BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13641_g1_i1 len=1126 path=[2332:0-855 4574:856-1125]

Length=1126
                                                                      Score     E

ref|XP_009782231.1|  PREDICTED: uncharacterized protein At1g04910...    301   2e-93   
ref|XP_009604992.1|  PREDICTED: uncharacterized protein At1g04910...    301   2e-93   
ref|XP_010327510.1|  PREDICTED: uncharacterized protein At1g04910...    296   3e-93   
ref|XP_006341331.1|  PREDICTED: uncharacterized protein At1g04910...    296   1e-91   
ref|XP_004248822.1|  PREDICTED: uncharacterized protein At1g04910...    295   1e-91   
ref|XP_009626180.1|  PREDICTED: uncharacterized protein At1g04910...    293   2e-90   
ref|XP_004229593.1|  PREDICTED: uncharacterized protein At1g04910...    293   3e-90   
ref|XP_006366494.1|  PREDICTED: uncharacterized protein At1g04910...    293   5e-90   
ref|XP_009778494.1|  PREDICTED: uncharacterized protein At1g04910...    291   2e-89   
gb|ACJ85641.1|  unknown                                                 269   2e-85   Medicago truncatula
ref|XP_011093377.1|  PREDICTED: uncharacterized protein At1g04910...    280   3e-85   
ref|XP_010067896.1|  PREDICTED: uncharacterized protein At1g04910       280   7e-85   
ref|XP_009365036.1|  PREDICTED: uncharacterized protein At1g04910...    280   8e-85   
ref|XP_003539654.1|  PREDICTED: uncharacterized protein At1g04910...    279   1e-84   
ref|XP_011087180.1|  PREDICTED: uncharacterized protein At1g04910       278   3e-84   
gb|EYU31341.1|  hypothetical protein MIMGU_mgv1a006110mg                275   3e-84   
emb|CDP07710.1|  unnamed protein product                                276   6e-84   
gb|AAK91401.1|  At2g44500/F4I1.31                                       266   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298576.2|  hypothetical protein POPTR_0001s23420g             277   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011007093.1|  PREDICTED: uncharacterized protein At1g04910...    276   3e-83   
ref|XP_008350154.1|  PREDICTED: uncharacterized protein At1g04910...    276   3e-83   
ref|XP_008375138.1|  PREDICTED: uncharacterized protein At1g04910...    276   4e-83   
ref|XP_011042011.1|  PREDICTED: uncharacterized protein At1g04910       275   8e-83   
ref|XP_009354686.1|  PREDICTED: uncharacterized protein At1g04910...    275   8e-83   
ref|XP_002266606.1|  PREDICTED: uncharacterized protein At1g04910       273   8e-83   Vitis vinifera
ref|XP_010257422.1|  PREDICTED: uncharacterized protein At1g04910...    274   9e-83   
ref|XP_002313473.2|  hypothetical protein POPTR_0009s02760g             275   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_007133850.1|  hypothetical protein PHAVU_011G214200g             273   3e-82   
ref|XP_006482836.1|  PREDICTED: uncharacterized protein At1g04910...    273   3e-82   
ref|XP_006482837.1|  PREDICTED: uncharacterized protein At1g04910...    272   3e-82   
ref|XP_010095397.1|  hypothetical protein L484_013070                   271   4e-82   
gb|AES69266.2|  GDP-fucose protein O-fucosyltransferase                 272   5e-82   
ref|XP_004506509.1|  PREDICTED: uncharacterized protein At1g04910...    273   5e-82   
gb|KDP43418.1|  hypothetical protein JCGZ_16705                         267   8e-82   
gb|EYU27099.1|  hypothetical protein MIMGU_mgv1a004188mg                271   8e-82   
ref|XP_003599015.1|  Growth regulator like protein                      273   1e-81   
ref|XP_007149066.1|  hypothetical protein PHAVU_005G038100g             272   1e-81   
ref|XP_004149620.1|  PREDICTED: DUF246 domain-containing protein ...    271   1e-81   
gb|KDO83491.1|  hypothetical protein CISIN_1g008992mg                   271   1e-81   
ref|XP_003534702.1|  PREDICTED: uncharacterized protein At1g04910...    271   1e-81   
ref|XP_006293918.1|  hypothetical protein CARUB_v10022909mg             271   1e-81   
gb|KGN58618.1|  hypothetical protein Csa_3G702070                       271   2e-81   
ref|XP_008461772.1|  PREDICTED: uncharacterized protein At1g04910       271   2e-81   
ref|XP_008231325.1|  PREDICTED: uncharacterized protein At1g04910...    271   2e-81   
ref|XP_010508287.1|  PREDICTED: uncharacterized protein At1g04910...    271   3e-81   
ref|XP_006397629.1|  hypothetical protein EUTSA_v10001372mg             270   3e-81   
ref|XP_003605027.1|  DUF246 domain-containing protein                   271   4e-81   
gb|KHN29192.1|  DUF246 domain-containing protein                        270   6e-81   
ref|XP_004161417.1|  PREDICTED: DUF246 domain-containing protein ...    270   7e-81   
ref|XP_010065185.1|  PREDICTED: uncharacterized protein At1g04910...    269   1e-80   
ref|XP_004306502.1|  PREDICTED: uncharacterized protein At1g04910...    269   1e-80   
ref|XP_007220633.1|  hypothetical protein PRUPE_ppa003424mg             269   2e-80   
ref|XP_002880120.1|  hypothetical protein ARALYDRAFT_483577             268   2e-80   
gb|KHN49038.1|  DUF246 domain-containing protein                        268   2e-80   
ref|XP_003546867.1|  PREDICTED: uncharacterized protein At1g04910...    268   2e-80   
ref|XP_010518045.1|  PREDICTED: uncharacterized protein At1g04910...    268   3e-80   
gb|KFK37254.1|  hypothetical protein AALP_AA4G233800                    268   3e-80   
ref|XP_007052598.1|  O-fucosyltransferase family protein                267   4e-80   
ref|XP_010265849.1|  PREDICTED: uncharacterized protein At1g04910...    266   6e-80   
ref|NP_181978.1|  O-fucosyltransferase family protein                   267   6e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06227.1|  hypothetical protein F383_00226                         266   1e-79   
ref|XP_010673474.1|  PREDICTED: uncharacterized protein At1g04910...    265   2e-79   
ref|XP_010506376.1|  PREDICTED: uncharacterized protein At1g04910...    265   5e-79   
ref|XP_004513144.1|  PREDICTED: uncharacterized protein At1g04910...    264   6e-79   
gb|AAL16192.1|AF428423_1  AT3g07900/F17A17_24                           257   6e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513143.1|  PREDICTED: uncharacterized protein At1g04910...    264   6e-79   
ref|XP_010547235.1|  PREDICTED: uncharacterized protein At1g04910       263   3e-78   
ref|XP_002520639.1|  conserved hypothetical protein                     263   3e-78   Ricinus communis
emb|CDY47678.1|  BnaC04g03810D                                          261   4e-78   
ref|XP_010524461.1|  PREDICTED: uncharacterized protein At1g04910...    260   3e-77   
ref|XP_006850060.1|  hypothetical protein AMTR_s00022p00204610          259   4e-77   
gb|KFK38242.1|  hypothetical protein AALP_AA3G087900                    256   5e-77   
ref|XP_008795748.1|  PREDICTED: uncharacterized protein At1g04910...    259   1e-76   
ref|XP_010544540.1|  PREDICTED: uncharacterized protein At1g04910       258   2e-76   
emb|CDX74661.1|  BnaA05g04070D                                          256   2e-76   
ref|NP_187447.1|  O-fucosyltransferase-like protein                     257   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943561.1|  PREDICTED: uncharacterized protein At1g04910...    256   5e-76   
ref|XP_009143041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    256   5e-76   
ref|XP_006407782.1|  hypothetical protein EUTSA_v10022290mg             256   9e-76   
ref|XP_002882556.1|  hypothetical protein ARALYDRAFT_478129             255   2e-75   
emb|CDY28009.1|  BnaC05g44110D                                          252   3e-75   
ref|XP_010928447.1|  PREDICTED: uncharacterized protein At1g04910...    254   3e-75   
ref|XP_010486367.1|  PREDICTED: uncharacterized protein At1g04910...    254   4e-75   
emb|CDY35972.1|  BnaA05g29780D                                          254   5e-75   
ref|XP_009147015.1|  PREDICTED: uncharacterized protein At1g04910       254   5e-75   
ref|XP_009417302.1|  PREDICTED: uncharacterized protein At1g04910...    252   1e-74   
ref|XP_010464437.1|  PREDICTED: uncharacterized protein At1g04910...    252   3e-74   
ref|XP_008364704.1|  PREDICTED: uncharacterized protein At1g04910...    252   3e-74   
ref|XP_010459424.1|  PREDICTED: uncharacterized protein At1g04910...    251   1e-73   
ref|XP_006299231.1|  hypothetical protein CARUB_v10015380mg             251   1e-73   
ref|XP_008375254.1|  PREDICTED: uncharacterized protein At1g04910...    246   5e-73   
gb|EPS67731.1|  hypothetical protein M569_07044                         234   3e-72   
ref|XP_008812582.1|  PREDICTED: uncharacterized protein At1g04910...    246   4e-72   
ref|XP_009394998.1|  PREDICTED: uncharacterized protein At1g04910...    244   2e-71   
ref|XP_009415424.1|  PREDICTED: uncharacterized protein At1g04910...    243   6e-71   
ref|XP_009405037.1|  PREDICTED: uncharacterized protein At1g04910...    229   1e-65   
ref|XP_002965190.1|  hypothetical protein SELMODRAFT_83648              221   2e-63   
ref|XP_002962277.1|  hypothetical protein SELMODRAFT_76196              219   2e-62   
ref|XP_003589433.1|  DUF246 domain-containing protein                   219   1e-61   
gb|KGN64393.1|  hypothetical protein Csa_1G050320                       202   6e-60   
ref|XP_006840183.1|  hypothetical protein AMTR_s00089p00101430          207   3e-58   
ref|XP_010677955.1|  PREDICTED: uncharacterized protein At1g04910       207   2e-57   
gb|ADN33952.1|  hypothetical protein                                    203   9e-57   
ref|XP_010102888.1|  hypothetical protein L484_002686                   204   2e-56   
ref|XP_008439494.1|  PREDICTED: uncharacterized protein At1g04910       203   1e-55   
ref|XP_004167707.1|  PREDICTED: DUF246 domain-containing protein ...    202   1e-55   
ref|XP_004152592.1|  PREDICTED: DUF246 domain-containing protein ...    202   1e-55   
ref|XP_006477558.1|  PREDICTED: uncharacterized protein At1g04910...    198   6e-55   
ref|XP_010248906.1|  PREDICTED: uncharacterized protein At1g04910       197   7e-54   
ref|XP_004236554.2|  PREDICTED: uncharacterized protein At1g04910       194   2e-53   
ref|XP_010550723.1|  PREDICTED: uncharacterized protein At1g04910...    196   2e-53   
ref|XP_007210126.1|  hypothetical protein PRUPE_ppa022449mg             196   3e-53   
ref|XP_008374303.1|  PREDICTED: uncharacterized protein At1g04910...    196   4e-53   
ref|XP_010550722.1|  PREDICTED: uncharacterized protein At1g04910...    196   5e-53   
ref|XP_009336577.1|  PREDICTED: uncharacterized protein At1g04910...    194   9e-53   
ref|XP_006351561.1|  PREDICTED: uncharacterized protein At1g04910...    194   1e-52   
ref|XP_008239627.1|  PREDICTED: uncharacterized protein At1g04910       195   2e-52   
gb|EYU23112.1|  hypothetical protein MIMGU_mgv1a018918mg                194   2e-52   
ref|XP_009346524.1|  PREDICTED: uncharacterized protein At1g04910...    194   2e-52   
ref|XP_009772998.1|  PREDICTED: uncharacterized protein At1g04910       192   4e-52   
ref|XP_011024396.1|  PREDICTED: uncharacterized protein At1g04910       192   5e-52   
ref|XP_006440070.1|  hypothetical protein CICLE_v10023901mg             192   8e-52   
ref|XP_002322236.1|  hypothetical protein POPTR_0015s10470g             192   9e-52   Populus trichocarpa [western balsam poplar]
ref|XP_008392956.1|  PREDICTED: uncharacterized protein At1g04910...    192   1e-51   
ref|XP_011090093.1|  PREDICTED: uncharacterized protein At1g04910       191   1e-51   
ref|XP_002279576.2|  PREDICTED: uncharacterized protein At1g04910       191   2e-51   Vitis vinifera
ref|XP_002980115.1|  hypothetical protein SELMODRAFT_111978             188   3e-51   
ref|XP_010460218.1|  PREDICTED: uncharacterized protein At1g04910       190   4e-51   
ref|XP_009359529.1|  PREDICTED: uncharacterized protein At1g04910...    190   5e-51   
ref|XP_010485298.1|  PREDICTED: uncharacterized protein At1g04910...    189   1e-50   
ref|XP_009624336.1|  PREDICTED: uncharacterized protein At1g04910       189   1e-50   
gb|KDP30951.1|  hypothetical protein JCGZ_11327                         183   7e-50   
ref|XP_007037929.1|  O-fucosyltransferase family protein, putative      185   2e-49   
ref|XP_002511216.1|  conserved hypothetical protein                     185   3e-49   Ricinus communis
ref|XP_008801214.1|  PREDICTED: uncharacterized protein At1g04910...    184   5e-49   
ref|XP_009150394.1|  PREDICTED: uncharacterized protein At1g04910       184   7e-49   
ref|XP_002866552.1|  hypothetical protein ARALYDRAFT_332561             183   1e-48   
emb|CDY41514.1|  BnaA06g22670D                                          182   4e-48   
ref|XP_006830094.1|  hypothetical protein AMTR_s00123p00067240          180   5e-48   
ref|NP_201144.1|  O-fucosyltransferase family protein                   181   7e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAU44615.1|  hypothetical protein AT5G63390                          181   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KDP30946.1|  hypothetical protein JCGZ_11322                         181   2e-47   
ref|XP_006281766.1|  hypothetical protein CARUB_v10027930mg             179   3e-47   
emb|CDX84405.1|  BnaC03g50950D                                          179   4e-47   
gb|KFK28051.1|  hypothetical protein AALP_AA8G465200                    174   6e-46   
ref|XP_010444223.1|  PREDICTED: uncharacterized protein At1g04910...    175   8e-46   
gb|KDO52594.1|  hypothetical protein CISIN_1g048096mg                   164   9e-42   
gb|KDO83493.1|  hypothetical protein CISIN_1g008992mg                   163   1e-41   
ref|XP_006439058.1|  hypothetical protein CICLE_v10031320mg             162   2e-41   
ref|XP_006394283.1|  hypothetical protein EUTSA_v10005492mg             163   2e-41   
gb|KEH33185.1|  GDP-fucose protein O-fucosyltransferase                 159   2e-40   
ref|XP_009410054.1|  PREDICTED: uncharacterized protein At1g04910...    158   6e-40   
ref|XP_010244145.1|  PREDICTED: uncharacterized protein At1g04910...    157   2e-39   
ref|XP_010913446.1|  PREDICTED: uncharacterized protein At1g04910...    156   3e-39   
emb|CDY67173.1|  BnaUnng01980D                                          144   1e-38   
ref|XP_008798041.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-38   
emb|CDX84250.1|  BnaC04g10120D                                          144   2e-38   
dbj|BAD94259.1|  axi 1 protein-like protein                             129   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974087.1|  hypothetical protein SELMODRAFT_442298             129   8e-30   
ref|XP_011097053.1|  PREDICTED: uncharacterized protein At1g04910...    127   4e-29   
ref|XP_011097054.1|  PREDICTED: uncharacterized protein At1g04910...    127   5e-29   
ref|XP_002517241.1|  conserved hypothetical protein                     126   6e-29   Ricinus communis
ref|XP_001765585.1|  predicted protein                                  124   4e-28   
ref|XP_009588701.1|  PREDICTED: uncharacterized protein At1g04910...    123   7e-28   
ref|XP_001761221.1|  predicted protein                                  123   7e-28   
ref|XP_010444397.1|  PREDICTED: uncharacterized protein At1g04910...    122   8e-28   
gb|EEC77803.1|  hypothetical protein OsI_16985                          122   2e-27   Oryza sativa Indica Group [Indian rice]
gb|EEE61496.1|  hypothetical protein OsJ_15784                          123   2e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01922.2|  OSJNBb0078D11.5                                        123   2e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04711.1|  unnamed protein product                                122   2e-27   
ref|XP_001765567.1|  predicted protein                                  121   2e-27   
ref|XP_003605029.1|  hypothetical protein MTR_4g023050                  114   2e-27   
ref|XP_010484244.1|  PREDICTED: uncharacterized protein At1g04910...    122   3e-27   
ref|XP_010680232.1|  PREDICTED: uncharacterized protein At1g04910       122   3e-27   
emb|CDY18704.1|  BnaA09g06910D                                          122   3e-27   
ref|XP_010444396.1|  PREDICTED: uncharacterized protein At1g04910...    122   3e-27   
gb|KDO58328.1|  hypothetical protein CISIN_1g043543mg                   120   4e-27   
ref|XP_010535322.1|  PREDICTED: uncharacterized protein At1g04910...    120   4e-27   
ref|XP_006653675.1|  PREDICTED: uncharacterized protein At1g04910...    121   4e-27   
ref|XP_007048355.1|  O-fucosyltransferase family protein isoform 1      120   6e-27   
ref|XP_007048356.1|  O-fucosyltransferase family protein isoform 2      120   7e-27   
ref|XP_010484245.1|  PREDICTED: uncharacterized protein At1g04910...    120   8e-27   
ref|XP_009112144.1|  PREDICTED: uncharacterized protein At1g04910       120   9e-27   
ref|XP_010535312.1|  PREDICTED: uncharacterized protein At1g04910...    120   9e-27   
ref|XP_002985325.1|  hypothetical protein SELMODRAFT_234769             120   9e-27   
emb|CDX81230.1|  BnaC09g06410D                                          120   1e-26   
ref|XP_006351036.1|  PREDICTED: uncharacterized protein At1g04910...    120   1e-26   
ref|XP_006664407.1|  PREDICTED: uncharacterized protein At1g04910...    119   1e-26   
ref|XP_006432248.1|  hypothetical protein CICLE_v10000858mg             120   1e-26   
ref|XP_010462011.1|  PREDICTED: uncharacterized protein At1g04910...    120   1e-26   
ref|XP_002970137.1|  hypothetical protein SELMODRAFT_171255             119   1e-26   
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    120   1e-26   
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    119   1e-26   
ref|XP_003613050.1|  DUF246 domain-containing protein                   116   2e-26   
gb|KDP39880.1|  hypothetical protein JCGZ_03411                         119   3e-26   
ref|XP_004953410.1|  PREDICTED: uncharacterized protein At1g04910...    119   3e-26   
ref|XP_010553257.1|  PREDICTED: uncharacterized protein At1g04910...    120   3e-26   
ref|XP_004249900.1|  PREDICTED: uncharacterized protein At1g04910       118   3e-26   
ref|XP_009789435.1|  PREDICTED: uncharacterized protein At1g04910...    118   3e-26   
ref|XP_010550724.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-26   
ref|XP_009789434.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-26   
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...    114   4e-26   
gb|KEH30846.1|  O-fucosyltransferase family protein                     119   4e-26   
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-26   
ref|XP_002514041.1|  conserved hypothetical protein                     118   5e-26   Ricinus communis
emb|CAA23010.1|  PsRT17-1 like protein                                  117   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018221.1|  O-fucosyltransferase family protein                118   5e-26   
dbj|BAK00215.1|  predicted protein                                      117   6e-26   
gb|KHG05427.1|  hypothetical protein F383_01689                         118   6e-26   
ref|XP_010039975.1|  PREDICTED: uncharacterized protein At1g04910...    115   6e-26   
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    117   7e-26   
gb|EYU18045.1|  hypothetical protein MIMGU_mgv1a006471mg                117   7e-26   
gb|EPS61269.1|  hypothetical protein M569_13528                         112   7e-26   
ref|XP_011009150.1|  PREDICTED: uncharacterized protein At1g04910...    119   8e-26   
ref|XP_011009151.1|  PREDICTED: uncharacterized protein At1g04910...    119   8e-26   
ref|XP_010536455.1|  PREDICTED: uncharacterized protein At1g04910...    118   8e-26   
ref|XP_010325489.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-25   
ref|XP_002969822.1|  hypothetical protein SELMODRAFT_231467             116   1e-25   
ref|XP_010520421.1|  PREDICTED: uncharacterized protein At1g04910...    116   1e-25   
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-25   
ref|XP_002985158.1|  hypothetical protein SELMODRAFT_234721             116   1e-25   
gb|KDP42616.1|  hypothetical protein JCGZ_24390                         117   1e-25   
ref|XP_003564076.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-25   
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-25   
gb|EPS69854.1|  hypothetical protein M569_04906                         116   1e-25   
ref|XP_007048357.1|  O-fucosyltransferase family protein isoform 3      117   1e-25   
ref|NP_194184.2|  O-fucosyltransferase family protein                   117   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398160.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-25   
gb|KHN43011.1|  DUF246 domain-containing protein                        116   1e-25   
ref|XP_001777077.1|  predicted protein                                  116   2e-25   
ref|XP_004976498.1|  PREDICTED: uncharacterized protein At1g04910...    117   2e-25   
ref|XP_006280272.1|  hypothetical protein CARUB_v10026194mg             117   2e-25   
ref|XP_010520413.1|  PREDICTED: uncharacterized protein At1g04910...    116   2e-25   
emb|CBI19199.3|  unnamed protein product                                117   2e-25   
ref|XP_003613049.1|  DUF246 domain-containing protein                   116   2e-25   
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       119   2e-25   
ref|XP_010113429.1|  hypothetical protein L484_026763                   117   2e-25   
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       117   2e-25   
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    116   2e-25   
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             117   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_003580329.1|  PREDICTED: uncharacterized protein At1g04910...    117   3e-25   
ref|XP_002323547.2|  hypothetical protein POPTR_0016s11700g             117   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              115   3e-25   
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    116   3e-25   
ref|XP_002867661.1|  predicted protein                                  116   3e-25   
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   115   3e-25   
ref|XP_004245776.1|  PREDICTED: uncharacterized protein At1g04910...    116   3e-25   
ref|XP_006394134.1|  hypothetical protein EUTSA_v10004008mg             115   3e-25   
gb|EEE52890.1|  hypothetical protein OsJ_35473                          115   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977171.1|  PREDICTED: uncharacterized protein At1g04910...    114   4e-25   
ref|XP_010419220.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-25   
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-25   
ref|XP_006440300.1|  hypothetical protein CICLE_v10019483mg             116   4e-25   
ref|XP_010943931.1|  PREDICTED: uncharacterized protein At1g04910...    116   4e-25   
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-25   
gb|AAL77666.1|  AT5g64600/MUB3_12                                       114   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010104478.1|  hypothetical protein L484_025447                   112   4e-25   
ref|XP_010664349.1|  PREDICTED: uncharacterized protein At1g04910       115   4e-25   
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-25   
ref|XP_004977170.1|  PREDICTED: uncharacterized protein At1g04910...    114   5e-25   
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-25   
ref|XP_011032328.1|  PREDICTED: uncharacterized protein At1g04910...    114   5e-25   
gb|EYU19327.1|  hypothetical protein MIMGU_mgv1a003931mg                115   5e-25   
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-25   
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             115   5e-25   
gb|KHN08072.1|  DUF246 domain-containing protein                        114   5e-25   
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-25   
ref|XP_006477177.1|  PREDICTED: uncharacterized protein At1g04910...    116   5e-25   
ref|XP_010060050.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-25   
ref|XP_010431531.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-25   
ref|NP_001066339.1|  Os12g0190100                                       115   5e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560          115   5e-25   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             115   5e-25   
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    115   6e-25   
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       115   6e-25   
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    115   6e-25   
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         115   6e-25   
ref|XP_008805903.1|  PREDICTED: uncharacterized protein At1g04910...    114   6e-25   
ref|XP_011031885.1|  PREDICTED: uncharacterized protein At1g04910       115   6e-25   
ref|XP_004502925.1|  PREDICTED: uncharacterized protein At1g04910...    116   6e-25   
ref|XP_006355513.1|  PREDICTED: uncharacterized protein At1g04910...    115   7e-25   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...    115   7e-25   
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             115   7e-25   
ref|XP_002303356.2|  hypothetical protein POPTR_0003s07520g             115   7e-25   
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...    115   7e-25   
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    115   7e-25   
ref|XP_009413170.1|  PREDICTED: uncharacterized protein At1g04910...    115   7e-25   
gb|EMS52186.1|  hypothetical protein TRIUR3_20101                       114   8e-25   
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       114   8e-25   
gb|EMT33036.1|  hypothetical protein F775_09618                         114   8e-25   
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...    115   8e-25   
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910       113   9e-25   
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-24   
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-24   
ref|XP_004977169.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-24   
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                    115   1e-24   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-24   
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg             115   1e-24   
ref|NP_001057161.2|  Os06g0219400                                       114   1e-24   
gb|EEC80240.1|  hypothetical protein OsI_22182                          114   1e-24   
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             115   1e-24   
gb|EEE65342.1|  hypothetical protein OsJ_20613                          114   1e-24   
gb|EEC68978.1|  hypothetical protein OsI_37727                          114   1e-24   
ref|XP_010539799.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-24   
ref|XP_011032327.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-24   
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-24   
ref|XP_004977168.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-24   
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             114   1e-24   
ref|XP_010471775.1|  PREDICTED: uncharacterized protein At1g04910       114   1e-24   
ref|XP_006661504.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-24   
ref|XP_009602405.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-24   
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       114   1e-24   
ref|NP_001148095.1|  auxin-independent growth promoter                  114   1e-24   
emb|CDY36519.1|  BnaA06g09720D                                          114   1e-24   
dbj|BAD37235.1|  putative auxin-independent growth promoter             114   1e-24   
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       114   1e-24   
ref|XP_008805902.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_002300651.1|  hypothetical protein POPTR_0002s01230g             114   2e-24   
ref|XP_004147217.1|  PREDICTED: DUF246 domain-containing protein ...    114   2e-24   
gb|EMT31676.1|  hypothetical protein F775_05595                         114   2e-24   
ref|XP_006656781.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910       114   2e-24   
ref|XP_002889072.1|  hypothetical protein ARALYDRAFT_476779             114   2e-24   
ref|XP_008805901.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_004253125.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_011001504.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_004156659.1|  PREDICTED: DUF246 domain-containing protein ...    114   2e-24   
ref|XP_004288336.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
ref|XP_011034893.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              113   2e-24   
ref|XP_009786248.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
ref|XP_010535316.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910       114   2e-24   
dbj|BAE71212.1|  hypothetical protein                                   112   2e-24   
ref|XP_004137916.1|  PREDICTED: DUF246 domain-containing protein ...    114   2e-24   
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             114   2e-24   
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
ref|XP_007039815.1|  O-fucosyltransferase family protein isoform 2      114   2e-24   
gb|EMS46244.1|  hypothetical protein TRIUR3_27764                       114   2e-24   
gb|KHN14510.1|  DUF246 domain-containing protein                        113   2e-24   
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
gb|KGN58804.1|  hypothetical protein Csa_3G732610                       114   2e-24   
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
ref|XP_006363293.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_007039814.1|  O-fucosyltransferase family protein isoform 1      114   2e-24   
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-24   
gb|AAF16673.1|AC012394_22  putative auxin-independent growth prom...    114   2e-24   
gb|ACN31634.1|  unknown                                                 109   2e-24   
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|NP_565129.1|  O-fucosyltransferase-like protein                     114   2e-24   
ref|XP_009764467.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...    114   2e-24   
ref|NP_201265.3|  O-fucosyltransferase family protein                   113   3e-24   
ref|XP_009604868.1|  PREDICTED: uncharacterized protein At1g04910...    114   3e-24   
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             113   3e-24   
dbj|BAB11427.1|  auxin-independent growth promoter-like protein         113   3e-24   
ref|XP_009389009.1|  PREDICTED: uncharacterized protein At1g04910       113   3e-24   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...    112   3e-24   
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...    113   3e-24   
gb|AAF17638.1|AC009978_14  T23E18.20                                    114   3e-24   
ref|XP_006581764.1|  PREDICTED: uncharacterized protein At1g04910...    111   3e-24   
ref|XP_004157119.1|  PREDICTED: DUF246 domain-containing protein ...    113   4e-24   
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_010258886.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_008448833.1|  PREDICTED: uncharacterized protein At1g04910       113   4e-24   
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    112   4e-24   
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_010534148.1|  PREDICTED: uncharacterized protein At1g04910...    108   4e-24   
ref|XP_002864909.1|  hypothetical protein ARALYDRAFT_496672             112   4e-24   
ref|XP_008452945.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_009379875.1|  PREDICTED: uncharacterized protein At1g04910...    111   4e-24   
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_010270432.1|  PREDICTED: uncharacterized protein At1g04910       112   4e-24   
gb|KHN35489.1|  DUF246 domain-containing protein                        112   4e-24   
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_010932414.1|  PREDICTED: uncharacterized protein At1g04910...    114   4e-24   
ref|XP_010093364.1|  hypothetical protein L484_022926                   113   4e-24   
ref|XP_003544811.1|  PREDICTED: uncharacterized protein At1g04910...    112   4e-24   
ref|XP_006342543.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
ref|XP_006369018.1|  hypothetical protein POPTR_0001s15750g             113   4e-24   
ref|XP_002526030.1|  conserved hypothetical protein                     113   4e-24   
emb|CDX73250.1|  BnaC06g36980D                                          113   4e-24   
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-24   
dbj|BAK02502.1|  predicted protein                                      113   4e-24   
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       112   5e-24   
gb|KFK36698.1|  hypothetical protein AALP_AA4G157600                    113   5e-24   
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg             112   5e-24   
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    113   5e-24   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-24   
emb|CDX87622.1|  BnaA07g32510D                                          113   5e-24   
gb|KHN09000.1|  DUF246 domain-containing protein                        112   5e-24   
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...    111   5e-24   
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-24   
emb|CAN78778.1|  hypothetical protein VITISV_029752                     112   5e-24   
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-24   
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       113   5e-24   
ref|XP_006302074.1|  hypothetical protein CARUB_v10020057mg             113   5e-24   
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-24   
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-24   
ref|XP_008813632.1|  PREDICTED: uncharacterized protein At1g04910...    113   5e-24   
gb|AES72844.2|  O-fucosyltransferase family protein                     113   6e-24   
ref|XP_006433927.1|  hypothetical protein CICLE_v10000706mg             112   6e-24   
ref|XP_006382852.1|  hypothetical protein POPTR_0005s06100g             112   6e-24   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             112   6e-24   
ref|XP_004145535.1|  PREDICTED: DUF246 domain-containing protein ...    113   6e-24   
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             112   6e-24   
ref|XP_010099296.1|  hypothetical protein L484_018158                   112   6e-24   
ref|XP_009106283.1|  PREDICTED: uncharacterized protein At1g04910...    112   6e-24   
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    111   6e-24   
ref|XP_009401883.1|  PREDICTED: uncharacterized protein At1g04910...    112   6e-24   
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       112   6e-24   
ref|XP_009804174.1|  PREDICTED: uncharacterized protein At1g04910...    112   6e-24   
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...    112   7e-24   
ref|XP_009627180.1|  PREDICTED: uncharacterized protein At1g04910...    112   7e-24   
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...    112   7e-24   
ref|XP_002436724.1|  hypothetical protein SORBIDRAFT_10g007565          110   7e-24   
ref|XP_011074208.1|  PREDICTED: uncharacterized protein At1g04910       112   7e-24   
ref|XP_009106284.1|  PREDICTED: uncharacterized protein At1g04910...    112   7e-24   
ref|XP_009627179.1|  PREDICTED: uncharacterized protein At1g04910...    112   7e-24   
gb|KHG05439.1|  hypothetical protein F383_31655                         110   7e-24   
ref|XP_010918225.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   7e-24   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             112   8e-24   
emb|CDP07301.1|  unnamed protein product                                112   8e-24   
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...    112   8e-24   
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         112   8e-24   
ref|XP_009379872.1|  PREDICTED: uncharacterized protein At1g04910...    111   8e-24   
gb|KDP38063.1|  hypothetical protein JCGZ_04706                         112   8e-24   
ref|XP_004500886.1|  PREDICTED: uncharacterized protein At1g04910...    112   8e-24   
ref|XP_009379874.1|  PREDICTED: uncharacterized protein At1g04910...    111   8e-24   
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       111   8e-24   
emb|CDY03446.1|  BnaC01g16360D                                          112   8e-24   
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     111   8e-24   
gb|KHG15636.1|  hypothetical protein F383_08162                         112   9e-24   
ref|XP_011077663.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
ref|XP_006433926.1|  hypothetical protein CICLE_v10000706mg             112   9e-24   
ref|XP_011019171.1|  PREDICTED: uncharacterized protein At1g04910...    111   9e-24   
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
gb|EPS72903.1|  hypothetical protein M569_01846                         111   9e-24   
ref|XP_010027680.1|  PREDICTED: uncharacterized protein At1g04910...    111   9e-24   
ref|XP_004299674.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
ref|XP_006390216.1|  hypothetical protein EUTSA_v10018355mg             112   9e-24   
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       112   9e-24   
gb|KHG20792.1|  hypothetical protein F383_01946                         112   9e-24   
gb|KFK42045.1|  hypothetical protein AALP_AA2G204600                    112   9e-24   
gb|EMT16885.1|  hypothetical protein F775_06176                         111   9e-24   
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    112   9e-24   
emb|CDP10650.1|  unnamed protein product                                112   1e-23   
ref|XP_002530648.1|  conserved hypothetical protein                     112   1e-23   
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685             112   1e-23   
ref|XP_010027681.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_003526859.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_008677206.1|  PREDICTED: auxin-independent growth promoter...    111   1e-23   
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      111   1e-23   
emb|CDY34289.1|  BnaA01g13920D                                          113   1e-23   
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             111   1e-23   
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_008786553.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_010930633.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_004239143.1|  PREDICTED: uncharacterized protein At1g04910       112   1e-23   
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_010110838.1|  hypothetical protein L484_011821                   111   1e-23   
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_006416386.1|  hypothetical protein EUTSA_v10007203mg             110   1e-23   
ref|XP_003614789.1|  Growth regulator-related protein                   112   1e-23   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_009392338.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_009627178.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
gb|EMT03760.1|  hypothetical protein F775_08651                         110   1e-23   
ref|XP_006357586.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    111   1e-23   
ref|XP_009627177.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_010055484.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_009392337.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       110   1e-23   
ref|NP_567509.2|  O-fucosyltransferase family protein                   111   1e-23   
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_008792012.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-23   
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_009407812.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-23   
ref|XP_004237944.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-23   
ref|XP_006414319.1|  hypothetical protein EUTSA_v10024831mg             111   2e-23   
ref|XP_010264337.1|  PREDICTED: uncharacterized protein At1g04910...    111   2e-23   
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    111   2e-23   
ref|NP_001132153.2|  uncharacterized protein LOC100193572               111   2e-23   
ref|XP_002441951.1|  hypothetical protein SORBIDRAFT_08g005420          110   2e-23   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg             111   2e-23   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...    111   2e-23   
gb|AGV54860.1|  O-fucosyltransferase family protein                     111   2e-23   
gb|KFK28149.1|  hypothetical protein AALP_AA8G479000                    110   2e-23   



