------TPFRRVSKTKKIFVGGIPPTLTEDE  1144
             E+H+IDGR VE K+ VPR+D               +P     +TKKIFVGG+P ++TE E
Sbjct  66    EKHIIDGRTVEAKKAVPRDDHQQVMKRHASPVHLMSPLHGGGRTKKIFVGGLPSSITETE  125

Query  1143  LKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKR  964
              K YF  +G++ +  +M DHNT R RGFGF+TFD++DAV +VL     HELNGK VE+KR
Sbjct  126   FKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHK-TFHELNGKLVEVKR  184

Query  963   AEPK  952
             A PK
Sbjct  185   AVPK  188



>ref|XP_008379218.1| PREDICTED: LOW QUALITY PROTEIN: heterogeneous nuclear ribonucleoprotein 
A0 [Malus domestica]
Length=386

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 140/207 (68%), Gaps = 9/207 (4%)
 Frame = -2

Query  1545  DLEPPIHSLDGSSAGHELKHSIDDST--------PSAGKLFVGGIAWETSEECFNRYFSK  1390
             +L+   H ++G    HE     D S          S+GK+F+GG+A  T+   F ++F  
Sbjct  9     NLDGEAHDINGPDHRHEAAEDDDYSRSQPHTGDGASSGKIFIGGLARRTTTAEFIKHFGA  68

Query  1389  YGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQEEHVIDGRVVEVKRTVPREDTPF  1210
             YGE+IDSVIM D+  G+PRGFGF+T+ADP V ++V+++ HVI+ R VE+KRT+PR     
Sbjct  69    YGEIIDSVIMKDRKMGQPRGFGFVTYADPSVVDKVIEDVHVINDRQVEIKRTIPR-GAMV  127

Query  1209  RRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEHQIMLDHNTGRSRGFGFVTFDNEDA  1030
              +  KTKKIFVGGIP T+ E+E  ++FS YG V EHQIM DH+TGRSRGFGFVTFD E A
Sbjct  128   SKDFKTKKIFVGGIPTTVNEEEFSDFFSQYGEVKEHQIMRDHSTGRSRGFGFVTFDTEQA  187

Query  1029  VQKVLSDGRMHELNGKQVEIKRAEPKR  949
             V ++L  G   E  G QVEIK+AEPK+
Sbjct  188   VDELLDKGNKLEFAGAQVEIKKAEPKK  214



>ref|XP_003573706.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brachypodium 
distachyon]
Length=347

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S  K+F+GG++ ETS   F  YF KYGE+ID+VIM D+ + +PRGFGFITF+DP + +RV
Sbjct  12    SPAKIFIGGLSKETSLGTFKEYFGKYGEIIDAVIMKDRYTQKPRGFGFITFSDPAIVDRV  71

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ HVIDG+ VE+KRT+P+   P +   KTKKIFVGG+  TL +DE K++FS +G VVE
Sbjct  72    IEDNHVIDGKQVEIKRTIPKGAAPLKDF-KTKKIFVGGLVSTLKDDEFKDFFSKFGKVVE  130

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLS-DGRMHELNGKQVEIKRAEPKR  949
             H+I+ DH+T +SRGFGF+ FD E  V ++L+  G M +L+G QVEIK+AEPK+
Sbjct  131   HEIIRDHSTNKSRGFGFIVFDAEKTVDELLAKKGNMIDLDGTQVEIKKAEPKK  183



>gb|KHN27466.1| Heterogeneous nuclear ribonucleoprotein 27C [Glycine soja]
Length=365

 Score =   204 bits (520),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+F+GG+A ET+   F ++F KYGE+ DSVIM D+ +G+PRGFGFIT+ADP V ++V
Sbjct  40    SPGKIFIGGLARETTIAQFIKHFGKYGEITDSVIMKDRKTGQPRGFGFITYADPSVVDKV  99

Query  1284  LQEEHVIDGRVVEVKRTVPREDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVE  1105
             +++ H+I+G+ VE+KRT+PR     +   +TKKIFVGGIP  +TEDE +++F+ YG V +
Sbjct  100   IEDPHIINGKQVEIKRTIPRGAVGSKDF-RTKKIFVGGIPSNVTEDEFRDFFTRYGEVKD  158

Query  1104  HQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDRASE  925
             HQIM DH+T RSRGFGF+TFD+E+AV  +LS G   +  G QVEIK+AEPK+      S 
Sbjct  159   HQIMRDHSTNRSRGFGFITFDSEEAVDDLLSMGNKIDFAGSQVEIKKAEPKKPSSAPPSS  218

Query  924   GR  919
              R
Sbjct  219   KR  220



>ref|NP_001137092.1| uncharacterized protein LOC100217268 [Zea mays]
 gb|ACF83251.1| unknown [Zea mays]
 gb|ADX60166.1| SNF2 transcription factor [Zea mays]
 gb|AFW65140.1| hypothetical protein ZEAMMB73_790427 [Zea mays]
Length=383

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = -2

Query  1458  GKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRVLQ  1279
             GK+FVGG+  +T++  F R+F +YGE++DSVIM D+ + +PRGFGFIT++DP V ++V++
Sbjct  25    GKIFVGGLPRDTTDATFVRHFGQYGEIVDSVIMKDRHTSQPRGFGFITYSDPAVVDKVIE  84

Query  1278  EEHVIDGRVVEVKRTVPREDT-PFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGSVVEH  1102
             + HVI+G+ VE+KRT+P+       +  KTKKIFVGG+P TLTEDE K +F+ YG+VV+H
Sbjct  85    DNHVINGKQVEIKRTIPKGSVQSSSKDFKTKKIFVGGLPSTLTEDEFKSFFARYGTVVDH  144

Query  1101  QIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRA  946
             QIM DH T RSRGFGF+ F +E  V  +L++G M +L G +VEIK+AEPK++
Sbjct  145   QIMFDHETKRSRGFGFIVFASEQVVDDLLANGNMVDLAGSKVEIKKAEPKKS  196



>gb|EMS45801.1| Heterogeneous nuclear ribonucleoprotein 27C [Triticum urartu]
Length=350

 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -2

Query  1464  SAGKLFVGGIAWETSEECFNRYFSKYGEVIDSVIMMDKVSGRPRGFGFITFADPEVANRV  1285
             S GK+FVGG+  +T+   F ++F  YGE++DSVIM +K + +PRGFGFIT++DP + ++V
Sbjct  16    SPGKIFVGGLPRDTTLATFQKHFGNYGEIVDSVIMKNKQTSQPRGFGFITYSDPAIVDKV  75

Query  1284  LQEEHVIDGRVVEVKRTVPR---EDTPFRRVSKTKKIFVGGIPPTLTEDELKEYFSSYGS  1114
             +++ HVI+G+ VE+KRT+P+   +  P  +  +TKKIFVGG+PP LTED  K++F  YG+
Sbjct  76    MEDTHVINGKQVEIKRTIPKDYMQSNP--KDFRTKKIFVGGLPPILTEDNFKDFFEKYGA  133

Query  1113  VVEHQIMLDHNTGRSRGFGFVTFDNEDAVQKVLSDGRMHELNGKQVEIKRAEPKRAGGDR  934
             VVEHQIM DH T RSRGFGFV F++E+ V  +L++G M +L G +VEIK+AEPK++    
Sbjct  134   VVEHQIMHDHQTRRSRGFGFVVFESEEVVDDLLANGNMIDLAGSKVEIKKAEPKKSSNLP  193

Query  933   ASEGRMHR  910
              S G   R
Sbjct  194   TSTGSDSR  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5297892630300