>ref|XP_009782231.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=541

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK ARIYWAGGIPLGGKEALQPL KEFPHFYNKEDLAL GELE FAKKAS
Sbjct  377  VARLIKALGAPKGARIYWAGGIPLGGKEALQPLTKEFPHFYNKEDLALTGELEPFAKKAS  436

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+PHF+N+SLSE+
Sbjct  437  LMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLPHFLNSSLSET  496

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FNRII  LH+DSLGQPELRK GRD+TKYPVP+CMCN+ T
Sbjct  497  EFNRIILDLHKDSLGQPELRKTGRDVTKYPVPECMCNTTT  536



>ref|XP_009604992.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=541

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK +RIYWAGGIPLGGKEALQPL KEFPHFYNKEDLAL GELE FAKKAS
Sbjct  377  VTRLIKALGAPKGSRIYWAGGIPLGGKEALQPLTKEFPHFYNKEDLALTGELEPFAKKAS  436

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+PHF+N+SLSE+
Sbjct  437  LMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLPHFLNSSLSET  496

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FNRII  LH+DSLGQPELRK GRD+TKYPVP+CMCN+ T
Sbjct  497  EFNRIILDLHKDSLGQPELRKTGRDVTKYPVPECMCNTTT  536



>ref|XP_010327510.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=387

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK ARIYWAGG P GGKE LQPL KEFPHFYNKEDLALPGELE F+KKAS
Sbjct  223  VTRLIKALGAPKGARIYWAGGTPFGGKETLQPLTKEFPHFYNKEDLALPGELETFSKKAS  282

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSDVFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+PHF+N+SLSES
Sbjct  283  LMAAIDYIVCENSDVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLPHFLNSSLSES  342

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FN+II  LH+DSLGQP+LRK GRD+TKYPVP+CMCNS T
Sbjct  343  EFNKIILDLHKDSLGQPDLRKRGRDVTKYPVPECMCNSTT  382



>ref|XP_006341331.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK ARIYWAGGIP GGKEALQPL KEFPHFYNKEDLALPGELE F+KKAS
Sbjct  352  VTRLIKALGAPKGARIYWAGGIPFGGKEALQPLTKEFPHFYNKEDLALPGELEPFSKKAS  411

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSD+FMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+PHF+N+ LSES
Sbjct  412  LMAAIDYIVCENSDMFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLPHFLNSYLSES  471

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FN+II  LH+DSLGQPELRK GRD+TKYPVP+CMCNS T
Sbjct  472  EFNKIILDLHKDSLGQPELRKTGRDVTKYPVPECMCNSTT  511



>ref|XP_004248822.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=502

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK ARIYWAGG P GGKE LQPL KEFPHFYNKEDLALPGELE F+KKAS
Sbjct  338  VTRLIKALGAPKGARIYWAGGTPFGGKETLQPLTKEFPHFYNKEDLALPGELETFSKKAS  397

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSDVFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+PHF+N+SLSES
Sbjct  398  LMAAIDYIVCENSDVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLPHFLNSSLSES  457

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FN+II  LH+DSLGQP+LRK GRD+TKYPVP+CMCNS T
Sbjct  458  EFNKIILDLHKDSLGQPDLRKRGRDVTKYPVPECMCNSTT  497



>ref|XP_009626180.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=546

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGGIPLGGKEALQPL  EF HFYNKEDLALPGELE FAKKAS
Sbjct  382  VTRLLKALGAPKSARIYWAGGIPLGGKEALQPLTSEFTHFYNKEDLALPGELEPFAKKAS  441

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DYIVS NS+VFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+ HF+N+SLSE+
Sbjct  442  LMAALDYIVSANSNVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLRHFLNSSLSET  501

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
            +FNRII  LHRDSLGQPELRK GRD+TKYPVP+CMCN
Sbjct  502  EFNRIILELHRDSLGQPELRKAGRDVTKYPVPECMCN  538



>ref|XP_004229593.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum]
Length=549

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGGIPLGGKEALQPL  EFPHF+NKEDLALPGELE F+KKAS
Sbjct  385  VTRLLKALGAPKRARIYWAGGIPLGGKEALQPLTSEFPHFFNKEDLALPGELEPFSKKAS  444

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DYIV+ENS+VFMPSHGGNMGHALQG RAYAGHKKTITPNKRQM+ HF+N+SLSE+
Sbjct  445  LMAALDYIVTENSNVFMPSHGGNMGHALQGQRAYAGHKKTITPNKRQMLRHFLNSSLSET  504

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
            +FNRII  LHRDSLGQPELRKPGRD+TKYPVP+CMCN
Sbjct  505  EFNRIILDLHRDSLGQPELRKPGRDVTKYPVPECMCN  541



>ref|XP_006366494.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=548

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGGIPLGGKEALQPL  EFPHF+NKEDLALPGELE FAKKAS
Sbjct  384  VTRLLKALGAPKSARIYWAGGIPLGGKEALQPLTSEFPHFFNKEDLALPGELEPFAKKAS  443

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DYIV+ENS+VFMPSHGGNMGHALQG RAYAGH+KTITPNKRQM+ HF+N+SLSE+
Sbjct  444  LMAALDYIVTENSNVFMPSHGGNMGHALQGQRAYAGHRKTITPNKRQMLQHFLNSSLSET  503

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
            +FNRII  LHRDSLGQPELRK GRD+TKYPVP+CMCN
Sbjct  504  EFNRIILDLHRDSLGQPELRKAGRDVTKYPVPECMCN  540



>ref|XP_009778494.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=547

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG PLGGKEALQPL  EF HFYNKEDLALPGELE FAKKAS
Sbjct  383  VTRLLKALGAPKSARIYWAGGFPLGGKEALQPLTSEFTHFYNKEDLALPGELEPFAKKAS  442

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DYIVS NS+VFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM+ HF+N+SLSE+
Sbjct  443  LMAALDYIVSANSNVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLRHFLNSSLSET  502

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
            +FNRII  LHRDSLGQPELRK GRD+TKYPVP+CMCN
Sbjct  503  EFNRIILELHRDSLGQPELRKAGRDVTKYPVPECMCN  539



>gb|ACJ85641.1| unknown [Medicago truncatula]
Length=198

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGA K ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FAKKAS
Sbjct  34   VTRLLKALGAQKDARIYWAGGQPLGGKEALHPLIHEFPHLYNKEDLALPGELEPFAKKAS  93

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHALQGHRAYAGHKK ITPNKRQM P+F+N SL E+
Sbjct  94   LMAAIDYIVSEKSDVFMPSHGGNMGHALQGHRAYAGHKKYITPNKRQMHPYFLNPSLPEA  153

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN I+  LH++SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  154  EFNSIVKELHQNSLGQPELRTSKVGRDVTKYPVPECMCNDS  194



>ref|XP_011093377.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
 ref|XP_011069354.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=541

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP S RIYWAGG+PLGG+EAL PL +EFPHFYNKEDLAL GELE FAKKAS
Sbjct  374  VVRLLKALGAPMSTRIYWAGGVPLGGREALLPLTREFPHFYNKEDLALLGELEPFAKKAS  433

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFM SHGGNMGHA+QGHRAYAGHKKTI PNKRQM+P+FMN+SL E+
Sbjct  434  LMAAIDYIVSENSDVFMASHGGNMGHAIQGHRAYAGHKKTIIPNKRQMLPYFMNSSLPEA  493

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LHRDSLGQPELR  K GRD+TKYP+P+CMCN+ 
Sbjct  494  EFNRIILDLHRDSLGQPELRTSKAGRDVTKYPIPECMCNNT  534



>ref|XP_010067896.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW66138.1| hypothetical protein EUGRSUZ_G03403 [Eucalyptus grandis]
Length=567

 Score =   280 bits (716),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKS+RIYWAGG PLGGKEAL+ LI+EFPH YNKEDLALPGELE+FA +AS
Sbjct  400  VTRLLKALGAPKSSRIYWAGGQPLGGKEALRSLIEEFPHLYNKEDLALPGELESFANRAS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVSE SDVFMPSHGGNMGHA+QGHRAY GHKK ITPNKRQM+P FMN+S+ E 
Sbjct  460  FMAAIDYIVSERSDVFMPSHGGNMGHAIQGHRAYLGHKKYITPNKRQMLPFFMNSSIPEE  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            DFNRII  LHRDSLGQPELR  K GRD+TKYPVP+CMCNS+
Sbjct  520  DFNRIIKELHRDSLGQPELRTSKSGRDVTKYPVPECMCNSS  560



>ref|XP_009365036.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=583

 Score =   280 bits (716),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEALQPLIKEFPHFYNKED+ LPGELE FA KAS
Sbjct  417  VTRLLKALGAPKSARIYWAGGQPFGGKEALQPLIKEFPHFYNKEDITLPGELEPFANKAS  476

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVS+NSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL E+
Sbjct  477  VMAAIDYIVSDNSDVFMPSHGGNMGHAMQGHRAYAGHKKFITPNKRHMLPYFLNSSLPEA  536

Query  503  DFNRIISYLHRDSLGQPELRKP--GRDITKYPVPDCMCNSN  387
            +FNRII  LHRDSLGQP+LR+   G+D+TKYP+P+CMCN  
Sbjct  537  EFNRIIKELHRDSLGQPDLRRSRVGKDVTKYPIPECMCNDT  577



>ref|XP_003539654.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN19427.1| DUF246 domain-containing protein [Glycine soja]
Length=555

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+ARIYWAGG PLGGKEALQPLI EFPH Y+KEDLALPGELE FA KAS
Sbjct  389  VTRLLKGLGAPKNARIYWAGGQPLGGKEALQPLINEFPHLYSKEDLALPGELEPFANKAS  448

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHALQGHRAYAGHKK ITPNKRQM+P+F+N+SL E 
Sbjct  449  LMAAIDYIVSEKSDVFMPSHGGNMGHALQGHRAYAGHKKYITPNKRQMLPYFLNSSLPEK  508

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +FNRII  LH+DSLGQPELR  K GRD+TKYPVP+CMCN ++
Sbjct  509  EFNRIIKELHQDSLGQPELRTSKSGRDVTKYPVPECMCNDDS  550



>ref|XP_011087180.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=543

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGGIPLGGKE L PL +EFPHFYNKEDLALPGELE FAKKAS
Sbjct  377  VARLLKALGAPKSARIYWAGGIPLGGKETLLPLTREFPHFYNKEDLALPGELEPFAKKAS  436

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIVSE SDVFM SHGGNMGHA+QG+RAYAGHKKTI PNKRQM+ +FMN+SL +S
Sbjct  437  IMAAIDYIVSERSDVFMASHGGNMGHAIQGYRAYAGHKKTIIPNKRQMLTYFMNSSLPDS  496

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LHRDSLGQPELR  K GRD+TKYP+P+CMCN+ 
Sbjct  497  EFNNIILDLHRDSLGQPELRTSKAGRDVTKYPIPECMCNNT  537



>gb|EYU31341.1| hypothetical protein MIMGU_mgv1a006110mg [Erythranthe guttata]
Length=457

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APKSARIYWAGGIPLGGK+AL PLI EFP+FYNKEDLALPGELE F KKAS
Sbjct  291  VARLLKALKAPKSARIYWAGGIPLGGKDALLPLITEFPYFYNKEDLALPGELEPFVKKAS  350

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DYIVSENSDVFM SHGGNMGHA+QGHRA+AGHKKTI PNKRQMIP+FMN+S+SE 
Sbjct  351  LMAAVDYIVSENSDVFMASHGGNMGHAIQGHRAFAGHKKTIIPNKRQMIPYFMNSSISEM  410

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +F +II  LHRDS GQPE+R  K GRD+TKYP+P+CMCN+ 
Sbjct  411  EFEKIIFDLHRDSFGQPEIRTNKNGRDVTKYPIPECMCNNT  451



>emb|CDP07710.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK+ARI+WAGG PLGGKEAL PLI+EFPHFYNKEDLALPGELE F KKAS
Sbjct  371  VARLLKALGAPKTARIFWAGGNPLGGKEALDPLIREFPHFYNKEDLALPGELEPFQKKAS  430

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKKTITPNKRQM  HFMN+SL  +
Sbjct  431  LMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMFSHFMNSSLPGA  490

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +F +II  LHRDSLGQPELR  K  RD+TKYPVP+CMCN
Sbjct  491  EFKKIIVGLHRDSLGQPELRSSKTRRDVTKYPVPECMCN  529



>gb|AAK91401.1| At2g44500/F4I1.31 [Arabidopsis thaliana]
 gb|AAM10417.1| At2g44500/F4I1.31 [Arabidopsis thaliana]
Length=240

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FA KAS
Sbjct  71   VTRLLKALEAPKDARIYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFANKAS  130

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  131  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  190

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  191  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  229



>ref|XP_002298576.2| hypothetical protein POPTR_0001s23420g [Populus trichocarpa]
 gb|EEE83381.2| hypothetical protein POPTR_0001s23420g [Populus trichocarpa]
Length=590

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP+S RIYWAGG PLGGKEALQPL +EFPHFYNKEDLALPGEL+ FA +AS
Sbjct  424  VARLLKALGAPRSTRIYWAGGQPLGGKEALQPLTREFPHFYNKEDLALPGELKPFANRAS  483

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL  +
Sbjct  484  LMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPGA  543

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LHRDSLGQPELR  K GRD+TKYPVP+CMC+ +
Sbjct  544  EFNRIIKELHRDSLGQPELRTIKAGRDVTKYPVPECMCSDS  584



>ref|XP_011007093.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=590

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK  RIYWAGG PLGGKEALQPL +EFPHFYNKEDLALPGEL+ FA +AS
Sbjct  424  VARLLKALGAPKGTRIYWAGGQPLGGKEALQPLTREFPHFYNKEDLALPGELKPFANRAS  483

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL  +
Sbjct  484  LMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPGA  543

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LHRDSLGQPELR  K GRD+TKYPVP+CMC+ +
Sbjct  544  EFNRIIKELHRDSLGQPELRTIKAGRDVTKYPVPECMCSDS  584



>ref|XP_008350154.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=583

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEALQPLIKEFPHFYNKEDL L GELE FA KAS
Sbjct  417  VTRLLKALGAPKSARIYWAGGQPFGGKEALQPLIKEFPHFYNKEDLTLXGELEPFANKAS  476

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+ L E+
Sbjct  477  VMAAIDYIVSENSDVFMPSHGGNMGHAMQGHRAYAGHKKFITPNKRHMLPYFLNSFLPEA  536

Query  503  DFNRIISYLHRDSLGQPELRKP--GRDITKYPVPDCMCN-SNT  384
            +FNRII  LHRDS+GQP+LR+   G+D+TKYP+P+CMCN +NT
Sbjct  537  EFNRIIKELHRDSIGQPDLRRSRVGKDVTKYPIPECMCNDTNT  579



>ref|XP_008375138.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=582

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 147/163 (90%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEAL PLI+EFPHFYNKEDLALPGELE FA +AS
Sbjct  416  VTRLLKALGAPKSARIYWAGGQPFGGKEALLPLIEEFPHFYNKEDLALPGELEPFANRAS  475

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGH +QGHRAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  476  VMAAIDYIVSENSDVFMPSHGGNMGHVMQGHRAYAGHKKYITPDKRHMLPYFLNSSLPEA  535

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +FNRII  LHRDSLGQP+LR  + G+D+TKYPVP+CMCN +NT
Sbjct  536  EFNRIIXELHRDSLGQPDLRSSRVGKDVTKYPVPECMCNDTNT  578



>ref|XP_011042011.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=588

 Score =   275 bits (703),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG PLGGKEAL PL +EFP+FYNKEDLALPGEL+ FA KAS
Sbjct  423  VARLLKALGAPKSARIYWAGGQPLGGKEALLPLTREFPNFYNKEDLALPGELKPFANKAS  482

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDY+VSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL E+
Sbjct  483  LMAAIDYLVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPEA  542

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNR+I  LHRDSLGQPELR  K GRD+TKYPVP+CMC  +
Sbjct  543  EFNRVIKELHRDSLGQPELRTSKAGRDVTKYPVPECMCRDS  583



>ref|XP_009354686.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=582

 Score =   275 bits (703),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 147/163 (90%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEAL PLI+EFPHFYNKEDLALPGELE FA +AS
Sbjct  416  VTRLLKALGAPKSARIYWAGGQPFGGKEALLPLIEEFPHFYNKEDLALPGELEPFANRAS  475

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGH +QGHRAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  476  VMAAIDYIVSENSDVFMPSHGGNMGHVMQGHRAYAGHKKYITPDKRHMLPYFLNSSLPEA  535

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +FNRII  LHRDSLGQP+LR  + G+D+TKYP+P+CMCN +NT
Sbjct  536  EFNRIIKELHRDSLGQPDLRSSRVGKDVTKYPIPECMCNETNT  578



>ref|XP_002266606.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI24838.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GG+EAL PL +EFP+FYNKEDLALPGELE F+KKAS
Sbjct  369  VTRLLKALGAPKSARIYWAGGQPFGGEEALLPLTREFPNFYNKEDLALPGELEPFSKKAS  428

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIV E SDVF+PSHGGNMGHA+QGHRAYAGHKK ITPNKRQMIP+F+N+ L E+
Sbjct  429  FMAAIDYIVCEKSDVFIPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMIPYFLNSPLPEA  488

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FNR+I  LHRDS GQPELR  K GRD+TKYPVP+CMCNS + 
Sbjct  489  EFNRVIMELHRDSFGQPELRATKAGRDVTKYPVPECMCNSTSS  531



>ref|XP_010257422.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=551

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP++ RIYWAGG P GGKEAL PL +EFPHFYNK+D+ALPGELE FA +AS
Sbjct  385  VMRLLKALGAPRNTRIYWAGGPPFGGKEALLPLTREFPHFYNKDDIALPGELEPFADRAS  444

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+P+F+N+SL ES
Sbjct  445  VLAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLPYFLNSSLPES  504

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +FN II  LHRDSLGQPELR  K GRD+TKYP+P+CMCN +NT
Sbjct  505  EFNMIIKDLHRDSLGQPELRTSKVGRDVTKYPIPECMCNDTNT  547



>ref|XP_002313473.2| hypothetical protein POPTR_0009s02760g [Populus trichocarpa]
 gb|EEE87428.2| hypothetical protein POPTR_0009s02760g [Populus trichocarpa]
Length=588

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG PLGGKEAL PL +EFP+FYNKEDLALPGEL+ FA KAS
Sbjct  423  VARLLKALGAPKSARIYWAGGQPLGGKEALLPLTREFPNFYNKEDLALPGELKPFANKAS  482

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDY+VSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL E+
Sbjct  483  LMAAIDYLVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPEA  542

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNR+I  LHRDSLGQPELR  K GRD+TKYPVP+CMC  +
Sbjct  543  EFNRVIKELHRDSLGQPELRTSKAGRDVTKYPVPECMCRDS  583



>ref|XP_007133850.1| hypothetical protein PHAVU_011G214200g [Phaseolus vulgaris]
 gb|ESW05844.1| hypothetical protein PHAVU_011G214200g [Phaseolus vulgaris]
Length=558

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG PLGGKEAL+PLI EFP+ Y+KEDLALPGELE FA KAS
Sbjct  398  VTRLLKALGAPKSARIYWAGGQPLGGKEALEPLINEFPYLYSKEDLALPGELEPFANKAS  457

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+P+F+N++L E 
Sbjct  458  LMAAIDYIVSEKSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLPYFLNSTLPEE  517

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LH+DSLGQPELR  K  RD+TKYPVPDCMCN +
Sbjct  518  EFNSIIKELHQDSLGQPELRTSKVARDVTKYPVPDCMCNDS  558



>ref|XP_006482836.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
Length=562

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FA KAS
Sbjct  397  VTRLLKALGAPKIARIYWAGGEPLGGKEALLPLITEFPHLYNKEDLALPGELEPFANKAS  456

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSD+FMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+ +F+N+SL E+
Sbjct  457  LMAAIDYIVSENSDIFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLHYFLNSSLPEA  516

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH +SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  517  EFNRIIKELHSESLGQPELRTSKAGRDVTKYPVPECMCNDS  557



>ref|XP_006482837.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
 ref|XP_006482838.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=552

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FA KAS
Sbjct  387  VTRLLKALGAPKIARIYWAGGEPLGGKEALLPLITEFPHLYNKEDLALPGELEPFANKAS  446

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSD+FMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+ +F+N+SL E+
Sbjct  447  LMAAIDYIVSENSDIFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLHYFLNSSLPEA  506

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH +SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  507  EFNRIIKELHSESLGQPELRTSKAGRDVTKYPVPECMCNDS  547



>ref|XP_010095397.1| hypothetical protein L484_013070 [Morus notabilis]
 gb|EXB59949.1| hypothetical protein L484_013070 [Morus notabilis]
Length=492

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP++ARIYWAGG PLGG EAL PL +EFP+FYNKEDLALPGELE FA +AS
Sbjct  326  VTRLLKALGAPRNARIYWAGGQPLGGNEALLPLTREFPNFYNKEDLALPGELEPFANRAS  385

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            + AAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+PHF+N+SL E+
Sbjct  386  VKAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLPHFLNSSLPEA  445

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +F RII +LH +SLGQPE R  K GRD+TKYPVP+CMCN +
Sbjct  446  EFKRIIKFLHHESLGQPEHRTSKTGRDVTKYPVPECMCNDS  486



>gb|AES69266.2| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=563

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI+EFP+FYNKEDLALPGEL+ F +KAS
Sbjct  399  VMRLLKALGAPKDARIYWAGGKPLGGKEALLPLIQEFPNFYNKEDLALPGELQPFVRKAS  458

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMG A+QGHRA+ GHKK ITPNKR M+P+F+N+SLSE 
Sbjct  459  LMAAIDYIVSEKSDVFMPSHGGNMGRAIQGHRAFTGHKKYITPNKRHMLPYFLNSSLSEE  518

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH+DSLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  519  EFNRIIKELHQDSLGQPELRTNKNGRDVTKYPVPECMCNDS  559



>ref|XP_004506509.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=581

 Score =   273 bits (697),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKE L PLI EFPH YNKEDLAL GELE FAKKAS
Sbjct  416  VTRLLKALGAPKDARIYWAGGQPLGGKEVLNPLIHEFPHLYNKEDLALAGELEPFAKKAS  475

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+P+F+N SL ES
Sbjct  476  LMAAIDYIVSEKSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLPYFLNPSLPES  535

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +FN I+  LH++SLGQPELR  K GRD+TKYPVP+CMCN+++
Sbjct  536  EFNNIVKELHQNSLGQPELRTSKVGRDVTKYPVPECMCNNDS  577



>gb|KDP43418.1| hypothetical protein JCGZ_16705 [Jatropha curcas]
Length=399

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG P GG+EAL PL +EF HFYNKEDLALPGEL+ FA KAS
Sbjct  233  VARLLKALGAPKDARIYWAGGQPFGGEEALLPLTREFSHFYNKEDLALPGELKPFADKAS  292

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL E+
Sbjct  293  LMAAIDYIVSEKSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPEA  352

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LHR+SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  353  EFNTIIKDLHRESLGQPELRNSKAGRDVTKYPVPECMCNDS  393



>gb|EYU27099.1| hypothetical protein MIMGU_mgv1a004188mg [Erythranthe guttata]
Length=540

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK+ RIYWAGG+PLGGKEAL PL  EFP+FYNKEDLALPGELE F+KKAS
Sbjct  371  VARLLKALGAPKTTRIYWAGGVPLGGKEALTPLTSEFPNFYNKEDLALPGELEPFSKKAS  430

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFM SHGGNMGHA+QG RAYAGHKKTI PNKRQM+ +FM+ SL ES
Sbjct  431  LMAAIDYIVSERSDVFMASHGGNMGHAIQGQRAYAGHKKTIIPNKRQMLSYFMDTSLPES  490

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FN+II  LHRDSLG+PELR  K GRD+TKYP+P+CMCN+   
Sbjct  491  EFNKIIVDLHRDSLGKPELRTSKNGRDVTKYPIPECMCNNTVA  533



>ref|XP_003599015.1| Growth regulator like protein [Medicago truncatula]
Length=600

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI+EFP+FYNKEDLALPGEL+ F +KAS
Sbjct  436  VMRLLKALGAPKDARIYWAGGKPLGGKEALLPLIQEFPNFYNKEDLALPGELQPFVRKAS  495

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMG A+QGHRA+ GHKK ITPNKR M+P+F+N+SLSE 
Sbjct  496  LMAAIDYIVSEKSDVFMPSHGGNMGRAIQGHRAFTGHKKYITPNKRHMLPYFLNSSLSEE  555

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH+DSLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  556  EFNRIIKELHQDSLGQPELRTNKNGRDVTKYPVPECMCNDS  596



>ref|XP_007149066.1| hypothetical protein PHAVU_005G038100g [Phaseolus vulgaris]
 gb|ESW21060.1| hypothetical protein PHAVU_005G038100g [Phaseolus vulgaris]
Length=570

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+AR+YWAGG PLGGKEAL PLI+EFPHFY+KEDLALPGEL+ FA KAS
Sbjct  406  VTRLLKGLGAPKNARMYWAGGEPLGGKEALLPLIQEFPHFYSKEDLALPGELQPFANKAS  465

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIVSE SDVFMPSHGGNMGHA+QGHRA+AGHKK ITPNKR M+P+F N+S+SE 
Sbjct  466  IMAAIDYIVSEKSDVFMPSHGGNMGHAIQGHRAFAGHKKYITPNKRHMLPYFHNSSISEQ  525

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH+DSLGQPELR  K GRD+TKYP+P+CMCN +
Sbjct  526  EFNRIIKELHQDSLGQPELRTIKAGRDVTKYPIPECMCNDS  566



>ref|XP_004149620.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=556

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y V RLLKALGAP+  RIYWAGG PLGGKEALQPL  EFP+FYNKEDLALP ELE FAKK
Sbjct  388  YEVMRLLKALGAPRDTRIYWAGGQPLGGKEALQPLTGEFPNFYNKEDLALPSELEPFAKK  447

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            ASIMAAIDYIV E+SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P F+++SL 
Sbjct  448  ASIMAAIDYIVCESSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPLFLDSSLP  507

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            E++FN+II  LH+DSLGQPELR  K GRD+TKYP+P+CMCN+++
Sbjct  508  EAEFNKIIRELHQDSLGQPELRTSKVGRDVTKYPIPECMCNNSS  551



>gb|KDO83491.1| hypothetical protein CISIN_1g008992mg [Citrus sinensis]
Length=547

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FA KAS
Sbjct  382  VTRLLKALGAPKIARIYWAGGEPLGGKEALLPLITEFPHLYNKEDLALPGELEPFANKAS  441

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSD+FMPSHGGNMGHA+QGHRAYAGH K ITPNKRQM+ +F+N+SL E+
Sbjct  442  LMAAIDYIVSENSDIFMPSHGGNMGHAIQGHRAYAGHMKYITPNKRQMLHYFLNSSLPEA  501

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH +SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  502  EFNRIIKELHSESLGQPELRTSKAGRDVTKYPVPECMCNDS  542



>ref|XP_003534702.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN40893.1| DUF246 domain-containing protein [Glycine soja]
Length=552

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 142/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+ARIYWAGG PLGGKE LQPLI EFPH Y+KEDLAL GELE FA KAS
Sbjct  386  VTRLLKGLGAPKNARIYWAGGQPLGGKEVLQPLINEFPHLYSKEDLALHGELEPFANKAS  445

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHALQGHRAYAGHKK ITPNKRQM+P+F+++SL E 
Sbjct  446  LMAAIDYIVSEKSDVFMPSHGGNMGHALQGHRAYAGHKKYITPNKRQMLPYFLDSSLPEE  505

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +FNRII  LH+DSLGQPE R  K GRD+TKYPVP+CMCN ++
Sbjct  506  EFNRIIKELHQDSLGQPEFRTSKSGRDVTKYPVPECMCNDDS  547



>ref|XP_006293918.1| hypothetical protein CARUB_v10022909mg [Capsella rubella]
 gb|EOA26816.1| hypothetical protein CARUB_v10022909mg [Capsella rubella]
Length=567

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FAKKAS
Sbjct  401  VTRLLKALEAPKDARIYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFAKKAS  460

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  461  VMAAIDYIVCENSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  520

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  521  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  559



>gb|KGN58618.1| hypothetical protein Csa_3G702070 [Cucumis sativus]
Length=572

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y V RLLKALGAP+  RIYWAGG PLGGKEALQPL  EFP+FYNKEDLALP ELE FAKK
Sbjct  404  YEVMRLLKALGAPRDTRIYWAGGQPLGGKEALQPLTGEFPNFYNKEDLALPSELEPFAKK  463

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            ASIMAAIDYIV E+SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P F+++SL 
Sbjct  464  ASIMAAIDYIVCESSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPLFLDSSLP  523

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            E++FN+II  LH+DSLGQPELR  K GRD+TKYP+P+CMCN+++
Sbjct  524  EAEFNKIIRELHQDSLGQPELRTSKVGRDVTKYPIPECMCNNSS  567



>ref|XP_008461772.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=572

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y V RLLKALGAP+  RIYWAGG PLGGKEALQPL  EFP+FYNKEDLALP ELE FAKK
Sbjct  404  YEVMRLLKALGAPRDTRIYWAGGQPLGGKEALQPLTGEFPNFYNKEDLALPSELEPFAKK  463

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            ASIMAAIDYIV E+SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P F+++SL 
Sbjct  464  ASIMAAIDYIVCESSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPLFLDSSLP  523

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            E++FN+II  LH+DSLGQPELR  K GRD+TKYP+P+CMCN+++
Sbjct  524  EAEFNKIIRELHQDSLGQPELRTSKVGRDVTKYPIPECMCNNSS  567



>ref|XP_008231325.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=575

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK+ARIYWAGG P GGKEAL PL  EFPHFYNKEDLALPGELE F+ +AS
Sbjct  409  VTRLLKALGAPKNARIYWAGGHPFGGKEALLPLTGEFPHFYNKEDLALPGELEPFSNRAS  468

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  469  VMAAIDYIVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPDKRHMLPYFLNSSLPEA  528

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH+DSLGQP+LR  + G+D+TKYPVP+CMCN +
Sbjct  529  EFNRIIKELHKDSLGQPDLRTSRAGKDVTKYPVPECMCNDS  569



>ref|XP_010508287.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=578

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FAKKAS
Sbjct  412  VTRLLKALEAPKDARIYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFAKKAS  471

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  472  VMAAIDYIVCENSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  531

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  532  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  570



>ref|XP_006397629.1| hypothetical protein EUTSA_v10001372mg [Eutrema salsugineum]
 ref|XP_006397630.1| hypothetical protein EUTSA_v10001372mg [Eutrema salsugineum]
 gb|ESQ39082.1| hypothetical protein EUTSA_v10001372mg [Eutrema salsugineum]
 gb|ESQ39083.1| hypothetical protein EUTSA_v10001372mg [Eutrema salsugineum]
Length=576

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL KEFPHFYNK DLALPGELE FAKKAS
Sbjct  407  VTRLLKALEAPKDARIYWAGGEPLGGKEVLEPLTKEFPHFYNKHDLALPGELEPFAKKAS  466

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  467  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  526

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  527  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  565



>ref|XP_003605027.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES87224.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=623

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGA K ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FAKKAS
Sbjct  459  VTRLLKALGAQKDARIYWAGGQPLGGKEALHPLIHEFPHLYNKEDLALPGELEPFAKKAS  518

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHALQGHRAYAGHKK ITPNKRQM P+F+N SL E+
Sbjct  519  LMAAIDYIVSEKSDVFMPSHGGNMGHALQGHRAYAGHKKYITPNKRQMHPYFLNPSLPEA  578

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN I+  LH++SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  579  EFNSIVKELHQNSLGQPELRTSKVGRDVTKYPVPECMCNDS  619



>gb|KHN29192.1| DUF246 domain-containing protein [Glycine soja]
Length=577

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+ARIYWAGG PLGGKEAL PLI+EFPHFY+KEDLALPGEL+ FA KAS
Sbjct  413  VTRLLKGLGAPKNARIYWAGGQPLGGKEALLPLIQEFPHFYSKEDLALPGELQPFANKAS  472

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIVSE SDVFMPSHGGNMGHA+QGHRA+AGHKK ITPNKR M+P+F N+SL E 
Sbjct  473  IMAAIDYIVSEKSDVFMPSHGGNMGHAIQGHRAFAGHKKYITPNKRHMLPYFHNSSLPEE  532

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FNRI+  LH+DSLGQPELR  K GRD+TK+P+P+CMCN +  
Sbjct  533  EFNRIMKELHQDSLGQPELRTIKAGRDVTKFPIPECMCNDSNA  575



>ref|XP_004161417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=572

 Score =   270 bits (689),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y V RLLKALGAP   RIYWAGG PLGGKEALQPL  EFP+FYNKEDLALP ELE FAKK
Sbjct  404  YEVMRLLKALGAPGDTRIYWAGGQPLGGKEALQPLTGEFPNFYNKEDLALPSELEPFAKK  463

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            ASIMAAIDYIV E+SDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKR M+P F+++SL 
Sbjct  464  ASIMAAIDYIVCESSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPLFLDSSLP  523

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            E++FN+II  LH+DSLGQPELR  K GRD+TKYP+P+CMCN+++
Sbjct  524  EAEFNKIIRELHQDSLGQPELRTSKVGRDVTKYPIPECMCNNSS  567



>ref|XP_010065185.1| PREDICTED: uncharacterized protein At1g04910-like [Eucalyptus 
grandis]
 gb|KCW62529.1| hypothetical protein EUGRSUZ_G00021 [Eucalyptus grandis]
Length=568

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP +ARIYWAGG PLGGKEAL PL +EFPHFYNK+DLALPGELE FA KAS
Sbjct  393  VARLLKALGAPNNARIYWAGGQPLGGKEALLPLTREFPHFYNKQDLALPGELEPFANKAS  452

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MA+IDYI+ E SDVFMPSHGGNMGHALQG RAYAGH+K ITPNKR M+P+F+N SL E 
Sbjct  453  FMASIDYIICERSDVFMPSHGGNMGHALQGQRAYAGHRKYITPNKRHMLPYFLNTSLPEL  512

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +FNRI+  LH+DSLGQPELR  K GRD+TKYP+PDCMCNS++
Sbjct  513  EFNRIMRELHQDSLGQPELRTSKVGRDVTKYPIPDCMCNSSS  554



>ref|XP_004306502.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=577

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PL +EF HFYNKEDLALPGELE FAK+AS
Sbjct  411  VTRLLKALGAPKDARIYWAGGEPLGGKEALLPLTREFSHFYNKEDLALPGELEPFAKRAS  470

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHALQG RAYAGHKK ITP+KR M+P+F+++ L E+
Sbjct  471  VMAAIDYIVSENSDVFMPSHGGNMGHALQGQRAYAGHKKYITPDKRHMLPYFLDSLLPEA  530

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LHRDSLGQP++R  K GRD+TKYP+P+CMC+ +
Sbjct  531  EFNRIIKELHRDSLGQPDIRISKVGRDVTKYPIPECMCSDS  571



>ref|XP_007220633.1| hypothetical protein PRUPE_ppa003424mg [Prunus persica]
 gb|EMJ21832.1| hypothetical protein PRUPE_ppa003424mg [Prunus persica]
Length=575

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK+ARIYWAGG P GGKEAL PL  EFPHFYNKEDLALPGELE F+ +AS
Sbjct  409  VTRLLKALGAPKNARIYWAGGHPFGGKEALLPLTGEFPHFYNKEDLALPGELEPFSNRAS  468

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSENSDVFMPSHGGNMGHA+QG+RAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  469  VMAAIDYIVSENSDVFMPSHGGNMGHAIQGYRAYAGHKKYITPDKRHMLPYFLNSSLPEA  528

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH+DSLGQP+LR  + G+D+TKYPVP+CMCN +
Sbjct  529  EFNRIIKELHKDSLGQPDLRTSRAGKDVTKYPVPECMCNDS  569



>ref|XP_002880120.1| hypothetical protein ARALYDRAFT_483577 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56379.1| hypothetical protein ARALYDRAFT_483577 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK+ARIYWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FAKKAS
Sbjct  403  VTRLLKALEAPKNARIYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFAKKAS  462

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  463  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  522

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  523  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  561



>gb|KHN49038.1| DUF246 domain-containing protein [Glycine soja]
Length=575

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+ARIYWAGG PLGGKEAL PLI++FPHFY+KEDLALPGEL+ FA KAS
Sbjct  411  VTRLLKGLGAPKNARIYWAGGQPLGGKEALLPLIQDFPHFYSKEDLALPGELQPFANKAS  470

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYI+SE SDVFMPSHGGNMGHA+QGHRA+AGHKK ITPNKR M+P F N+SLSE 
Sbjct  471  IMAAIDYIISEKSDVFMPSHGGNMGHAIQGHRAFAGHKKYITPNKRHMLPFFHNSSLSEE  530

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FN+II  LH+DSLGQPELR  K GRD+TK+P+P+CMCN +  
Sbjct  531  EFNKIIKELHQDSLGQPELRTIKAGRDVTKFPIPECMCNDSNA  573



>ref|XP_003546867.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=575

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPK+ARIYWAGG PLGGKEAL PLI++FPHFY+KEDLALPGEL+ FA KAS
Sbjct  411  VTRLLKGLGAPKNARIYWAGGQPLGGKEALLPLIQDFPHFYSKEDLALPGELQPFANKAS  470

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYI+SE SDVFMPSHGGNMGHA+QGHRA+AGHKK ITPNKR M+P F N+SLSE 
Sbjct  471  IMAAIDYIISEKSDVFMPSHGGNMGHAIQGHRAFAGHKKYITPNKRHMLPFFHNSSLSEE  530

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FN+II  LH+DSLGQPELR  K GRD+TK+P+P+CMCN +  
Sbjct  531  EFNKIIKELHQDSLGQPELRTIKAGRDVTKFPIPECMCNDSNA  573



>ref|XP_010518045.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=572

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGK  L+PL KEFP FYNK DLALPGELE FAKKAS
Sbjct  407  VTRLLKALEAPKDARIYWAGGEPLGGKVVLEPLTKEFPQFYNKHDLALPGELEPFAKKAS  466

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV ENSDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  467  VMAAIDYIVCENSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  526

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  527  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  565



>gb|KFK37254.1| hypothetical protein AALP_AA4G233800 [Arabis alpina]
Length=558

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL K FPHFYNK DLALPGELE FAKKAS
Sbjct  387  VTRLLKALEAPKEARIYWAGGEPLGGKEVLEPLTKSFPHFYNKHDLALPGELEPFAKKAS  446

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQMIP+F+++SL ES
Sbjct  447  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMIPYFLDSSLPES  506

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  507  DFNRIVKDLHRESLGQPELRTSKAGKDVTKHPVPECMCS  545



>ref|XP_007052598.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOX96755.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=551

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            + V RLLKALGAP+SA+IYWAGG PLGGKEAL PL +EFPHFYNKEDLA PGELE FA K
Sbjct  386  FEVTRLLKALGAPRSAKIYWAGGQPLGGKEALSPLTREFPHFYNKEDLAFPGELEPFANK  445

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            AS MAAIDYIVS+ SDVFMPSHGGNMGHA+QG RAYAGHKK ITPNKR M+P+F+N+SL 
Sbjct  446  ASFMAAIDYIVSQKSDVFMPSHGGNMGHAIQGQRAYAGHKKYITPNKRHMLPYFLNSSLP  505

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            E++F+RII  LH +SLGQPELR  K GRD+TKYPVP+CMCN+
Sbjct  506  EAEFSRIIKELHHESLGQPELRASKAGRDVTKYPVPECMCNN  547



>ref|XP_010265849.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=547

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP   RIYWAGG P GG+EAL PL +EFP+FYNK DLALPGELE FA +AS
Sbjct  385  VMRLLKALGAPWDTRIYWAGGPPFGGEEALLPLTREFPYFYNKNDLALPGELEPFADRAS  444

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDY+VSENSDVFMPSHGGNMGHA+QGHRAYAGHKK ITPNKRQM+P+F+N+SL ES
Sbjct  445  VLAAIDYVVSENSDVFMPSHGGNMGHAIQGHRAYAGHKKYITPNKRQMLPYFLNSSLPES  504

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FNRII  LH DSLGQPE R  K GRD+TKYP+P+CMCN  
Sbjct  505  EFNRIIKELHHDSLGQPEFRTSKVGRDVTKYPIPECMCNDT  545



>ref|NP_181978.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAK43924.1|AF370605_1 axi 1 protein-like protein [Arabidopsis thaliana]
 gb|AAC16096.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AEC10430.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=573

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FA KAS
Sbjct  404  VTRLLKALEAPKDARIYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFANKAS  463

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  464  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  523

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  524  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  562



>gb|KHG06227.1| hypothetical protein F383_00226 [Gossypium arboreum]
Length=541

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            + V RLLKALGAP+SARIYWAGG PLGGKEAL PL +EFPHFYNKE LALPGELE FA K
Sbjct  376  FEVTRLLKALGAPRSARIYWAGGQPLGGKEALSPLTREFPHFYNKEGLALPGELEPFANK  435

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            AS MAAIDYIVSE SDVFM SHGGNMGHA+QG RAYAGHKK ITPNKR M+P+F+N+SL 
Sbjct  436  ASFMAAIDYIVSEKSDVFMASHGGNMGHAIQGQRAYAGHKKYITPNKRHMLPYFVNSSLP  495

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            E++F+RII  LH++SLGQPELR  K GRD+TKYPVP+CMC  N
Sbjct  496  EAEFSRIIKELHQESLGQPELRSSKAGRDVTKYPVPECMCKRN  538



>ref|XP_010673474.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGK+AL PL  EFP+ YNKEDLALPGEL+ FA +AS
Sbjct  380  VARLLKALGAPKSARIYWAGGQPFGGKDALLPLTTEFPYLYNKEDLALPGELKPFANRAS  439

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIV E SDVFM SHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+FMN++L E 
Sbjct  440  FMAAIDYIVCEKSDVFMASHGGNMGHAIQGHRAYAGHKKHITPNKRHMLPYFMNSTLPEI  499

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            +FN+I+  LHRDSLGQPE R  KPGRD+TKYPVP+CMCN+
Sbjct  500  EFNKIVKELHRDSLGQPEFRTSKPGRDVTKYPVPECMCNT  539



>ref|XP_010506376.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=571

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL KAL APK AR+YWAGG PLGGKE L+PL KEFP FYNK DLALPGELE FAKKAS
Sbjct  406  VTRLHKALEAPKDARLYWAGGEPLGGKEVLEPLTKEFPQFYNKHDLALPGELEPFAKKAS  465

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAID+IV ENSDVF+PSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ES
Sbjct  466  VMAAIDHIVCENSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPES  525

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            DFNRI+  LHR+SLGQPELR  K G+D+TK+PVP+CMC+
Sbjct  526  DFNRIVKDLHRESLGQPELRMSKAGKDVTKHPVPECMCS  564



>ref|XP_004513144.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=548

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPKSA++YWAGG PLGGKEAL PLI+EFP+FYNKEDLALPGEL+ F KKAS
Sbjct  384  VTRLLKGLGAPKSAKVYWAGGKPLGGKEALLPLIQEFPNFYNKEDLALPGELQPFVKKAS  443

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVS+ SDVFMPSHGGNMGHA+QGHRA+ GHKK ITPNKR M+P+F+N+SLSE 
Sbjct  444  LMAAIDYIVSQKSDVFMPSHGGNMGHAIQGHRAFTGHKKYITPNKRHMLPYFLNSSLSEE  503

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LH+DSLG+PELR  K  RD+TKYPVP+CMCN +
Sbjct  504  EFNMIIKELHQDSLGKPELRTNKIRRDVTKYPVPECMCNDS  544



>gb|AAL16192.1|AF428423_1 AT3g07900/F17A17_24 [Arabidopsis thaliana]
Length=313

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  149  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRAS  208

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N+SL+E+
Sbjct  209  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNSSLTET  268

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMCN SNT
Sbjct  269  EFEKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMCNQSNT  311



>ref|XP_004513143.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=564

 Score =   264 bits (675),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLK LGAPKSA++YWAGG PLGGKEAL PLI+EFP+FYNKEDLALPGEL+ F KKAS
Sbjct  400  VTRLLKGLGAPKSAKVYWAGGKPLGGKEALLPLIQEFPNFYNKEDLALPGELQPFVKKAS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVS+ SDVFMPSHGGNMGHA+QGHRA+ GHKK ITPNKR M+P+F+N+SLSE 
Sbjct  460  LMAAIDYIVSQKSDVFMPSHGGNMGHAIQGHRAFTGHKKYITPNKRHMLPYFLNSSLSEE  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LH+DSLG+PELR  K  RD+TKYPVP+CMCN +
Sbjct  520  EFNMIIKELHQDSLGKPELRTNKIRRDVTKYPVPECMCNDS  560



>ref|XP_010547235.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=575

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP++ARIYWAGG PLGGKEAL P  +EFPHFYNK DLA  GELE FAK+AS
Sbjct  411  VTRLLRALGAPRNARIYWAGGDPLGGKEALTPFTREFPHFYNKHDLASRGELEPFAKRAS  470

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDY+V E SDVFM SHGGNMG A+QGHRAYAGHKK ITPNKR M+P+FMN +++E+
Sbjct  471  LMAAIDYVVCEQSDVFMASHGGNMGRAIQGHRAYAGHKKYITPNKRHMLPYFMNTTMAEA  530

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F+++I  LHRDSLGQPELR  K GRD+TKYPVP+CMCN +T 
Sbjct  531  EFDKVIKTLHRDSLGQPELRTSKAGRDVTKYPVPECMCNKSTS  573



>ref|XP_002520639.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41735.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP  ARIYWAGG PLGGKEAL P+  EFPHFYNKEDLAL GELE F  KAS
Sbjct  423  VTRLLKALGAPSDARIYWAGGQPLGGKEALLPITNEFPHFYNKEDLALHGELEPFVNKAS  482

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFM SHGGNMGHA+QGHRAYAGHKK ITPNKR M+P+F+N+SL E+
Sbjct  483  VMAAIDYIVSEKSDVFMASHGGNMGHAIQGHRAYAGHKKYITPNKRHMLPYFLNSSLPEA  542

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +FN II  LHRDSLGQPELR  K GRD+TK+P+P+CMCN +
Sbjct  543  EFNVIIKDLHRDSLGQPELRTSKDGRDVTKFPIPECMCNDS  583



>emb|CDY47678.1| BnaC04g03810D [Brassica napus]
Length=528

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKEAL+PL KEFPH YNK DLALPGELE FAKKAS
Sbjct  363  VTRLLKALEAPKDARIYWAGGEPLGGKEALEPLTKEFPHLYNKHDLALPGELEPFAKKAS  422

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKR M+P+FMNASL ES
Sbjct  423  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRHMLPYFMNASLPES  482

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +FNRI+   HR+SLGQPELR  + G+D+TK+PV +CMC+
Sbjct  483  EFNRIVKDFHRESLGQPELRTGRGGKDVTKHPVSECMCS  521



>ref|XP_010524461.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=570

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP++ RIYWAGG PLGGKEAL+PLI EFPH +NK+DLAL  ELE FAKKAS
Sbjct  404  VTRLLKALDAPRNTRIYWAGGEPLGGKEALKPLISEFPHLHNKQDLALLHELEPFAKKAS  463

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVFMPSHGGNMGHALQG RAYAGHKK ITP KRQMIP+FMN+SL E+
Sbjct  464  VMAAIDYIVCEKSDVFMPSHGGNMGHALQGERAYAGHKKYITPKKRQMIPYFMNSSLPEA  523

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +FN I+  LHRDSLGQPE+R  K G+D+TK+P+P+CMCN + G
Sbjct  524  EFNMIVKELHRDSLGQPEIRTSKAGKDVTKHPIPECMCNDSAG  566



>ref|XP_006850060.1| hypothetical protein AMTR_s00022p00204610 [Amborella trichopoda]
 gb|ERN11641.1| hypothetical protein AMTR_s00022p00204610 [Amborella trichopoda]
Length=539

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP++ARIYWAGG P GG EALQPLIKEFP+F+NKE+L+LPGELE FA KAS
Sbjct  370  VARLLKALGAPRNARIYWAGGKPFGGLEALQPLIKEFPNFFNKENLSLPGELEPFANKAS  429

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIVSE+SDVFMPSHGGNMGHA+QGHRAYAGH K ITPNKR+M+P+F++ SL ES
Sbjct  430  LLAAIDYIVSESSDVFMPSHGGNMGHAIQGHRAYAGHMKHITPNKREMLPYFLDNSLPES  489

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +FNR+I  LH++SLGQP++R  K GRD+  YPVP+CMCN
Sbjct  490  EFNRVIKELHKNSLGQPDIRTGKTGRDVIAYPVPECMCN  528



>gb|KFK38242.1| hypothetical protein AALP_AA3G087900 [Arabis alpina]
Length=455

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  291  VTRLLRALGAPRDARIYWAGGEPLGGKEALRPLTSEFPHLYNKHDIALPLELKPFAKRAS  350

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N S++E+
Sbjct  351  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYGGHKKIITPNKRHMLPYFLNTSMTET  410

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMCN +
Sbjct  411  EFTKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMCNQS  451



>ref|XP_008795748.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
 ref|XP_008778357.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=598

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP+ ARIYWAGG P GG  ALQPL +EFPHFY+KE+L+LPGELE FA KAS
Sbjct  434  VARLLKALEAPRDARIYWAGGEPFGGPAALQPLTREFPHFYSKENLSLPGELEPFANKAS  493

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AA+DYIV E SDVFMPSHGGNMGH +QGHRA+AGHKK ITPNKRQM+P+F++ SL ES
Sbjct  494  LLAAVDYIVGERSDVFMPSHGGNMGHLMQGHRAFAGHKKFITPNKRQMLPYFLDTSLPES  553

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS-NTG  381
            +F RII  LH+ SLGQPE RK GRD+T YPVP+CMCNS NTG
Sbjct  554  EFKRIIKELHKGSLGQPEFRKLGRDVTAYPVPECMCNSTNTG  595



>ref|XP_010544540.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=576

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP++ RIYWAGG PLGGKEAL+PL  EFPH YNK+DLALP ELE FA KAS
Sbjct  410  VTRLLKALDAPRNTRIYWAGGEPLGGKEALKPLNTEFPHLYNKQDLALPSELEPFANKAS  469

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV + SDVFMPSHGGNMGHALQG RAYAGHKK ITPNKRQM+P+FMN+SL E+
Sbjct  470  VMAAIDYIVCQKSDVFMPSHGGNMGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPEA  529

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F RI+  LH +SLGQPE+R  K G+D+TK+PVP+CMCN + G
Sbjct  530  EFKRIVKELHGESLGQPEMRTSKAGKDVTKHPVPECMCNGSAG  572



>emb|CDX74661.1| BnaA05g04070D [Brassica napus]
Length=528

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKEAL+PL KEFPH YNK DLALPGELE FAKKAS
Sbjct  361  VTRLLKALEAPKDARIYWAGGEPLGGKEALEPLTKEFPHLYNKHDLALPGELEPFAKKAS  420

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKR M+ +FMNASL ES
Sbjct  421  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRHMLLYFMNASLPES  480

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +FNRI+  LHR+SLGQP LR  + G+D+TK+PV +CMC+
Sbjct  481  EFNRIVKDLHRESLGQPVLRTGRGGKDVTKHPVSECMCS  519



>ref|NP_187447.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF21200.1|AC013483_24 putative auxin-independent growth promoter [Arabidopsis thaliana]
 gb|AEE74617.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=579

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  415  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRAS  474

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N+SL+E+
Sbjct  475  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNSSLTET  534

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMCN SNT
Sbjct  535  EFEKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMCNQSNT  577



>ref|XP_010943561.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=543

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG P GG  ALQPL +EFPHFY+KE+L+LPGEL+ FA K+S
Sbjct  379  VTRLLKALGAPKDARIYWAGGEPFGGLAALQPLTREFPHFYSKENLSLPGELQPFANKSS  438

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIV E SDVFMPSHGGNMGH +QGHRA++GH+K ITPNKRQM+P+F++ SL ES
Sbjct  439  LLAAIDYIVCEQSDVFMPSHGGNMGHLMQGHRAFSGHRKFITPNKRQMLPYFLDTSLPES  498

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNT  384
            +FN II  LH+ SLGQPE RK GRD+T YPVP+CMCN+ +
Sbjct  499  EFNGIIKELHKGSLGQPEFRKVGRDVTAYPVPECMCNNTS  538



>ref|XP_009143041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Brassica rapa]
Length=556

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL APK ARIYWAGG PLGGKEAL+PL KEFPH YNK DLALPGELE FAKKAS
Sbjct  389  VTRLLKALEAPKDARIYWAGGEPLGGKEALEPLTKEFPHLYNKHDLALPGELEPFAKKAS  448

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIV E SDVF+PSHGGNMGHALQG RAYAGHKK ITPNKR M+ +FMNASL ES
Sbjct  449  VMAAIDYIVCEKSDVFIPSHGGNMGHALQGQRAYAGHKKYITPNKRHMLLYFMNASLPES  508

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +FNRI+  LHR+SLGQP LR  + G+D+TK+PV +CMC+
Sbjct  509  EFNRIVKDLHRESLGQPVLRTGRGGKDVTKHPVSECMCS  547



>ref|XP_006407782.1| hypothetical protein EUTSA_v10022290mg [Eutrema salsugineum]
 gb|ESQ49235.1| hypothetical protein EUTSA_v10022290mg [Eutrema salsugineum]
Length=585

 Score =   256 bits (655),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  420  VTRLLRALGAPREARIYWAGGEPLGGKEALKPLTSEFPHLYNKHDIALPLELKPFAKRAS  479

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N S++E+
Sbjct  480  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKLITPNKRHMLPYFLNTSMTET  539

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMCN+ +
Sbjct  540  EFKKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMCNNQS  581



>ref|XP_002882556.1| hypothetical protein ARALYDRAFT_478129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58815.1| hypothetical protein ARALYDRAFT_478129 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  408  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRAS  467

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N+S++++
Sbjct  468  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNSSMTKT  527

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMCN SNT
Sbjct  528  EFEKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMCNQSNT  570



>emb|CDY28009.1| BnaC05g44110D [Brassica napus]
Length=458

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+A P EL+ FAK+AS
Sbjct  293  VTRLLRALGAPRDARIYWAGGEPLGGKEALRPLTSEFPHLYNKYDIAFPLELKPFAKRAS  352

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMG A+QGHRAY GHKK ITPNKRQM+P+F+N +++E+
Sbjct  353  IMAAIDYIVCKESDVFMASHGGNMGRAIQGHRAYEGHKKLITPNKRQMLPYFLNKTMTET  412

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F +++  LHR SLGQPE+R  K GRD+TKYPVP+CMCN+ T
Sbjct  413  EFEKMMKKLHRQSLGQPEIRVSKAGRDVTKYPVPECMCNNQT  454



>ref|XP_010928447.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=538

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP+ ARIYWAGG P GG  ALQPL +EFP+FY+KE+L+LPGELE FA KAS
Sbjct  374  VTRLLKALEAPRDARIYWAGGEPFGGPAALQPLTREFPNFYSKENLSLPGELEPFANKAS  433

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AA+DYIV E SDVFMPSHGGNMGH +QGHRA+AGHKK ITPNKRQM+P+F++ SL ES
Sbjct  434  LVAAVDYIVCEQSDVFMPSHGGNMGHLMQGHRAFAGHKKFITPNKRQMLPYFLDTSLPES  493

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            +F++II  LH+ SLGQPE RK GRD+T YPVP+CMCNS 
Sbjct  494  EFDQIIKELHKGSLGQPEFRKIGRDVTAYPVPECMCNST  532



>ref|XP_010486367.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=578

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  414  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRAS  473

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N S+S++
Sbjct  474  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNTSMSKT  533

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMC   T
Sbjct  534  EFEKMIKKLHRQSLGQPELRVSKAGRDVTKYPVPECMCKQTT  575



>emb|CDY35972.1| BnaA05g29780D [Brassica napus]
Length=566

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  401  VTRLLRALGAPRDARIYWAGGEPLGGKEALRPLTSEFPHLYNKYDIALPHELKPFAKRAS  460

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMG A+QGHRAY GHKK ITPNKRQM+P+F+N S++E+
Sbjct  461  IMAAIDYIVCKESDVFMASHGGNMGRAIQGHRAYEGHKKLITPNKRQMLPYFLNTSMTET  520

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F +++  LHR SLGQPE+R  K GRD+TKYPVP+CMCN+ +
Sbjct  521  EFEKMMKKLHRQSLGQPEIRVSKAGRDVTKYPVPECMCNNQS  562



>ref|XP_009147015.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=566

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  401  VTRLLRALGAPRDARIYWAGGEPLGGKEALRPLTSEFPHLYNKYDIALPHELKPFAKRAS  460

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMG A+QGHRAY GHKK ITPNKRQM+P+F+N S++E+
Sbjct  461  IMAAIDYIVCKESDVFMASHGGNMGRAIQGHRAYEGHKKLITPNKRQMLPYFLNTSMTET  520

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F +++  LHR SLGQPE+R  K GRD+TKYPVP+CMCN+ +
Sbjct  521  EFEKMMKKLHRQSLGQPEIRVSKAGRDVTKYPVPECMCNNQS  562



>ref|XP_009417302.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=545

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RL+KALGAPK ARIYWAGG P GG EAL PLI EFPH YNKE+++ PGELE FA K+S
Sbjct  379  VTRLIKALGAPKDARIYWAGGEPFGGPEALLPLITEFPHLYNKENISQPGELERFASKSS  438

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIV E SDVFMPSHGGNMGH +QGHRAYAGH+K ITPNKRQM+P+F++ASL +S
Sbjct  439  VLAAIDYIVCEQSDVFMPSHGGNMGHLMQGHRAYAGHRKFITPNKRQMLPYFVDASLPDS  498

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +FNRII  LHR SLGQPE R  K G+D+T YPVP+CMCN  +
Sbjct  499  EFNRIIKDLHRGSLGQPEWRTDKVGKDVTAYPVPECMCNGTS  540



>ref|XP_010464437.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=571

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFP+ YNK D+ALP EL+ FAK+AS
Sbjct  407  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPNLYNKYDIALPLELKPFAKRAS  466

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHALQGHRAY GHKK ITPNKR M+P+F+N S+S++
Sbjct  467  IMAAIDYIVCKESDVFMASHGGNMGHALQGHRAYEGHKKIITPNKRHMLPYFVNTSMSKT  526

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMC   T
Sbjct  527  EFEKMIKKLHRQSLGQPELRVSKAGRDVTKYPVPECMCKQAT  568



>ref|XP_008364704.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=582

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 145/163 (89%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEAL PLI+EFPHFYNKEDLALPGELE FA +AS
Sbjct  416  VTRLLKALGAPKSARIYWAGGQPFGGKEALLPLIEEFPHFYNKEDLALPGELEPFANRAS  475

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDY VSENSDVFMPSHGGNMG  +QGHRAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  476  VMAAIDYJVSENSDVFMPSHGGNMGXXMQGHRAYAGHKKYITPDKRHMLPYFLNSSLPEA  535

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +FNRII  LHRDSLGQP+LR  + G+D+TKYPVP+CMCN +NT
Sbjct  536  EFNRIIQELHRDSLGQPDLRSSRVGKDVTKYPVPECMCNDTNT  578



>ref|XP_010459424.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=578

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFP+ YNK D+ALP EL+ FAK+AS
Sbjct  414  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPNLYNKYDIALPLELKPFAKRAS  473

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F+N S+S++
Sbjct  474  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNTSMSKT  533

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CMC   T
Sbjct  534  EFEKMIKKLHRQSLGQPELRVSKAGRDVTKYPVPECMCKQAT  575



>ref|XP_006299231.1| hypothetical protein CARUB_v10015380mg [Capsella rubella]
 gb|EOA32129.1| hypothetical protein CARUB_v10015380mg [Capsella rubella]
Length=578

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+ ARIYWAGG PLGGKEAL+PL  EFPH YNK D+ALP EL+ FAK+AS
Sbjct  413  VTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRAS  472

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAAIDYIV + SDVFM SHGGNMGHA+QGHRAY GHKK ITPNKR M+P+F N S+S++
Sbjct  473  IMAAIDYIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFANTSMSKT  532

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F ++I  LHR SLGQPELR  K GRD+TKYPVP+CM N  T
Sbjct  533  EFEKMIKKLHRQSLGQPELRISKAGRDVTKYPVPECMSNQVT  574



>ref|XP_008375254.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=466

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPKSARIYWAGG P GGKEAL PLI+EFPHFYNKEDLALPGELE FA +AS
Sbjct  300  VTRLLKALGAPKSARIYWAGGQPFGGKEALLPLIEEFPHFYNKEDLALPGELEPFANRAS  359

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDY VSENSDVFMPSHGGNMG  +QG RAYAGHKK ITP+KR M+P+F+N+SL E+
Sbjct  360  VMAAIDYJVSENSDVFMPSHGGNMGXXMQGXRAYAGHKKYITPDKRHMLPYFLNSSLPEA  419

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN-SNT  384
            +FNRII  LHRDSLGQP+LR  + G+D+TKYP P+CMCN +NT
Sbjct  420  EFNRIIXELHRDSLGQPDLRSSRVGKDVTKYPXPECMCNDTNT  462



>gb|EPS67731.1| hypothetical protein M569_07044, partial [Genlisea aurea]
Length=166

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKE-ALQPLIKEFPHFYNKEDLALPGELEAFAKKASI  681
            RLLKALGAP  A IYWAGG+PLGG+E AL PL KEFP+ YNKED+A  GELE ++ +ASI
Sbjct  1    RLLKALGAPGDAAIYWAGGMPLGGEEEALSPLRKEFPNMYNKEDIASEGELEPYSNRASI  60

Query  680  MAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESD  501
            MAA+DY+V E SDVFM SHGGNMGHA+QG RAY GH+KTI PNKR+M+P+F+N+SL   +
Sbjct  61   MAAVDYVVCERSDVFMASHGGNMGHAIQGERAYGGHRKTIVPNKREMLPYFLNSSLPRDE  120

Query  500  FNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            F+RI+  LH DSLG+PE+R  K GRD+TKYP+P+CMCN
Sbjct  121  FDRIVMELHVDSLGRPEIRTSKAGRDVTKYPIPECMCN  158



>ref|XP_008812582.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=546

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG P GG  ALQPL +EF HFY+KE+L+LPGELE FA K+S
Sbjct  381  VTRLLKALGAPKDARIYWAGGEPFGGPAALQPLTREFSHFYSKENLSLPGELEPFANKSS  440

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIV E SD FMPSHGGNMGH ++GHRA+AGHKK ITPNKRQM+P+F++ SL ES
Sbjct  441  LLAAIDYIVCEQSDAFMPSHGGNMGHLMRGHRAFAGHKKFITPNKRQMLPYFLDTSLPES  500

Query  503  DFNRIISYLHRDSLGQPELRKPG-RDITKYPVPDCMCNSNTG  381
            +F+ II  LH+ SLGQPE RK G RD+T YPVP+CMCN+   
Sbjct  501  EFHGIIKELHKGSLGQPEFRKVGRRDVTAYPVPECMCNNTNA  542



>ref|XP_009394998.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=539

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP  A IYWAGG P GG EAL PL +EFPH YNK++L+LPGELE FAKKAS
Sbjct  373  VTRLLKALGAPPDAMIYWAGGEPFGGPEALLPLTREFPHLYNKDNLSLPGELEPFAKKAS  432

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIV E SDVFMPSHGGNMGH +QGHRA+AGH+K ITPNKRQM+P+F++ASL E 
Sbjct  433  LLAAIDYIVCEQSDVFMPSHGGNMGHLMQGHRAFAGHRKFITPNKRQMLPYFLDASLPEL  492

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F+RII  LHR SLGQPE R  K  +D+T +PVP+CMCN  +
Sbjct  493  EFHRIIKELHRGSLGQPEWRSDKVDKDVTAFPVPECMCNGTS  534



>ref|XP_009415424.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=554

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP+ ARIYWAGG P GG++AL PL+ EFPH YNKE L LPGELE FA ++S
Sbjct  387  VTRLLKALEAPRDARIYWAGGQPFGGRQALLPLLYEFPHLYNKESLTLPGELEQFANRSS  446

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIV E SDVFM SHGGNMGH ++GHRA+AGHKK IT NKRQMIP+F++ SL ES
Sbjct  447  LLAAIDYIVCEQSDVFMASHGGNMGHLMRGHRAFAGHKKFITANKRQMIPYFLDTSLPES  506

Query  503  DFNRIISYLHRDSLGQPELR---KPGRDITKYPVPDCMCNSNT  384
            +FNRI+  LH+ SLGQPELR   K G+D+T YPVP+CMCN  +
Sbjct  507  EFNRIVKELHQGSLGQPELRTDHKVGKDVTAYPVPECMCNGTS  549



>ref|XP_009405037.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKAL AP+ ARIYWAGG P GG++AL PL++EFP+ Y+KE+L LPGEL  FA ++S
Sbjct  376  VTRLLKALEAPRDARIYWAGGEPFGGRDALLPLMREFPNLYSKENLTLPGELGPFANRSS  435

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAID +V E SDVFM SHGGNMGH ++G RA+AGH+K ITPNKRQM+ HFMNASL  S
Sbjct  436  LLAAIDDVVCEQSDVFMASHGGNMGHLMRGQRAFAGHRKFITPNKRQMLRHFMNASLPAS  495

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            + NRI+  LHR SLGQPELR  K GRD+T YP+P+CMC 
Sbjct  496  ELNRIVKELHRGSLGQPELRTDKIGRDVTAYPLPECMCE  534



>ref|XP_002965190.1| hypothetical protein SELMODRAFT_83648 [Selaginella moellendorffii]
 gb|EFJ34028.1| hypothetical protein SELMODRAFT_83648 [Selaginella moellendorffii]
Length=481

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ LGA    RIYWAGG P GG  ALQPL +EFP+  NK D+A P ELEAF  KAS
Sbjct  318  VARLLRGLGATSWTRIYWAGGEPFGGSRALQPLKQEFPNLVNKHDIATPQELEAFRSKAS  377

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDY+VS NSDVFMPSHGGNMGHAL+GHRAY GH+K ITPNKR+M+P F+N+SL + 
Sbjct  378  RLAAIDYVVSLNSDVFMPSHGGNMGHALKGHRAYTGHRKHITPNKREMLPFFLNSSLPQR  437

Query  503  DFNRIISYLHRDSLGQPE--LRKPGRDITKYPVPDCMCNSN  387
            DFN  I  LHR+S+GQP   + K GRD+  YPV +CMC +N
Sbjct  438  DFNAAIRELHRESVGQPAMWMEKKGRDVLGYPVAECMCKTN  478



>ref|XP_002962277.1| hypothetical protein SELMODRAFT_76196 [Selaginella moellendorffii]
 gb|EFJ37537.1| hypothetical protein SELMODRAFT_76196 [Selaginella moellendorffii]
Length=481

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ LGA    RIYWAGG P GG  ALQ L +EFP+  NK D+A P ELEAF  KAS
Sbjct  318  VARLLRGLGATSWTRIYWAGGEPFGGSRALQQLKQEFPNLVNKHDIATPQELEAFRSKAS  377

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDY+VS NSDVFMPSHGGNMGHAL+GHRAY GH+K ITPNKR+M+P F+N+SL + 
Sbjct  378  RLAAIDYVVSLNSDVFMPSHGGNMGHALKGHRAYTGHRKHITPNKREMLPFFLNSSLPQR  437

Query  503  DFNRIISYLHRDSLGQPE--LRKPGRDITKYPVPDCMCNSN  387
            DFN  I  LHR+S+GQP   + K GRD+  YPV +CMC +N
Sbjct  438  DFNAAIRELHRESVGQPAMWMEKKGRDVLGYPVAECMCKTN  478



>ref|XP_003589433.1| DUF246 domain-containing protein, partial [Medicago truncatula]
Length=583

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGA K ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FAKKAS
Sbjct  459  VTRLLKALGAQKDARIYWAGGQPLGGKEALHPLIHEFPHLYNKEDLALPGELEPFAKKAS  518

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAAIDYIVSE SDVFMPSHGGNMGHALQGHRAYAGHKK ITPNKRQM P+F+N SL E+
Sbjct  519  LMAAIDYIVSEKSDVFMPSHGGNMGHALQGHRAYAGHKKYITPNKRQMHPYFLNPSLPEA  578

Query  503  DFNRI  489
            +FN I
Sbjct  579  EFNSI  583



>gb|KGN64393.1| hypothetical protein Csa_1G050320 [Cucumis sativus]
Length=162

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGAPK ARIY AGG P GGK+ALQPLI EFP+   K  L+  GEL  F  K+S M
Sbjct  5    RLLKALGAPKQARIYTAGGEPFGGKKALQPLIAEFPNIVTKYTLSREGELSPFINKSSAM  64

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVFMPSHGGNMG A+QGHRAY GH+K I PNKR M+ +F +AS+SE++ 
Sbjct  65   AAIDYIVSLSSDVFMPSHGGNMGRAMQGHRAYVGHRKYIKPNKRAMLEYFDDASISETEL  124

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
              I+  LH+  +G+PE R  +  RDI  YP+P+CMC S
Sbjct  125  GTIVRKLHKGCMGKPERRTKRKDRDIIAYPMPECMCQS  162



>ref|XP_006840183.1| hypothetical protein AMTR_s00089p00101430 [Amborella trichopoda]
 gb|ERN01858.1| hypothetical protein AMTR_s00089p00101430 [Amborella trichopoda]
Length=477

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ALGAP+S+RIYWAGG  LGG EAL+ L++ F +   KE LALPGELE F  K+S
Sbjct  316  VARLLEALGAPRSSRIYWAGGEALGGDEALRALVERFTNLVKKETLALPGELEPFINKSS  375

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AA+DYIV+  SDVFMPSHGGNM   +QGHRAY GHKK ITPNKR M P+F + SL E+
Sbjct  376  ALAAVDYIVALYSDVFMPSHGGNMARTMQGHRAYLGHKKYITPNKRGMSPYFSDHSLPEA  435

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
             F  I  +LH+D LGQP LR  K GRD+T +PVP+CMC
Sbjct  436  AFVTIAKHLHKDKLGQPRLRCSKKGRDVTAFPVPECMC  473



>ref|XP_010677955.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=534

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            + V RLLKALGAP+ AR+Y AGG P GG  AL+PLI+EFP+   K+ LA  GEL  FA +
Sbjct  370  FEVARLLKALGAPRDARVYVAGGKPYGGSMALKPLIQEFPNVMTKDSLAREGELLQFANR  429

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIV+ +SDVF+PSHGGNMG A+QGHRAY+GH+K I PNKR M+P F + S+S
Sbjct  430  SSALAAIDYIVALSSDVFLPSHGGNMGRAMQGHRAYSGHRKYIKPNKRMMLPFFEDQSIS  489

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            E++F  II  LH  S GQPELR  K  RD+  YPVP+CMC S T
Sbjct  490  EAEFGGIIRKLHEKSQGQPELRTGKRDRDVIAYPVPECMCKSRT  533



>gb|ADN33952.1| hypothetical protein [Cucumis melo subsp. melo]
Length=465

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAPK ARIY AGG P GGK+ALQPLI EFP+   K  L+  GEL  F  K+S
Sbjct  306  IARLLKALGAPKQARIYTAGGEPFGGKKALQPLIAEFPNIVTKYTLSREGELSPFINKSS  365

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +SDVFMPSHGGNMG A+QGHRAY GH+K I PNKR M+ +F +AS+SE+
Sbjct  366  AMAAIDYIVSLSSDVFMPSHGGNMGRAMQGHRAYVGHRKYIKPNKRAMLEYFDDASISET  425

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            +   I+  LH+  +GQPE R  +  RDI  YP+P+CMC S
Sbjct  426  ELGTIVRKLHKGCMGQPEPRTKRKDRDIIAYPMPECMCQS  465



>ref|XP_010102888.1| hypothetical protein L484_002686 [Morus notabilis]
 gb|EXB94325.1| hypothetical protein L484_002686 [Morus notabilis]
Length=536

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGAP++ RIY AGG P GG +ALQPLI EFP+   KE LA  GEL  FA K+S +
Sbjct  374  RLLKALGAPRTTRIYNAGGEPFGGSKALQPLIAEFPNLVTKEMLARDGELSPFANKSSAL  433

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+PSHGGNMG ALQGHRAY GH+K I PNKR M+P F +AS+S+++F
Sbjct  434  AAIDYIVSLSSDVFVPSHGGNMGRALQGHRAYVGHRKYIKPNKRAMLPFFEDASVSDAEF  493

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            + I+  LH  S GQPELR  +  RD+  YPVP+CMC
Sbjct  494  STIMRELHSKSQGQPELRNFRIDRDVIAYPVPECMC  529



>ref|XP_008439494.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=591

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAPK ARIY AGG P GGK+ALQPLI EFP+   K  L+  GEL  F  K+S
Sbjct  432  IARLLKALGAPKQARIYTAGGEPFGGKKALQPLIAEFPNIVTKYTLSREGELSPFINKSS  491

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +SDVFMPSHGGNMG A+QGHRAY GH+K I PNKR M+ +F +AS+SE+
Sbjct  492  AMAAIDYIVSLSSDVFMPSHGGNMGRAMQGHRAYVGHRKYIKPNKRAMLEYFDDASISET  551

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            +   I+  LH+  +GQPE R  +  RDI  YP+P+CMC S
Sbjct  552  ELGTIVRKLHKGCMGQPEPRTKRKDRDIIAYPMPECMCQS  591



>ref|XP_004167707.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=559

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAPK ARIY AGG P GGK+ALQPLI EFP+   K  L+  GEL  F  K+S
Sbjct  400  IARLLKALGAPKQARIYTAGGEPFGGKKALQPLIAEFPNIVTKYTLSREGELSPFINKSS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +SDVFMPSHGGNMG A+QGHRAY GH+K I PNKR M+ +F +AS+SE+
Sbjct  460  AMAAIDYIVSLSSDVFMPSHGGNMGRAMQGHRAYVGHRKYIKPNKRAMLEYFDDASISET  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            +   I+  LH+  +G+PE R  +  RDI  YP+P+CMC S
Sbjct  520  ELGTIVRKLHKGCMGKPERRTKRKDRDIIAYPMPECMCQS  559



>ref|XP_004152592.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=559

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAPK ARIY AGG P GGK+ALQPLI EFP+   K  L+  GEL  F  K+S
Sbjct  400  IARLLKALGAPKQARIYTAGGEPFGGKKALQPLIAEFPNIVTKYTLSREGELSPFINKSS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +SDVFMPSHGGNMG A+QGHRAY GH+K I PNKR M+ +F +AS+SE+
Sbjct  460  AMAAIDYIVSLSSDVFMPSHGGNMGRAMQGHRAYVGHRKYIKPNKRAMLEYFDDASISET  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
            +   I+  LH+  +G+PE R  +  RDI  YP+P+CMC S
Sbjct  520  ELGTIVRKLHKGCMGKPERRTKRKDRDIIAYPMPECMCQS  559



>ref|XP_006477558.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=467

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP SARIY AGG P GG +ALQPL  EFP+   KE LA  GEL  +  ++S
Sbjct  303  IARFLKALGAPSSARIYIAGGEPFGGHQALQPLAAEFPNLVTKEMLAQEGELSPYVNRSS  362

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS NS+VF+PSHGGNMG A+QGHRAY GH+K I PNK+ M+P F ++S+S+ 
Sbjct  363  SLAAIDYIVSLNSNVFVPSHGGNMGRAMQGHRAYVGHRKYIKPNKKAMLPFFEDSSISDE  422

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  II  +H  S GQPE R  K  RD+T YPVP+CM   NTG
Sbjct  423  EFGSIIRKIHSKSQGQPERRTNKRDRDVTAYPVPECMRKHNTG  465



>ref|XP_010248906.1| PREDICTED: uncharacterized protein At1g04910 [Nelumbo nucifera]
Length=566

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 118/159 (74%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP+SAR+Y AGG P GG  AL+PL+ EFP+   KE LA  GEL  +  ++S
Sbjct  407  VARLLKALGAPRSARVYCAGGKPFGGSRALRPLMMEFPNVVTKEMLARDGELAPYVNRSS  466

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVFMPSHGGNM  A+QG RAYAGH+K I PNKR M+P+F + S+S++
Sbjct  467  ALAAIDYIVSLSSDVFMPSHGGNMARAMQGDRAYAGHRKYIKPNKRAMLPYFEDDSISDA  526

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCN  393
            +F  I+  LHR  +GQPE R  K  RD+  YP+PDCMC 
Sbjct  527  EFGSIMKKLHRTLVGQPEPRTNKRDRDVIAYPIPDCMCT  565



>ref|XP_004236554.2| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=436

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            R LK LGAP SARIY AGG P GG +A+QPL  EFP+   K  LA  GEL  + +K+S +
Sbjct  279  RFLKGLGAPISARIYVAGGEPFGGTQAMQPLKDEFPNLLTKHTLARNGELTPYLEKSSTL  338

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+ SHGGNMG AL+GHRAY GH+K I PNKR M+P F ++S+SE +F
Sbjct  339  AAIDYIVSLSSDVFINSHGGNMGRALEGHRAYVGHRKYIKPNKRMMLPFFEDSSVSEQEF  398

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNS  390
             RI+  LHR S GQPE R  K  RD+  YPVP+CMC  
Sbjct  399  KRIMKKLHRKSQGQPEPRAKKIDRDVIAYPVPECMCKQ  436



>ref|XP_010550723.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGAP SA IY AGG P GG  AL+PL++EFP+   KE LA  GEL +++ K+S +
Sbjct  398  RLLKALGAPSSAEIYIAGGEPFGGSRALEPLVEEFPNLVTKETLAHKGELSSYSNKSSAL  457

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR ++P   +AS++ES+ 
Sbjct  458  AAIDYIVSLSSDVFVPSHGGNMARAMQGYRAYTGHRKFIMPNKRAILPLMEDASVTESEL  517

Query  497  NRIISYLHRDSLGQPELRKP--GRDITKYPVPDCMC  396
            +RII  +HR S GQPE RK    RD+  YPVP+CMC
Sbjct  518  SRIIRKIHRKSQGQPEQRKRRIDRDVVAYPVPECMC  553



>ref|XP_007210126.1| hypothetical protein PRUPE_ppa022449mg [Prunus persica]
 gb|EMJ11325.1| hypothetical protein PRUPE_ppa022449mg [Prunus persica]
Length=562

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP  ARIY AGG   G   ALQPL+ EFP+   KE LA  GEL  +  K+S
Sbjct  398  IARFLKALGAPSGARIYRAGGEAFGDSRALQPLVAEFPNLVTKEMLARDGELSPYMNKSS  457

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY GH+K I PNKR M+PHF +AS+ ++
Sbjct  458  ALAAIDYIVSLSSDVFVPSHGGNMGRAMQGHRAYVGHRKFIKPNKRAMLPHFEDASIGDA  517

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S G+PE R  +  RD+  YPVP+CMC  N G
Sbjct  518  EFGSIMRELHRKSQGKPEPRGYRRNRDVIAYPVPECMCKHNAG  560



>ref|XP_008374303.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=564

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP+ ARIY AGG   GG  ALQPL++EFP+   KE LA  GEL  +  KAS
Sbjct  400  IARFLKALGAPRGARIYSAGGKAFGGNRALQPLVEEFPNLVTKEMLARDGELSPYMNKAS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNMG A+QGHRAYA H+K I PNKR M+P F + S+ ++
Sbjct  460  ALAAIDYIVSLSSDVFVPSHGGNMGRAMQGHRAYAEHRKFIKPNKRAMLPLFEDNSIGDA  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S GQPE R  +  RD+  YPVP+CMC  +TG
Sbjct  520  EFGSIMRELHRKSQGQPEPRGYRRNRDVIAYPVPECMCKRSTG  562



>ref|XP_010550722.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=640

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGAP SA IY AGG P GG  AL+PL++EFP+   KE LA  GEL +++ K+S +
Sbjct  398  RLLKALGAPSSAEIYIAGGEPFGGSRALEPLVEEFPNLVTKETLAHKGELSSYSNKSSAL  457

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR ++P   +AS++ES+ 
Sbjct  458  AAIDYIVSLSSDVFVPSHGGNMARAMQGYRAYTGHRKFIMPNKRAILPLMEDASVTESEL  517

Query  497  NRIISYLHRDSLGQPELRKP--GRDITKYPVPDCMC  396
            +RII  +HR S GQPE RK    RD+  YPVP+CMC
Sbjct  518  SRIIRKIHRKSQGQPEQRKRRIDRDVVAYPVPECMC  553



>ref|XP_009336577.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=564

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP++ARIY AGG   GG  ALQPL++EFP+   KE LA  GEL  +  KAS
Sbjct  400  IARFLKALGAPRAARIYSAGGEAFGGNRALQPLVEEFPNLVTKEMLARDGELSPYVNKAS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY  H+K I PNKR M+P F + S+ ++
Sbjct  460  ALAAIDYIVSLSSDVFVPSHGGNMGRAMQGHRAYIEHRKFIKPNKRAMLPLFEDNSIGDA  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S GQPE R  +  RD+  YPVP+CMC  +TG
Sbjct  520  EFGSIMRELHRKSQGQPEPRGYRRNRDVIAYPVPECMCKHSTG  562



>ref|XP_006351561.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=555

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            R LK LGAP SARIY AGG P GG +A+QPL  EFP+   K  L   GEL  + +K+S +
Sbjct  398  RFLKGLGAPISARIYVAGGEPFGGTQAMQPLKNEFPNLLTKHTLVRNGELTPYLEKSSTL  457

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+ SHGGNMG AL+GHRAY GH+K I PNKR M+P F ++S+SE +F
Sbjct  458  AAIDYIVSLSSDVFINSHGGNMGRALEGHRAYVGHRKYIKPNKRMMLPFFEDSSVSEQEF  517

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
             RI+  LHR S GQPE R  K  RD+  YPVP+CMC
Sbjct  518  KRIMKKLHRKSQGQPESRAKKIDRDVIAYPVPECMC  553



>ref|XP_008239627.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=642

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP  ARIY AGG   G   ALQPL+ EFP+   KE LA  GEL  +  K+S
Sbjct  398  IARFLKALGAPSGARIYSAGGEAFGDSRALQPLVAEFPNLVTKEMLARDGELSPYMNKSS  457

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY GH+K I PNKR M+PHF +AS+ ++
Sbjct  458  ALAAIDYIVSLSSDVFVPSHGGNMGRAMQGHRAYVGHRKFIKPNKRAMLPHFEDASIGDA  517

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
            +F  I+  LHR S GQPE R  +  RD+  YPVP+CMC  N
Sbjct  518  EFGSIMRELHRKSQGQPEPRGYRRNRDVIAYPVPECMCKHN  558



>gb|EYU23112.1| hypothetical protein MIMGU_mgv1a018918mg [Erythranthe guttata]
Length=550

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP++A IY AGG P GG  ALQPL+ EFP    KE LA  GEL+ +  + S
Sbjct  391  VARLLKALGAPRNAHIYIAGGEPFGGAHALQPLVHEFPKIATKEILAREGELDPYINRPS  450

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY GH+K I PNKR M+P   + S++E 
Sbjct  451  VLAAIDYIVSLSSDVFLPSHGGNMGRAMQGHRAYVGHRKYIKPNKRMMLPLMEDGSITEG  510

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            +F +I+  LH+ S GQP LR  K  RD+  YPVP+CMC
Sbjct  511  EFGKIMQKLHKYSKGQPLLRNKKLDRDVLAYPVPECMC  548



>ref|XP_009346524.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=564

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP+ ARIY AGG   GG  ALQPL++EFP+   KE LA  GEL  +  KAS
Sbjct  400  IARFLKALGAPRGARIYSAGGEAFGGNRALQPLVEEFPNLVTKEMLARDGELSPYMNKAS  459

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY  H+K I PNKR M+P F + S+ ++
Sbjct  460  ALAAIDYIVSLSSDVFVPSHGGNMGRAMQGHRAYVEHRKFIKPNKRAMLPLFEDNSIGDA  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S GQPE R  +  RD+  YPVP+CMC  +TG
Sbjct  520  EFGSIMRELHRKSQGQPEPRGYRRNRDVIAYPVPECMCKHSTG  562



>ref|XP_009772998.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=551

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            R LK LGAP SARIY AGG P G  +A+QPL KEFP+   K  LA  GEL  + +K+SI+
Sbjct  394  RFLKGLGAPSSARIYVAGGEPFGDAQAMQPLQKEFPNLVKKHTLARNGELTPYLEKSSIL  453

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+ SHGGNMG  L+GHRAY GH+K I PNKR M+P F ++S+ + +F
Sbjct  454  AAIDYIVSLSSDVFINSHGGNMGRTLEGHRAYVGHRKYIKPNKRMMLPFFEDSSIPDQEF  513

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
             RII  LHR S GQPE R  K  RD+  YPVP+CMC
Sbjct  514  KRIIKKLHRKSQGQPEPRTKKIDRDVIAYPVPECMC  549



>ref|XP_011024396.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=559

 Score =   192 bits (489),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP +ARIY AGG P GG  ALQPLI EFP+   KE LA  GEL  F KKAS
Sbjct  398  IARFLKALGAPSTARIYVAGGEPFGGSLALQPLISEFPNVITKEILARGGELSPFIKKAS  457

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +S+VF+PSHGGN G  +QGHRAYAGHKK I PNKR M+P F N++    
Sbjct  458  ALAAIDYIVSLSSNVFIPSHGGNFGRVMQGHRAYAGHKKHIRPNKRAMLPVFENSTF---  514

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F  II  LH+ S GQPE R  K  RD+  YPVP+CMC   T
Sbjct  515  EFGSIIRTLHKKSQGQPEPRTNKRDRDVIAYPVPECMCKHRT  556



>ref|XP_006440070.1| hypothetical protein CICLE_v10023901mg [Citrus clementina]
 gb|ESR53310.1| hypothetical protein CICLE_v10023901mg [Citrus clementina]
Length=564

 Score =   192 bits (488),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP SARIY AGG P GG +ALQPL  EFP+   KE LA  GEL  +  ++S
Sbjct  401  IARFLKALGAPSSARIYIAGGEPFGGHQALQPLAAEFPYLVTKEMLAQEGELSPYVNRSS  460

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS NS+VF+PSHGGNMG  +QGHRAY GH K I PNK+ M+P F ++S+S+ 
Sbjct  461  SLAAIDYIVSLNSNVFVPSHGGNMGRVMQGHRAYVGHWKYIKPNKKAMLP-FFDSSISDE  519

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  II  +H  S GQPE R  K  RD+T YPVP+CM   NTG
Sbjct  520  EFGSIIRKIHSKSQGQPERRTNKRDRDVTAYPVPECMRKHNTG  562



>ref|XP_002322236.1| hypothetical protein POPTR_0015s10470g [Populus trichocarpa]
 gb|EEF06363.1| hypothetical protein POPTR_0015s10470g [Populus trichocarpa]
Length=559

 Score =   192 bits (487),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP +ARIY AGG P GG  ALQPLI EFP+   KE LA  GEL  F KKAS
Sbjct  398  IARFLKALGAPSTARIYIAGGEPFGGSLALQPLIAEFPNVITKEILARGGELSPFIKKAS  457

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYI+S +S+VF+PSHGGN G  +QGHRAYAGHKK I PNKR M+P F N++    
Sbjct  458  ALAAIDYIISLSSNVFIPSHGGNFGRVMQGHRAYAGHKKHIRPNKRAMLPVFENSTF---  514

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F  II  LH+ S GQPE R  K  RD+  YPVP+CMC   T
Sbjct  515  EFGSIIRTLHKKSQGQPEPRTNKRDRDVIAYPVPECMCKHRT  556



>ref|XP_008392956.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=561

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP+ ARIY AGG   GG  ALQPL+ EFP+   KE LA  GEL  +  KAS
Sbjct  397  IARFLKALGAPRGARIYSAGGEAFGGSRALQPLVDEFPNLVTKEMLARDGELXPYMNKAS  456

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDY VS +SDV +PSHGGNMG A+QGHRAY GH+K I PNKR M+P F ++S+ ++
Sbjct  457  ALAAIDYTVSLSSDVXVPSHGGNMGRAMQGHRAYVGHRKFIKPNKRAMLPLFEDSSIGDA  516

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S GQPE R  +  RD+  YPVP+CMC  +TG
Sbjct  517  EFGSIMRGLHRKSQGQPEPRGYRRNRDVIAYPVPECMCKHSTG  559



>ref|XP_011090093.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=545

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLL+ LGAP +ARIY AGG P GG  A+QPL+ EFP+   K+ LA  GEL  +  + S
Sbjct  386  VARLLRGLGAPSNARIYVAGGEPFGGSCAIQPLVHEFPNIATKKTLARQGELTPYLNRPS  445

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            ++AAIDYIVS +SDVF+PSHGGNMG A+QGHRAY GH+K I PNKR ++P   N S+S+ 
Sbjct  446  VLAAIDYIVSLSSDVFLPSHGGNMGRAMQGHRAYVGHRKYIKPNKRMIVPLLENTSVSDE  505

Query  503  DFNRIISYLHRDSLGQPELRKP--GRDITKYPVPDCMC  396
             F R I  LH+ S GQPE RK    RD+  YPVP+CMC
Sbjct  506  KFRRTIQKLHKYSKGQPEWRKKKLDRDVLAYPVPECMC  543



>ref|XP_002279576.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI15631.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAP++AR+Y AGG P GG +ALQ L+ EFP+   KE LA  GEL  +  + S
Sbjct  394  VARLLKALGAPRTARVYRAGGEPFGGAKALQALMGEFPNVVTKEMLAREGELSPYVNRPS  453

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAA+DYIVS +SDVF+PSHGGNMG A+QGHRAY GH+K + P+KR+MI  F +AS+SE+
Sbjct  454  AMAALDYIVSLSSDVFLPSHGGNMGRAMQGHRAYVGHRKFVKPDKREMIAFFEDASISEA  513

Query  503  DFNRIISYLHRDSLGQPELR---KPGRDITKYPVPDCMC  396
            +F  I+  LH    GQPE R   +  RD+  YPVP+CMC
Sbjct  514  EFRSIMRKLHSRYQGQPEKRTNKRSTRDVIAYPVPECMC  552



>ref|XP_002980115.1| hypothetical protein SELMODRAFT_111978 [Selaginella moellendorffii]
 ref|XP_002991907.1| hypothetical protein SELMODRAFT_186445 [Selaginella moellendorffii]
 gb|EFJ07018.1| hypothetical protein SELMODRAFT_186445 [Selaginella moellendorffii]
 gb|EFJ18985.1| hypothetical protein SELMODRAFT_111978 [Selaginella moellendorffii]
Length=446

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R L+ALGA    R++WAGG   GG ++L+PL  EFP  Y+K  +A P E+E F +KAS
Sbjct  278  IARTLRALGANSRTRVFWAGGEAFGGSKSLEPLRAEFPLLYDKFSIAEPWEMEPFREKAS  337

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSE  507
             +AAIDYI++ NSDVF+PSHGGNMGHAL+GHRAY GH+K ITP KR +I  F+N +S+ E
Sbjct  338  SLAAIDYIITLNSDVFIPSHGGNMGHALRGHRAYVGHRKYITPQKRDLIQLFLNSSSMRE  397

Query  506  SDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
             + N  I  LH ++ G+P+LR  KP RD+  YPVP+CMC S+
Sbjct  398  EEINDEIKRLHSEANGRPQLRMEKPTRDVLGYPVPECMCRSS  439



>ref|XP_010460218.1| PREDICTED: uncharacterized protein At1g04910 [Camelina sativa]
Length=559

 Score =   190 bits (483),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP++A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  +
Sbjct  391  YEIARLLKALGAPRNASIYIAGGEPFGGARALEPLAKEFSNLVTKETLAHKGELLPYTNR  450

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAYAGH+K I PNKR M+P   N+S+S
Sbjct  451  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYAGHRKFIMPNKRAMLPLMENSSVS  510

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+F+ +I  LHR + G PE R  +  RD+  YPVP+CMC
Sbjct  511  ESEFSLVIRKLHRKTQGHPESRRGRRDRDVIAYPVPECMC  550



>ref|XP_009359529.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=559

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP+ ARIY AGG   GG  ALQPL+ EFP+   KE LA  GEL  +  KAS
Sbjct  395  IARFLKALGAPRGARIYSAGGEAFGGSGALQPLVDEFPNLVTKEMLARDGELSPYMNKAS  454

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDY VS +SDVF PSHGGNMG A+QGHRAY GH+K I PNKR M+P F + S+S++
Sbjct  455  ALAAIDYTVSLSSDVFAPSHGGNMGRAMQGHRAYVGHRKFIKPNKRAMLPLFEDNSISDA  514

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNTG  381
            +F  I+  LHR S GQ E R  +  RD+  YPVP+CMC  +TG
Sbjct  515  EFGSIMRGLHRKSQGQLEPRGYRRNRDVIAYPVPECMCKHSTG  557



>ref|XP_010485298.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=562

 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP++A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  +
Sbjct  391  YEIARLLKALGAPRNASIYIAGGEPFGGARALEPLSKEFSNLVTKETLAHKGELLPYTNR  450

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAYAGH+K I PNKR M+P   N+S+S
Sbjct  451  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYAGHRKFIMPNKRAMLPLMENSSVS  510

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+F+ ++  LHR S G PE R  +  RD+  YPVP+CMC
Sbjct  511  ESEFSLVMRKLHRKSQGHPESRRGRRDRDVIAYPVPECMC  550



>ref|XP_009624336.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=551

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            R L  LG P SA IY AGG P GG +A+QPL KEFP+   K  L   GEL  + +K+S++
Sbjct  394  RFLNGLGVPSSAHIYVAGGEPFGGAQAMQPLQKEFPNLVTKHTLERNGELTPYLEKSSML  453

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +SDVF+ SHGGNMG AL+GHRAY GH+K I PNKR M+P F + SL E +F
Sbjct  454  AAIDYIVSLSSDVFINSHGGNMGRALEGHRAYVGHRKYIKPNKRMMLPFFEDPSLPEEEF  513

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
             RII  LHR S GQPE R  K  RD+  YPVP+CMC
Sbjct  514  KRIIKKLHRKSQGQPEPRTKKIDRDVIAYPVPECMC  549



>gb|KDP30951.1| hypothetical protein JCGZ_11327 [Jatropha curcas]
Length=387

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 113/162 (70%), Gaps = 5/162 (3%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAP+SA IY AGG P GG +ALQPL  E+      E LA  GEL  + KKAS
Sbjct  226  IARLLKALGAPRSALIYVAGGEPFGGSQALQPLAAEYQIL---EMLAKEGELAPYNKKAS  282

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +S+VF+PSHGGNMG  +QGHRAY GH K I PNKR MI  F + SLS++
Sbjct  283  AMAAIDYIVSLSSNVFIPSHGGNMGRLMQGHRAYVGHWKCIKPNKRAMIHFFEDNSLSDA  342

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
            +F  I+  LHR S GQPE R  K  RD+  YPVP+CMC   T
Sbjct  343  EFGSIVRMLHRKSRGQPEPRSNKRDRDVIAYPVPECMCKHTT  384



>ref|XP_007037929.1| O-fucosyltransferase family protein, putative [Theobroma cacao]
 gb|EOY22430.1| O-fucosyltransferase family protein, putative [Theobroma cacao]
Length=558

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 1/160 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLK+LGAP+SAR+Y AGG P GG  ALQ L  EFPH   KE LA  GEL  F   +S +
Sbjct  397  RLLKSLGAPRSARLYIAGGEPFGGTRALQQLAAEFPHLVRKEMLAREGELSPFLNSSSAL  456

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            +AIDYIVS NSD+F+PSHGGNMG AL GHRAY GH+K I PNKR ++P F + S+SE + 
Sbjct  457  SAIDYIVSFNSDIFIPSHGGNMGRALLGHRAYMGHRKCIRPNKRTILPFFEDPSISEEEL  516

Query  497  NRIISYLHRDSL-GQPELRKPGRDITKYPVPDCMCNSNTG  381
             +II  LH   L  +P  ++  +D+  +P+P+CMC   TG
Sbjct  517  RKIIRSLHNKYLKSEPSKKEKTKDVIAFPLPECMCRQGTG  556



>ref|XP_002511216.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51818.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALG   +ARIY AGG P GG +  QPL+ EF +   K+ LA  GEL  + KK+S M
Sbjct  410  RLLKALGVSSNARIYIAGGEPFGGVQTAQPLVAEFHNLVTKDMLAREGELLPYIKKSSAM  469

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AAIDYIVS +S+VF+PSHGGNMG  +QGHRAY GH K I PNKR MIP    +SLS+++F
Sbjct  470  AAIDYIVSLSSNVFIPSHGGNMGRLMQGHRAYVGHWKCIKPNKRSMIPFLEKSSLSDAEF  529

Query  497  NRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSNT  384
              I   LHR S GQPE R  K  RD+  YPVP+CMC  +T
Sbjct  530  GSIARMLHRKSKGQPEPRSNKRDRDVIAYPVPECMCKHST  569



>ref|XP_008801214.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=555

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 117/162 (72%), Gaps = 6/162 (4%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V  LL+ALGAP+SAR+YWAGG PLGG++AL+PL+ EFP   NKE LA  GEL  FA K+S
Sbjct  385  VAALLRALGAPRSARVYWAGGEPLGGEQALRPLMAEFPKLMNKEMLASDGELVKFANKSS  444

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASL---  513
            ++AA+D++V+ +SDVFMPSHGGNM   +QGHRAY GHKK+I PNKR ++     A+    
Sbjct  445  VLAAVDFMVAVSSDVFMPSHGGNMARVIQGHRAYVGHKKSIRPNKRAVVELLKQAAAAPK  504

Query  512  SESDFNRI-ISYLHRDSLGQPEL--RKPGRDITKYPVPDCMC  396
            SE +   I +  +H   +GQPE   RK GRD+  +PVP+CMC
Sbjct  505  SEGELRSIMMKRVHAPQMGQPEERGRKKGRDVIAFPVPECMC  546



>ref|XP_009150394.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=575

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP +A IY AGG P GG  A++PL KEF +   KE LA  GEL  +A +
Sbjct  405  YEIARLLKALGAPSNASIYVAGGEPFGGSRAMEPLAKEFANLVTKETLARKGELLPYANR  464

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N S+S
Sbjct  465  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENPSVS  524

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+ +R+   LH  S G PE R  +  RD+  YPVP+CMC
Sbjct  525  ESELSRVARKLHGKSQGHPESRRGRRDRDVLAYPVPECMC  564



>ref|XP_002866552.1| hypothetical protein ARALYDRAFT_332561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42811.1| hypothetical protein ARALYDRAFT_332561 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP++A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  +
Sbjct  389  YEIARLLKALGAPRNASIYIAGGEPFGGSRALEPLSKEFSNLVTKETLAHKGELLPYTNR  448

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+S
Sbjct  449  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENSSVS  508

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            +++ + +   LHR S G PE R  +  RD+  YPVP+CMC
Sbjct  509  DAELSSVTRKLHRKSQGHPESRRGRRDRDVIAYPVPECMC  548



>emb|CDY41514.1| BnaA06g22670D [Brassica napus]
Length=557

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAP +A IY AGG P GG  A++PL KEF +   KE LA  GEL  +A ++S
Sbjct  389  IARLLKALGAPSNASIYVAGGEPFGGSRAMEPLAKEFANLVTKETLAHKGELLPYANRSS  448

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N S+SES
Sbjct  449  ALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENPSVSES  508

Query  503  DFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            + +R+   LH  S G PE R  +  RD+  YPVP+CMC
Sbjct  509  ELSRVARKLHGKSQGHPESRRGRRDRDVLAYPVPECMC  546



>ref|XP_006830094.1| hypothetical protein AMTR_s00123p00067240 [Amborella trichopoda]
 gb|ERM97510.1| hypothetical protein AMTR_s00123p00067240 [Amborella trichopoda]
Length=468

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGA +S RIYWAGG P GGK AL+PL   FP  +NK  LA   EL  F  KAS M
Sbjct  307  RLLKALGASRSTRIYWAGGHPFGGKRALEPLRSNFPIIHNKRTLATLDELRPFEGKASAM  366

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMI----PHFMNASLS  510
            AA+DYIVS +S VFM +HGGNM  ALQGHRAY GH+K ITPNKR M+     +     L 
Sbjct  367  AALDYIVSLSSTVFMANHGGNMARALQGHRAYLGHRKHITPNKRGMVATLNTNISTWGLR  426

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ++D + I+  LH +SLG P LR  K  RD+  +PVPDCMC
Sbjct  427  DADMDEILRNLHVNSLGSPLLRTDKAARDVIAFPVPDCMC  466



>ref|NP_201144.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB08804.1| auxin-independent growth promoter-like protein [Arabidopsis thaliana]
 gb|AED97742.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=559

 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -3

Query  872  LYIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAK  693
            +Y + RLLKALGAP +A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  
Sbjct  388  VYEIARLLKALGAPSNASIYIAGGEPFGGSRALEPLAKEFSNLVTKETLAHKGELLPYTN  447

Query  692  KASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASL  513
            ++S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+
Sbjct  448  RSSALAAIDYIVSLSSDVFIPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENSSV  507

Query  512  SESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            S+++ + +   LHR S G PE R  +  RD+  YPVP+CMC
Sbjct  508  SDAELSFLTRKLHRKSQGYPESRRGRRDRDVIAYPVPECMC  548



>gb|AAU44615.1| hypothetical protein AT5G63390 [Arabidopsis thaliana]
Length=559

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -3

Query  872  LYIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAK  693
            +Y + RLLKALGAP +A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  
Sbjct  388  VYEIARLLKALGAPSNASIYIAGGEPFGGSRALEPLAKEFSNLVTKETLAHKGELLPYTN  447

Query  692  KASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASL  513
            ++S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+
Sbjct  448  RSSALAAIDYIVSLSSDVFIPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENSSV  507

Query  512  SESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            S+++ + +   LHR S G PE R  +  RD+  YPVP+CMC
Sbjct  508  SDAELSFLTRKLHRKSQGYPESRRGRRDRDVIAYPVPECMC  548



>gb|KDP30946.1| hypothetical protein JCGZ_11322 [Jatropha curcas]
Length=726

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLKALGAP+SARIY AGG P GG +ALQPL  E+ +   KE L+  GEL  + KKAS
Sbjct  316  IARLLKALGAPRSARIYVAGGEPFGGSQALQPLAAEYQNLVTKEMLSKEGELAPYVKKAS  375

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             MAAIDYIVS +S+VF+PSHGGNMG  +QGHRAY GH K I PNKR MIP F + SLS++
Sbjct  376  AMAAIDYIVSLSSNVFIPSHGGNMGRLMQGHRAYVGHWKCIKPNKRAMIPFFEDNSLSDA  435

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            +F  I+  LHR S GQPE R   RD      P+ M  S
Sbjct  436  EFGSIVRMLHRKSRGQPEPRSNKRDRDVIAHPEVMALS  473



>ref|XP_006281766.1| hypothetical protein CARUB_v10027930mg [Capsella rubella]
 gb|EOA14664.1| hypothetical protein CARUB_v10027930mg [Capsella rubella]
Length=559

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP++A IY AGG P GG  AL+PL KEF +   KE LA   EL  +  +
Sbjct  389  YEIARLLKALGAPRNASIYIAGGEPFGGSRALEPLAKEFSNLVTKETLAHKDELLPYTNR  448

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+S
Sbjct  449  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYVGHRKFIMPNKRLMLPLMENSSVS  508

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+F+ +   LH  + G PE R  +  RD+  YPVP+CMC
Sbjct  509  ESEFSLVTRKLHGKTQGYPESRRGRRDRDVIAYPVPECMC  548



>emb|CDX84405.1| BnaC03g50950D [Brassica napus]
Length=558

 Score =   179 bits (454),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP +A I+ AGG P GG  A++PL KEF +   KE LA  GEL  +  +
Sbjct  388  YEIARLLKALGAPSNASIFVAGGEPFGGSRAMEPLAKEFANLVTKETLAHKGELLPYTNR  447

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH K I PNKR M+P   N S+S
Sbjct  448  SSALAAIDYIVSLSSDVFVPSHGGNMAKAMQGNRAYVGHMKFIMPNKRAMLPLMENPSVS  507

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+ +R+   LH  S G PE R  +  RD+  YPVP+CMC
Sbjct  508  ESELSRVARKLHGKSQGHPESRRGRRDRDVLAYPVPECMC  547



>gb|KFK28051.1| hypothetical protein AALP_AA8G465200 [Arabis alpina]
Length=434

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP +A IY AGG P GG  AL+PL K FP+   KE LA  GEL  +  +
Sbjct  263  YEIARLLKALGAPSNASIYIAGGEPFGGSRALEPLTKVFPNLVTKETLAHKGELLPYTNR  322

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+S
Sbjct  323  SSALAAIDYIVSLSSDVFIPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENSSVS  382

Query  509  ESDFNRIISYLHRDSLGQPE--LRKPGRDITKYPVPDCMC  396
            ES+ + +   LHR + G PE    +  RD+  YPVP+CMC
Sbjct  383  ESELSILTRKLHRKTQGHPESRRGRRDRDVVAYPVPECMC  422



>ref|XP_010444223.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=559

 Score =   175 bits (444),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP++A IY AGG P GG  AL+PL KEF +   KE LA  GEL  +  +
Sbjct  391  YEIARLLKALGAPRNASIYIAGGEPFGGSRALEPLAKEFSNLVTKETLAHKGELLPYTNR  450

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AAIDYIVS +SDVF+PSHGGNM  A+QG+RAYAGH+K I PNKR M+P   N+S+S
Sbjct  451  SSALAAIDYIVSLSSDVFLPSHGGNMAKAMQGNRAYAGHRKFIMPNKRAMLPLMENSSVS  510

Query  509  ESDFNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMC  396
            ES+F+ +I  LHR S G PE R  +  RD+  YPVP+CMC
Sbjct  511  ESEFSFVIRKLHRKSQGHPESRRGRRDRDVIAYPVPECMC  550



>gb|KDO52594.1| hypothetical protein CISIN_1g048096mg, partial [Citrus sinensis]
Length=530

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + R LKALGAP SARIY AGG P GG +ALQPL  EFP+   KE LA  GEL  +  ++S
Sbjct  401  IARFLKALGAPSSARIYIAGGEPFGGHQALQPLAAEFPNLVTKEMLAQEGELSPYVNRSS  460

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
             +AAIDYIVS NS+VF+PSHGGNMG A+QGHRAY GH+K I PNK+ M+P F ++S+S+ 
Sbjct  461  SLAAIDYIVSLNSNVFVPSHGGNMGRAMQGHRAYVGHRKYIKPNKKAMLPFFEDSSISDE  520

Query  503  DFNRIISYLH  474
            +F  II  +H
Sbjct  521  EFGSIIRKIH  530



>gb|KDO83493.1| hypothetical protein CISIN_1g008992mg [Citrus sinensis]
Length=483

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FA KAS
Sbjct  382  VTRLLKALGAPKIARIYWAGGEPLGGKEALLPLITEFPHLYNKEDLALPGELEPFANKAS  441

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQ  597
            +MAAIDYIVSENSD+FMPSHGGNMGHA+Q
Sbjct  442  LMAAIDYIVSENSDIFMPSHGGNMGHAIQ  470



>ref|XP_006439058.1| hypothetical protein CICLE_v10031320mg [Citrus clementina]
 gb|ESR52298.1| hypothetical protein CICLE_v10031320mg [Citrus clementina]
Length=498

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI EFPH YNKEDLALPGELE FA KAS
Sbjct  397  VTRLLKALGAPKIARIYWAGGEPLGGKEALLPLITEFPHLYNKEDLALPGELEPFANKAS  456

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQ  597
            +MAAIDYIVSENSD+FMPSHGGNMGHA+Q
Sbjct  457  LMAAIDYIVSENSDIFMPSHGGNMGHAIQ  485



>ref|XP_006394283.1| hypothetical protein EUTSA_v10005492mg [Eutrema salsugineum]
 gb|ESQ31569.1| hypothetical protein EUTSA_v10005492mg [Eutrema salsugineum]
Length=558

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -3

Query  869  YIVFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKK  690
            Y + RLLKALGAP +A IY AGG P GG  A++PL+K+FP+   KE LA  GEL  F  +
Sbjct  388  YEIARLLKALGAPNNASIYIAGGEPFGGSRAIEPLVKKFPNLVTKETLAHKGELLPFTNR  447

Query  689  ASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLS  510
            +S +AA+DYIVS +SDVF+PSHGGNM  A+QG+RAY GH+K I PNKR M+P   N+S+S
Sbjct  448  SSALAALDYIVSLSSDVFLPSHGGNMAKAMQGNRAYVGHRKFIMPNKRAMLPLMENSSVS  507

Query  509  ESDFNRIISYLHRDSLGQPE--LRKPGRDITKYPVPDCMC  396
            ES+ + +   LHR S G PE    +  RD+  YPVP+CMC
Sbjct  508  ESELSSVTRKLHRKSQGHPESRRGRRDRDVVAYPVPECMC  547



>gb|KEH33185.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=488

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            V RLLKALGAPK ARIYWAGG PLGGKEAL PLI+EFP+FYNKEDLALPGEL+ F +KAS
Sbjct  399  VMRLLKALGAPKDARIYWAGGKPLGGKEALLPLIQEFPNFYNKEDLALPGELQPFVRKAS  458

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQ  597
            +MAAIDYIVSE SDVFMPSHGGNMG A+Q
Sbjct  459  LMAAIDYIVSEKSDVFMPSHGGNMGRAIQ  487



>ref|XP_009410054.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLK LGAP++ RIYWAGG P GG +ALQPL  ++P+ +NK DLA P EL+    K S
Sbjct  340  ISRLLKGLGAPRNIRIYWAGGEPFGGVKALQPLESQYPNLFNKWDLANPQELDGIKDKPS  399

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            IMAA+DYIV   S VF+ SHGGNM  +LQGHR + G  K I P K+ ++  F++ SL+++
Sbjct  400  IMAALDYIVCLRSRVFLASHGGNMARSLQGHRTFIGSGKNIKPKKKLLVQLFLDGSLTDA  459

Query  503  DFNRIISYLHRDSLGQPELRKPGR--DITKYPVPDCMCN  393
            +    I ++HR+S     + K     D+  +P P CMC+
Sbjct  460  EMRNRIQHIHRESTDLSSIMKNQSKIDVIAFPTPYCMCS  498



>ref|XP_010244145.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=538

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 105/163 (64%), Gaps = 6/163 (4%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALP-GELE--AFAK  693
            V RLLKALGA    RIY AGG  LGG +AL+PL  +FPH YNK  LA   GEL+      
Sbjct  364  VTRLLKALGASNGTRIYMAGGEALGGDKALEPLRSQFPHLYNKWVLAAAEGELDLVKLKH  423

Query  692  KASIMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASL  513
            + S++AAIDY+V  NS VFM +HGGNM  ALQGHRAY GH K ITPNK++++   MN +L
Sbjct  424  RPSVLAAIDYVVCLNSQVFMANHGGNMARALQGHRAYLGHMKHITPNKKKLVQLLMNKNL  483

Query  512  SESDFNRIISYLHRDSL-GQPE--LRKPGRDITKYPVPDCMCN  393
            +E++    I  +H  SL G P    +  GRD+  YP+  CMC 
Sbjct  484  TETEMVERIKEIHVLSLWGSPSAGTKTSGRDVIAYPISHCMCT  526



>ref|XP_010913446.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=511

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLK LGA +  RIYWAGG P GG++AL+PL  +FP+ +NK  LA PGEL+   +K S+M
Sbjct  344  RLLKGLGALRKTRIYWAGGEPFGGQDALKPLQSQFPNLFNKWSLARPGELDGIKRKPSVM  403

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDF  498
            AA+DY V   S  FM SHGGNM  +LQG R Y GH K I PNK+ ++  FM   LS+ + 
Sbjct  404  AALDYAVCLESQFFMASHGGNMARSLQGQRTYMGHGKHIRPNKKLLVKLFMEKGLSDDEM  463

Query  497  NRIISYLHRDSL-GQPELR-KPGRDITKYPVPDCMCN  393
             + I  +H  SL G   LR     D+  +P+P CMC+
Sbjct  464  EKRIKQMHTVSLDGASFLRNNTSIDVIGFPIPYCMCS  500



>emb|CDY67173.1| BnaUnng01980D [Brassica napus]
Length=106

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = -3

Query  680  MAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESD  501
            MAAIDYIV + SDVFM SHGGNMG A++GH AY GHKK ITPNKRQM+P+F+N +++E++
Sbjct  1    MAAIDYIVCKESDVFMASHGGNMGCAIKGHSAYEGHKKLITPNKRQMLPYFLNKTMTETE  60

Query  500  FNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
              +++  LH+ SLGQPE+R  K GRD+TKYPVP+CMC  N
Sbjct  61   SEKMMKKLHKQSLGQPEIRVSKAGRDLTKYPVPECMCIYN  100



>ref|XP_008798041.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=539

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 101/162 (62%), Gaps = 2/162 (1%)
 Frame = -3

Query  863  VFRLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKAS  684
            + RLLK LG  +  +IYWAGG P GG++ALQPL  +FP+ +NK  LA PGEL+   +K S
Sbjct  370  ISRLLKGLGVSRKTKIYWAGGEPFGGQKALQPLQSQFPNLFNKWSLAGPGELDGIKRKPS  429

Query  683  IMAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES  504
            +MAA+DY V   S  FM SHGGNM  +L+GHR Y G  K I PNK+ +   FM+ +LS+ 
Sbjct  430  VMAALDYAVCLESQFFMASHGGNMARSLRGHRTYMGQGKHIRPNKKLLAKLFMDKTLSDD  489

Query  503  DFNRIISYLHRDSLGQPELRK--PGRDITKYPVPDCMCNSNT  384
            +  R +  +H  SL    + +     D+  +P+P CMC+  T
Sbjct  490  EMERKVKQIHTVSLDVASVLRNNTNVDVIGFPIPYCMCSRET  531



>emb|CDX84250.1| BnaC04g10120D [Brassica napus]
Length=106

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -3

Query  680  MAAIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESD  501
            MAAIDYIV + SDVFM SHGGNMG A+QGHRAY GHKK ITPNKRQM+P+F+N +++E++
Sbjct  1    MAAIDYIVCKESDVFMASHGGNMGCAIQGHRAYEGHKKLITPNKRQMLPYFLNKTMTETE  60

Query  500  FNRIISYLHRDSLGQPELR--KPGRDITKYPVPDCMCNSN  387
              +++   H  SLGQ E+R  K GRD+TKYPVP+CMC +N
Sbjct  61   SEKMMKKFHSQSLGQREIRASKAGRDVTKYPVPECMCINN  100



>dbj|BAD94259.1| axi 1 protein-like protein [Arabidopsis thaliana]
Length=88

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = -3

Query  617  NMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFNRIISYLHRDSLGQPELR--  444
            N+GHALQG RAYAGHKK ITPNKRQM+P+FMN+SL ESDFNRI+  LHR+SLGQPELR  
Sbjct  1    NLGHALQGQRAYAGHKKYITPNKRQMLPYFMNSSLPESDFNRIVKDLHRESLGQPELRMS  60

Query  443  KPGRDITKYPVPDCMCN  393
            K G+D+TK+PVP+CMC+
Sbjct  61   KAGKDVTKHPVPECMCS  77



>ref|XP_002974087.1| hypothetical protein SELMODRAFT_442298 [Selaginella moellendorffii]
 gb|EFJ25042.1| hypothetical protein SELMODRAFT_442298 [Selaginella moellendorffii]
Length=571

 Score =   129 bits (325),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 100/173 (58%), Gaps = 16/173 (9%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P + RIY A G   GG E +Q L   FP+   KE +A P  L  F++ AS MA
Sbjct  375  FLQALGYPSATRIYVAAGEIYGGNERMQELQARFPNLMRKETVATPAALAQFSRHASQMA  434

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKR---QMIPHFMNASLSES  504
            A+DYI+S  +DVF+PS+ GNM  A++GHR Y GH+KTI P+++    +I    +  L +S
Sbjct  435  ALDYIMSVEADVFVPSYSGNMARAVEGHRRYLGHRKTIIPDRKALVDLIGKTESGVLEDS  494

Query  503  DFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSNT  384
            + ++ I  +H+   G P  RK       G+D  +        P+PDC+CN N+
Sbjct  495  ELSKRIIDIHKRRQGAPRKRKGPVVGSKGKDRFRTEEAFYTNPLPDCLCNKNS  547



>ref|XP_011097053.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Sesamum 
indicum]
Length=500

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 99/174 (57%), Gaps = 16/174 (9%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P+S  IY A G   GG+  L  L   FP+   KE LA   EL  F+  AS  A
Sbjct  325  FLQALGFPRSTLIYIAAGEIYGGERRLLELTSRFPNIVFKEMLATQEELRTFSNHASQTA  384

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF--MNASLSE-S  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++     + A L E S
Sbjct  385  ALDYIISVESDVFIPSHSGNMARAVEGHRRFLGHQKTITPDRKGLVELLDKLEAGLLEVS  444

Query  503  DFNRIISYLHRDSLGQPELRKP------GRDITKY-------PVPDCMCNSNTG  381
             F+ +++ LH++  G P  R        GR  ++        P P+C+C S TG
Sbjct  445  SFSSLVNQLHKNRFGAPRKRGAAPLGIKGRARSRLEESFYQNPYPECICKSETG  498



>ref|XP_011097054.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Sesamum 
indicum]
Length=499

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 99/174 (57%), Gaps = 16/174 (9%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P+S  IY A G   GG+  L  L   FP+   KE LA   EL  F+  AS  A
Sbjct  324  FLQALGFPRSTLIYIAAGEIYGGERRLLELTSRFPNIVFKEMLATQEELRTFSNHASQTA  383

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF--MNASLSE-S  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++     + A L E S
Sbjct  384  ALDYIISVESDVFIPSHSGNMARAVEGHRRFLGHQKTITPDRKGLVELLDKLEAGLLEVS  443

Query  503  DFNRIISYLHRDSLGQPELRKP------GRDITKY-------PVPDCMCNSNTG  381
             F+ +++ LH++  G P  R        GR  ++        P P+C+C S TG
Sbjct  444  SFSSLVNQLHKNRFGAPRKRGAAPLGIKGRARSRLEESFYQNPYPECICKSETG  497



>ref|XP_002517241.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45141.1| conserved hypothetical protein [Ricinus communis]
Length=411

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 98/175 (56%), Gaps = 17/175 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG   S  IY A G   GG+  L  L+  FP+   KE LA P EL+AFAK AS  A
Sbjct  235  FLQALGYSPSMIIYIAAGEIYGGESHLLELMARFPNTVFKETLATPEELKAFAKHASQTA  294

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH+KTITP +R ++  F    +  + E 
Sbjct  295  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRKTITPERRGLVKLFDKLESGQMKEG  354

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNSNTG  381
              F+ I+  +H++  G P  RK   PG              + P P+C+C S  G
Sbjct  355  PTFSNIVQEMHKNRQGAPRKRKGPLPGIKGRARLRTEESFYENPYPECICRSKKG  409



>ref|XP_001765585.1| predicted protein [Physcomitrella patens]
 gb|EDQ69635.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 97/173 (56%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKALG P++  IY A G   GG E ++ L+  FP+   KE +A P EL  F   +S +A
Sbjct  264  FLKALGYPETTPIYIAAGEIYGGDERMKSLLSRFPNVLRKETVATPEELAPFVNHSSQLA  323

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYIVS  S+VF+PS+ GNM  A++GHR Y GH+KTITP++++++  F      E    
Sbjct  324  ALDYIVSVESNVFVPSYSGNMARAVEGHRRYLGHRKTITPDRKELVALFDKLDRGELTEG  383

Query  506  SDFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSN  387
             +    I+ +H+   G P  RK       GRD  +        P+PDC+C+  
Sbjct  384  PELAETIANIHKRRQGAPRKRKGPITGTKGRDRFRTEEAFYTNPLPDCLCSET  436



>ref|XP_009588701.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
tomentosiformis]
Length=494

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 95/173 (55%), Gaps = 16/173 (9%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA P EL  FA  AS  A
Sbjct  318  FLQALGYPLSTLIYIAAGEIYGGNTHLSELTSRFPNVIFKEMLATPEELRGFANHASQTA  377

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  F       L   
Sbjct  378  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRKGLVEIFDKLEAGQLEGP  437

Query  503  DFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSNT  384
             F+ ++ +LH++  G P  R        GR  ++        P P+C+C+S T
Sbjct  438  SFSHLVKHLHKNRQGAPRKRAGAPPGVKGRARSRLEEPFYQNPYPECICSSKT  490



>ref|XP_001761221.1| predicted protein [Physcomitrella patens]
 gb|EDQ73943.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 101/173 (58%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK+LG P+S RIY A G   GG+E +  L+  FP+  +KE +A   EL  F   +S MA
Sbjct  256  FLKSLGYPESTRIYVAAGEIYGGRERMSGLLSRFPNVMSKEYIATASELAPFFNHSSQMA  315

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF--MNASLSESD  501
            A+DYIVS  S+VF+ S+ GNM  A++GHR + GH+KTI+P++++++  F  ++  L + D
Sbjct  316  ALDYIVSVESNVFVSSYSGNMARAVEGHRRFLGHRKTISPDRKELVALFDMLDQGLLKED  375

Query  500  FN--RIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSN  387
             N   +I+ +H +  G P  RK       GRD  +        P PDC+C  +
Sbjct  376  QNLADVITTMHENRQGAPRKRKGPLKGTKGRDRLRSEEAFYTNPTPDCLCQQS  428



>ref|XP_010444397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=391

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 96/173 (55%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LAL GEL+ F   A+  A
Sbjct  214  FLKGLGYPQSTVIYIAAGDIYGGDDRLSELKSRFPNLVFKETLALKGELKGFTGHATKTA  273

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM---NASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F       L E 
Sbjct  274  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQLREG  333

Query  503  -DFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNSN  387
               + ++  +H+D  G P  RK P + I             + P P+C+C+S 
Sbjct  334  PKLSNLVKQMHQDRQGAPRRRKGPTQGIKGRARFRNEEAFYENPYPECICSSK  386



>gb|EEC77803.1| hypothetical protein OsI_16985 [Oryza sativa Indica Group]
Length=550

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   IY A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  332  MLRALGFGKDVHIYVASGEVYGGEETLAPLKALFPNFHSKETLASKEELAPFLSFSSRMA  391

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+DYIV + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   F+N  S+S   F
Sbjct  392  ALDYIVCDKSDVFVTNNNGNMARMLAGRRRYFGHKRTIRPNAKKLYSLFLNRTSMSWETF  451

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
            +  +  L +  +G+P   KPGR +  ++P+ DC+C    G
Sbjct  452  SSKVQTLQKGFMGEPNEIKPGRGEFHEHPM-DCICAKTKG  490



>gb|EEE61496.1| hypothetical protein OsJ_15784 [Oryza sativa Japonica Group]
Length=571

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   IY A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  353  MLRALGFGKDVHIYVASGEVYGGEETLAPLKALFPNFHSKETLASKEELAPFLSFSSRMA  412

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+DYIV + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   F+N  S+S   F
Sbjct  413  ALDYIVCDKSDVFVTNNNGNMARMLAGRRRYFGHKRTIRPNAKKLYSLFLNRTSMSWETF  472

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
            +  +  L +  +G+P   KPGR +  ++P+ DC+C    G
Sbjct  473  SSKVQTLQKGFMGEPNEIKPGRGEFHEHPM-DCICAKTKG  511



>emb|CAE01922.2| OSJNBb0078D11.5 [Oryza sativa Japonica Group]
 emb|CAH67175.1| H0211B05.12 [Oryza sativa Indica Group]
Length=570

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   IY A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  352  MLRALGFGKDVHIYVASGEVYGGEETLAPLKALFPNFHSKETLASKEELAPFLSFSSRMA  411

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+DYIV + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   F+N  S+S   F
Sbjct  412  ALDYIVCDKSDVFVTNNNGNMARMLAGRRRYFGHKRTIRPNAKKLYSLFLNRTSMSWETF  471

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
            +  +  L +  +G+P   KPGR +  ++P+ DC+C    G
Sbjct  472  SSKVQTLQKGFMGEPNEIKPGRGEFHEHPM-DCICAKTKG  510



>emb|CDP04711.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 96/174 (55%), Gaps = 18/174 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA  GEL+AF+  AS  A
Sbjct  330  FLQALGYPPSTLIYIAAGEIYGGSVHLSELTSRFPNIVYKEALASKGELQAFSHHASQSA  389

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSE-  507
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  +    +  L E 
Sbjct  390  ALDYIISIESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRKGLVAIYDMLESGVLKEG  449

Query  506  -SDFNRIISYLHRDSLGQPELRK------PGRD-------ITKYPVPDCMCNSN  387
             S  + ++  LHR   G P  R+       GR          + P P+CMC SN
Sbjct  450  SSSLSHLVMKLHRSRQGAPRKREGAPSGIKGRGRFRLEEPFYQNPFPECMCGSN  503



>ref|XP_001765567.1| predicted protein [Physcomitrella patens]
 gb|EDQ69617.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 97/173 (56%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKALG P++  IY A G   GG E ++ L+  FP+   KE +A P EL  F   +S +A
Sbjct  214  FLKALGYPETTPIYIAAGEIYGGDERMKGLLSRFPNVLRKETVATPEELAPFVNHSSQLA  273

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYIVS  S+VF+PS+ GNM  A++GHR Y  H+KTITP++++++  F      E    
Sbjct  274  ALDYIVSVESNVFVPSYSGNMARAVEGHRRYLEHRKTITPDRKELVALFDKLDRGELTEG  333

Query  506  SDFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSN  387
             +   +I+ +H+   G P  RK       GRD  +        P+PDC+C+  
Sbjct  334  PELAEMIANIHKRRQGAPRKRKGPITGTKGRDRFRTEEVFYTNPLPDCLCSET  386



>ref|XP_003605029.1| hypothetical protein MTR_4g023050 [Medicago truncatula]
 gb|AES87226.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=108

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = -3

Query  608  HALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFNRIISYLHRDSLGQPELR--KPG  435
            ++ QGHRAYAGHKK ITPNKRQM P+F+N SL E++FN I+  LH++SLGQPELR  K G
Sbjct  29   YSFQGHRAYAGHKKYITPNKRQMHPYFLNPSLPEAEFNSIVKELHQNSLGQPELRTSKVG  88

Query  434  RDITKYPVPDCMCN  393
            RD+TKYPVP+CMCN
Sbjct  89   RDVTKYPVPECMCN  102



>ref|XP_010484244.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=514

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LAL GEL+ F   A+  A
Sbjct  337  FLKGLGYPQSTVIYIAAGDIYGGDDRLSELKSRFPNLVFKETLALKGELKGFTGHATKTA  396

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM---NASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F       L E 
Sbjct  397  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQLREG  456

Query  503  -DFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
               + ++  +H+D  G P  RK P + I             + P P+C+C+S
Sbjct  457  PKLSNLVKQMHQDRQGAPRRRKGPTQGIKGRARFRTEEAFYENPYPECICSS  508



>ref|XP_010680232.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=496

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 94/171 (55%), Gaps = 17/171 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             +KALG P S  IY A G   GG   L  L  +FP+  +KE LA   ELEAF+  AS  A
Sbjct  326  FIKALGYPASTLIYIAAGEIYGGAGRLSELTLQFPNVVSKETLATKAELEAFSHHASQNA  385

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM---NASLSES  504
            AIDYI+S  S+VF+PSH GNM  A++GHR +  HKKTITP+++ +I  F    +  L E 
Sbjct  386  AIDYIISVESNVFIPSHSGNMARAVEGHRRFLEHKKTITPDRQGLIEVFNKLDSGQLVEG  445

Query  503  -DFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCN  393
                 I+  +HR+  G P  R        GR   +Y       P P+C+CN
Sbjct  446  PTLTNIVKRMHRNRRGAPRKRNGPPLGIKGRARFRYEESFYQNPYPECICN  496



>emb|CDY18704.1| BnaA09g06910D [Brassica napus]
Length=511

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 96/173 (55%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LLK LG P+S  IY A G   GG + L  L   FP+   KE LA   ELE F   A+  A
Sbjct  334  LLKGLGYPESTVIYIAAGEIYGGDDRLLELKSRFPNLVFKETLAGEEELEGFTGHATKTA  393

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +    
Sbjct  394  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFDKVERGQMKEG  453

Query  506  SDFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNSN  387
            + F+ ++  +H+D  G P  RK P + I             + P P+C+C+S 
Sbjct  454  AKFSNLVKAMHQDRQGAPRRRKGPAQGIKGRARFRTEEAFYENPYPECICSSK  506



>ref|XP_010444396.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=514

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LAL GEL+ F   A+  A
Sbjct  337  FLKGLGYPQSTVIYIAAGDIYGGDDRLSELKSRFPNLVFKETLALKGELKGFTGHATKTA  396

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM---NASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F       L E 
Sbjct  397  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQLREG  456

Query  503  -DFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
               + ++  +H+D  G P  RK P + I             + P P+C+C+S
Sbjct  457  PKLSNLVKQMHQDRQGAPRRRKGPTQGIKGRARFRNEEAFYENPYPECICSS  508



>gb|KDO58328.1| hypothetical protein CISIN_1g043543mg [Citrus sinensis]
Length=381

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L+  FP+   KE LA   EL+AFA  AS  A
Sbjct  207  FLQALGYPPSTIIYIAAGEIYGGNTHLSELMYRFPNLVFKETLATKEELKAFANHASQTA  266

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP++R ++  F    +  L E 
Sbjct  267  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRRGLVELFDKLKSGKLREG  326

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
              F++ +  +H +  G P  RK   PG              + P P+C+C+S
Sbjct  327  PSFSQRVQQIHENWQGGPRKRKGPLPGIKGRARFRTEESFYENPYPECICSS  378



>ref|XP_010535322.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Tarenaya 
hassleriana]
Length=442

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 99/175 (57%), Gaps = 19/175 (11%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L ALG P S  IY A G   GG+  +  L   FP   +KE LA   E+E F K AS MA
Sbjct  260  FLAALGYPSSTPIYVAAGEIYGGESRISDLRYRFPMLMSKEKLASREEMEPFMKHASQMA  319

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKR---QMIPHFMNASLSES  504
            A+DYIVS  SDVF+PS+ GNM  A++GHR Y GH+KTI+P+++   ++I    + +L E 
Sbjct  320  ALDYIVSVESDVFIPSYSGNMARAVEGHRRYLGHRKTISPDRKGIVRLIDKMEHGALKEG  379

Query  503  D--FNRIISYLHRDSLGQPELRK------PGRD-------ITKYPVPDCMCNSNT  384
               ++RII  +H+   G P  RK       G D         + P+PDC+C+ NT
Sbjct  380  TKVYDRIIE-IHKTRQGSPRRRKGPISGTKGMDRFRSEEPFYENPLPDCLCHLNT  433



>ref|XP_006653675.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=507

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   IY A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  289  MLRALGFGKDVHIYVASGEVYGGEETLAPLKALFPNFHSKETLARKEELAPFLSFSSRMA  348

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+DY+V + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   F+N  S+S   F
Sbjct  349  ALDYVVCDKSDVFVTNNNGNMARMLAGRRRYFGHKRTIRPNAKKLYSLFLNRTSMSWETF  408

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
            +  +    +  +G+P   KPGR +  ++P+ DC+C    G
Sbjct  409  SSKVQSFQKGFMGEPNEIKPGRGEFHEHPM-DCICTKAKG  447



>ref|XP_007048355.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX92512.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=511

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 96/174 (55%), Gaps = 17/174 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G P S  IY A G   GG   L  L+  FP+   KE LA   EL+AFAK AS  A
Sbjct  332  FLQAVGYPPSTLIYVAAGEIYGGDARLSELMSRFPNLVFKEQLATEKELKAFAKHASQSA  391

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PS+ GNM  A++GHR + GH+KTITP+++ ++  F      +    
Sbjct  392  ALDYIISIESDVFVPSYSGNMARAVEGHRRFLGHRKTITPDRKGLVRLFDELEGGQHREA  451

Query  506  SDFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNSNT  384
            S F+ ++   H++  G P  RK   PG              + P P+C+C+S  
Sbjct  452  SSFSYLVRQTHKNRQGAPRKRKGPSPGIKGKARFRTEESFYENPFPECICSSKV  505



>ref|XP_007048356.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOX92513.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=510

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 96/174 (55%), Gaps = 17/174 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G P S  IY A G   GG   L  L+  FP+   KE LA   EL+AFAK AS  A
Sbjct  331  FLQAVGYPPSTLIYVAAGEIYGGDARLSELMSRFPNLVFKEQLATEKELKAFAKHASQSA  390

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PS+ GNM  A++GHR + GH+KTITP+++ ++  F      +    
Sbjct  391  ALDYIISIESDVFVPSYSGNMARAVEGHRRFLGHRKTITPDRKGLVRLFDELEGGQHREA  450

Query  506  SDFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNSNT  384
            S F+ ++   H++  G P  RK   PG              + P P+C+C+S  
Sbjct  451  SSFSYLVRQTHKNRQGAPRKRKGPSPGIKGKARFRTEESFYENPFPECICSSKV  504



>ref|XP_010484245.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=512

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LAL GEL+ F   A+  A
Sbjct  337  FLKGLGYPQSTVIYIAAGDIYGGDDRLSELKSRFPNLVFKETLALKGELKGFTGHATKTA  396

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM---NASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F       L E 
Sbjct  397  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQLREG  456

Query  503  -DFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
               + ++  +H+D  G P  +K P + I             + P P+C+C+S
Sbjct  457  PKLSNLVKQMHQDRQGAPRRKKGPTQGIKGRARFRTEEAFYENPYPECICSS  508



>ref|XP_009112144.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=508

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 95/173 (55%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LA   ELE F   A+  A
Sbjct  331  FLKGLGYPESTVIYIAAGEIYGGDDRLLELKSRFPNLVFKETLAGEEELEGFTGHATKTA  390

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +    
Sbjct  391  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFDKVERGQMKEG  450

Query  506  SDFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNSN  387
            + F+ ++  +H+D  G P  RK P + I             + P P+C+C+S 
Sbjct  451  AKFSNLVKAMHQDRQGAPRRRKGPAQGIKGRARFRTEEAFYENPYPECICSSK  503



>ref|XP_010535312.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=567

 Score =   120 bits (302),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 99/175 (57%), Gaps = 19/175 (11%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L ALG P S  IY A G   GG+  +  L   FP   +KE LA   E+E F K AS MA
Sbjct  385  FLAALGYPSSTPIYVAAGEIYGGESRISDLRYRFPMLMSKEKLASREEMEPFMKHASQMA  444

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKR---QMIPHFMNASLSES  504
            A+DYIVS  SDVF+PS+ GNM  A++GHR Y GH+KTI+P+++   ++I    + +L E 
Sbjct  445  ALDYIVSVESDVFIPSYSGNMARAVEGHRRYLGHRKTISPDRKGIVRLIDKMEHGALKEG  504

Query  503  D--FNRIISYLHRDSLGQPELRK------PGRD-------ITKYPVPDCMCNSNT  384
               ++RII  +H+   G P  RK       G D         + P+PDC+C+ NT
Sbjct  505  TKVYDRIIE-IHKTRQGSPRRRKGPISGTKGMDRFRSEEPFYENPLPDCLCHLNT  558



>ref|XP_002985325.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
 gb|EFJ13819.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
Length=462

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 88/155 (57%), Gaps = 2/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      +Y A G   GG+  L PL   FPHF+ KE LA   E+E F++ +S MA
Sbjct  276  MLRALGFSNETYLYVASGDIYGGESTLAPLRALFPHFFTKESLASDKEMEQFSRYSSRMA  335

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF-MNASLSESDF  498
            AIDYIV   SDVF+ ++ GNM   L GHR YAGHK+TI PN +++   F +   +    F
Sbjct  336  AIDYIVCNQSDVFVTNNNGNMARILAGHRRYAGHKRTIRPNAKKLGSFFGLRQEMGWEQF  395

Query  497  NRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
               +  L +  +G P  R   RDI + P   C+C+
Sbjct  396  AAKLRSLQKGFMGDPMERSSRRDIFENPRV-CICD  429



>emb|CDX81230.1| BnaC09g06410D [Brassica napus]
Length=509

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 95/173 (55%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LA   ELE F   A+  A
Sbjct  332  FLKGLGYPESTVIYIAAGEIYGGDDRLLDLKSRFPNLVFKETLAGEEELEGFTGHATKTA  391

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +    
Sbjct  392  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFDKVERGQMKEG  451

Query  506  SDFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNSN  387
            + F+ ++  +H+D  G P  RK P + I             + P P+C+C+S 
Sbjct  452  AKFSNLVKAMHQDRQGAPRRRKGPAQGIKGRARFRTEEAFYENPYPECICSSK  504



>ref|XP_006351036.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=497

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 96/173 (55%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA P EL  FA  AS  A
Sbjct  322  FLQALGYPPSTLIYIAAGEIYGGNTRLSELKSYFPNVVFKEMLATP-ELREFANHASQAA  380

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  F       L  S
Sbjct  381  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRKGLVEIFDQLEAGQLDGS  440

Query  503  DFNRIISYLHRDSLGQPELRK------PGRDITKY-------PVPDCMCNSNT  384
             F+ ++ +LH++  G P  R        GR  ++        P P+C+C+S T
Sbjct  441  SFSHLVRHLHKNRQGAPRKRAGAPSGVRGRARSRLEESFYQNPYPECICSSRT  493



>ref|XP_006664407.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=443

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 95/170 (56%), Gaps = 17/170 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G PKS  IY A G   GG + +  L   FP+  +KE LA   EL+ F   AS +A
Sbjct  269  FLRAMGYPKSTWIYLAAGEIYGGDKYVSKLRSYFPNLVSKEVLATKEELDKFNNHASQVA  328

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYIVS  SDVF+PSH GNM  A++GHR + GH+KT+TP++R ++  F       L E 
Sbjct  329  ALDYIVSVESDVFVPSHSGNMARAVEGHRRFLGHRKTVTPDRRGLVELFDLLQKGELMEG  388

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMC  396
              F+ +++ +H++  G P  R    PG              + P P+C+C
Sbjct  389  PKFSSLVTEMHKNRQGSPRKRNGSLPGSKGRARLRTEESFYENPFPECIC  438



>ref|XP_006432248.1| hypothetical protein CICLE_v10000858mg [Citrus clementina]
 ref|XP_006464639.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
 gb|ESR45488.1| hypothetical protein CICLE_v10000858mg [Citrus clementina]
Length=522

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L+  FP+   KE LA   EL+AFA  AS  A
Sbjct  348  FLQALGYPPSTIIYIAAGEIYGGNAHLSELMYRFPNLVFKETLATKEELKAFANHASQTA  407

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP++R ++  F    +  L E 
Sbjct  408  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRRGLVELFDKLKSGKLREG  467

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
              F++ +  +H +  G P  RK   PG              + P P+C+C+S
Sbjct  468  PSFSQRVQQIHENWQGGPRKRKGPLPGIKGRARFRTEESFYENPYPECICSS  519



>ref|XP_010462011.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=515

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 95/172 (55%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG + L  L   FP+   KE LAL GEL+ F   A+  A
Sbjct  338  FLKGLGYPQSTVIYIAAGDIYGGDDRLSELKSRFPNLVFKETLALKGELKGFTGHATKTA  397

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSES---  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +S   
Sbjct  398  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQSREG  457

Query  503  -DFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
               + ++  + +D  G P  RK P + I             + P P+C+C+S
Sbjct  458  PKLSNLVKQMLQDRQGAPRRRKGPTQGIKGRARFRTEEAFYENPYPECICSS  509



>ref|XP_002970137.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
 gb|EFJ29261.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
Length=482

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 88/155 (57%), Gaps = 2/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      +Y A G   GG+  L PL   FPHF+ KE LA   E+E F++ +S MA
Sbjct  296  MLRALGFSNETYLYVASGDIYGGESTLAPLRALFPHFFTKESLASDKEMEQFSRYSSRMA  355

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF-MNASLSESDF  498
            AIDYIV   SDVF+ ++ GNM   L GHR YAGHK+TI PN +++   F +   +    F
Sbjct  356  AIDYIVCNQSDVFVTNNNGNMARILAGHRRYAGHKRTIRPNAKKLGSFFGLRQEMGWEQF  415

Query  497  NRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
               +  L +  +G P  R   RDI + P   C+C+
Sbjct  416  AAKLRSLQKGFMGDPMERSSRRDIFENPRV-CICD  449



>ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=560

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 93/160 (58%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  I+ A GI    ++ + PL++ FP+ + KE LA   EL  F   +S MA
Sbjct  391  MLRGMGFTKNTSIFLASGIIYNAEKTMAPLLQMFPNLHTKETLASEEELAPFKNYSSRMA  450

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N ++    
Sbjct  451  AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKS  510

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   I  +P PDCMC +N
Sbjct  511  FKRQLMSMRSHSDSKGV-ELKRPNDSIYSFPCPDCMCRAN  549



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   + R+Y A     GG+  +  L K FP   +K+ L  P E    A KAS+ A
Sbjct  361  LLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSA  420

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS +SDVF+ +  GNM +AL GHRAY  + KTI PN   + P F+N S+  S+F 
Sbjct  421  AVDYYVSLHSDVFISASPGNMHNALLGHRAYL-NMKTIRPNMVLLGPLFLNKSMEWSEFK  479

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMC  396
            + +   HR+  GQ  LRK  + I  YP PDCMC
Sbjct  480  KAVLTGHRNRQGQIRLRKETQSIYTYPAPDCMC  512



>ref|XP_003613050.1| DUF246 domain-containing protein [Medicago truncatula]
Length=282

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 86/154 (56%), Gaps = 1/154 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG   +  L + FP   +K+ L LP E      KAS++A
Sbjct  129  LLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLA  188

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY +S +SD+F+ +  GNM +AL GHR Y  + KTI PN   M   F+N ++  S+F 
Sbjct  189  ALDYYISIHSDIFISASPGNMHNALVGHRTYL-NLKTIRPNMALMGQLFLNKTMEWSEFE  247

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
              +   H    GQ  LRKP + I  YPVPDCMC 
Sbjct  248  HAVVEGHESRQGQLRLRKPKQSIYTYPVPDCMCQ  281



>gb|KDP39880.1| hypothetical protein JCGZ_03411 [Jatropha curcas]
Length=549

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      IY A G   GG+E L+PL + FP+FY KE LA   EL+ F   +S +A
Sbjct  366  MLRALGFANDTYIYVASGEIYGGEETLRPLRELFPNFYTKEMLA-NEELKPFLPFSSRLA  424

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESD-F  498
            AIDYIV + SDVF+ ++ GNM   L G R YAGHK+TI PN +++   FM  + ++ D F
Sbjct  425  AIDYIVCDESDVFVTNNNGNMAKILAGRRRYAGHKRTIRPNAKKLSGLFMQRNETDWDTF  484

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMC  396
             + +    R+ +G+P   KPGR +  +YP P C+C
Sbjct  485  AKRVKACQREFMGEPNEGKPGRGEFHEYPSP-CIC  518



>ref|XP_004953410.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=577

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  +   +Y A G   GG+E L PL   FP+FY+KE LA   ELE F   +S MA
Sbjct  353  MLRALGFGRDVHMYVASGDVYGGEETLAPLKALFPNFYSKETLASKQELEPFLPFSSRMA  412

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+D++V + S+VF+ ++ GNM   L G R Y GH++TI PN R++   F+N  S+S   F
Sbjct  413  ALDFVVCDQSNVFVTNNNGNMARMLTGRRRYFGHRRTIRPNTRKLNSLFLNRTSMSWDTF  472

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
               +    +  +G+P   +PGR    +YP+ DC+C    G
Sbjct  473  AFKVQTFQKGFMGEPNEVEPGRGGFYEYPL-DCICQKTKG  511



>ref|XP_010553257.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=659

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 93/163 (57%), Gaps = 10/163 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKA+G P S  IY   G  + G+ ++     E+P+ ++   LA   ELE F    + +A
Sbjct  473  FLKAMGYPSSTTIYIVAG-EIYGRNSMDAFRAEYPNVFSHSTLATEEELEPFRPYQNRLA  531

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKR---QMIPHFMNASLSES  504
            A+DYIV+  SDVF+ ++ GNM  A+QGHR + G +KTI P++    ++I HF    +S  
Sbjct  532  ALDYIVALESDVFVYTYDGNMAKAVQGHRRFEGFRKTINPDRLNFVRLIDHFDEGVMSWE  591

Query  503  DFNRIISYLHRDSLGQPELRKPG------RDITKYPVPDCMCN  393
            DF+  +  LHRD +G P LR+PG       +    P PDC+CN
Sbjct  592  DFSSEVKRLHRDRIGAPYLRRPGEFPRLEENFYANPQPDCICN  634



>ref|XP_004249900.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=493

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 94/171 (55%), Gaps = 17/171 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA P EL  FA  AS  A
Sbjct  322  FLQALGYPPSTFIYIAAGEIYGGNTRLSELKSYFPNVVFKEMLATP-ELREFANHASQAA  380

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  F       L  S
Sbjct  381  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHRKTITPDRKGLVEIFDQLEAGQLDGS  440

Query  503  DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
             F+ ++ +LH++  G P  R    PG              + P P+C+C+S
Sbjct  441  SFSHLVRHLHKNRQGAPRKRAGAPPGVRGRARSRLEESFYQNPYPECICSS  491



>ref|XP_009789435.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=476

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA P EL  FA  AS  A
Sbjct  318  FLQALGYPPSTLIYIAAGEIYGGNTHLSELTSHFPNVIFKEMLATPEELRGFANHASQTA  377

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  F N     L   
Sbjct  378  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHQKTITPDRKGLVEIFDNLEAGQLEGP  437

Query  503  DFNRIISYLHRDSLGQPELR  444
             F+ ++ +LH++  G P  R
Sbjct  438  SFSHLVKHLHKNRQGAPRKR  457



>ref|XP_010550724.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  857  RLLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIM  678
            RLLKALGAP SA IY AGG P GG  AL+PL++EFP+   KE LA  GEL +++ K+S +
Sbjct  398  RLLKALGAPSSAEIYIAGGEPFGGSRALEPLVEEFPNLVTKETLAHKGELSSYSNKSSAL  457

Query  677  AAIDYIVSENSDVFMPSHGGNMGHALQG  594
            AAIDYIVS +SDVF+PSHGGNM  A+QG
Sbjct  458  AAIDYIVSLSSDVFVPSHGGNMARAMQG  485



>ref|XP_009789434.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=486

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA P EL  FA  AS  A
Sbjct  328  FLQALGYPPSTLIYIAAGEIYGGNTHLSELTSHFPNVIFKEMLATPEELRGFANHASQTA  387

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DY++S  SDVF+PSH GNM  A++GHR + GH+KTITP+++ ++  F N     L   
Sbjct  388  ALDYLISVESDVFIPSHSGNMARAVEGHRRFLGHQKTITPDRKGLVEIFDNLEAGQLEGP  447

Query  503  DFNRIISYLHRDSLGQPELR  444
             F+ ++ +LH++  G P  R
Sbjct  448  SFSHLVKHLHKNRQGAPRKR  467



>ref|XP_008389203.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=228

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  IY A G     ++++ PL++ FP+   KE LA   EL  F   +S MA
Sbjct  59   MLRGMGFEKNTFIYLASGKIYNAEKSMAPLLEMFPNLQTKEMLASEEELAPFKNYSSRMA  118

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N  +    
Sbjct  119  AIDYTVCLHSEVFVTTQGGNFPHFLIGHRRYMYGGHSKTIRPDKRKLALLFDNPQIGWKT  178

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  E+++P   I  +P PDCMC SN
Sbjct  179  FKRHLLGMRSHSDSKGY-EIKRPNDSIYTFPCPDCMCRSN  217



>gb|KEH30846.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=561

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  I+ A GI    ++ + PL++ FP+ + KE LA   EL  F   +S MA
Sbjct  392  MLRGMGFTKNTSIFLASGIIYNAEKTMAPLLQMFPNLHTKETLASEEELSTFRNYSSRMA  451

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N ++    
Sbjct  452  AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWRS  511

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   I  +P P+CMC +N
Sbjct  512  FKRQLLNMRSHSDSKGV-ELKRPNDSIYSFPCPECMCRAN  550



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L + FP   +K+ LA   EL     KAS++A
Sbjct  363  LLTALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHELSEVEGKASLLA  422

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL GHRAY  + KTI PN   +   F+N ++  S+F 
Sbjct  423  ALDYYVSMQSDIFISASPGNMHNALLGHRAYK-NLKTIRPNMTLLGKLFLNKTMEWSEFQ  481

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            R I   H++  GQ  LRK  + I  YP PDCMC +
Sbjct  482  RAIQQGHKNRQGQMRLRKEKQSIYTYPAPDCMCKT  516



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 89/154 (58%), Gaps = 1/154 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L + FP   +K+ LA   EL     KAS++A
Sbjct  359  LLAALGFSNSTRLYLASHKVYGGEARVSTLKQLFPSMEDKKSLASAEELALVEGKASLLA  418

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL GHRAY  + KTI PN   + P F+N S+  S+F 
Sbjct  419  AVDYYVSLQSDIFISASPGNMHNALVGHRAYL-NLKTIRPNMVLLGPLFLNKSVEWSEFQ  477

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
              +   H++  GQ  LRK  + I  YP+PDCMC 
Sbjct  478  TAVVKGHKNRQGQIRLRKEKQSIYTYPIPDCMCQ  511



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   + R+Y A     GG+  +  L K FP   NK+ LA   EL     KAS+MA
Sbjct  277  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  336

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +ALQ HRAY  + KTI PN   +   F+N SL  S+F 
Sbjct  337  AVDYYVSMKSDIFISASPGNMHNALQAHRAYL-NLKTIRPNMILLGQVFVNKSLDWSEFE  395

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMC  396
              +   H++  GQ  LRK  + I  YP PDCMC
Sbjct  396  GAVMNGHKNRQGQLRLRKQKQSIYTYPAPDCMC  428



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L K FP   +K+ LA   EL     KAS++A
Sbjct  387  LLAALGFNNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASVKELAEIEGKASLLA  446

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL GHRAY  + KTI PN   + P F+N S+  S+F 
Sbjct  447  AVDYYVSLQSDIFISASPGNMHNALVGHRAYL-NLKTIRPNMLLLGPLFLNKSMEWSEFQ  505

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
              +   H++  GQ  LRK  + I  YP PDCMC +
Sbjct  506  HAVINRHKNRQGQIRLRKEEQSIYTYPAPDCMCRA  540



>dbj|BAK00215.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 94/173 (54%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L ALG P S  +Y A G   GG+  +  L   FP   NKE LA   EL  F++ AS MA
Sbjct  265  FLSALGYPSSTPVYIAAGEIYGGESHMVDLQSRFPILMNKEKLASAEELRPFSQYASQMA  324

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNAS---LSES  504
            A+DYIVS  SDVF+PSH GNM  A+ GHR + GH+KTI+P+++ ++  F       L E 
Sbjct  325  ALDYIVSVESDVFIPSHSGNMARAVAGHRRFHGHRKTISPDRKALVHLFDKVDSGLLDEG  384

Query  503  D-FNRIISYLHRDSLGQPELRK------PGRD-------ITKYPVPDCMCNSN  387
            +  ++ I  +H+   G P  RK       G D         + P+PDC+C SN
Sbjct  385  ERLSQKIIEMHQKRQGSPRKRKGPVSGTRGSDRFRSEEAFYENPLPDCLCQSN  437



>gb|KHG05427.1| hypothetical protein F383_01689 [Gossypium arboreum]
Length=542

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      IY A G   GG+E L+PL   FP+FY KE LA   EL+ F   +S +A
Sbjct  351  MLRALGFANDTYIYVASGEIYGGEETLRPLRDLFPNFYTKERLA-NEELKPFLPFSSRLA  409

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESD-F  498
            AIDYIV + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   FM     + D F
Sbjct  410  AIDYIVCDESDVFVTNNNGNMARILAGRRRYMGHKRTIRPNAKRLSSLFMERDKMDWDTF  469

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSN  387
             R +  + R  +G+P+  +PGR +  +YP   C+C  N
Sbjct  470  ARKVKAVQRGYMGEPDEMRPGRGEFHEYPY-SCICKKN  506



>ref|XP_010039975.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Eucalyptus 
grandis]
Length=304

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 92/170 (54%), Gaps = 17/170 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA+  ELE F  +AS  A
Sbjct  126  FLRALGYPSSTLIYIAAGEIYGGNSRLSTLSSRFPNLVFKETLAVKEELEGFTNRASQSA  185

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSE-  507
            AIDYI+S  SDVF+ S+ GNMG A++GHR + GH++TITP+++ ++  F    +  L E 
Sbjct  186  AIDYIISVESDVFVSSYSGNMGRAVEGHRRFLGHRRTITPDRKGLVEVFDRLESGDLREG  245

Query  506  SDFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMC  396
            S  + +   +H +  G P  RK   PG              + P P+C+C
Sbjct  246  SSLSALARQMHDNRQGAPRKRKGPLPGLKGKARSRTEESFYENPYPECIC  295



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L + FP   +K+ LA   EL     KAS++A
Sbjct  363  LLTALGFNNSTRLYLASHKVYGGEARISALHQLFPFMEDKKSLAASHELSEVEGKASLLA  422

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL GHRAY  + KTI PN   +   F+N ++  S+F 
Sbjct  423  ALDYYVSMQSDIFISASPGNMHNALLGHRAYK-NLKTIRPNMTLLGKLFLNKTMEWSEFQ  481

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            R +   H++  GQ  LRK  + I  YP PDCMC +
Sbjct  482  RAVQQGHKNRQGQMRLRKEKQSIYTYPAPDCMCKA  516



>gb|EYU18045.1| hypothetical protein MIMGU_mgv1a006471mg [Erythranthe guttata]
Length=443

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (52%), Gaps = 16/174 (9%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P S  IY A G   GG   L  L   FP+   KE LA   EL+  +  AS  A
Sbjct  268  FLQALGYPPSTLIYIAAGEIYGGDTHLSELTSRFPNIVFKEMLASQEELKKISSHASQTA  327

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN---ASLSES  504
            A+DYI+S  SD+F+PSH GNM   ++GHR + GH+KTITP+++ ++  F       L  S
Sbjct  328  ALDYIISIESDIFIPSHSGNMARTVEGHRRFLGHRKTITPDRKGLVELFDKLEAGRLQVS  387

Query  503  DFNRIISYLHRDSLGQPELR-------------KPGRDITKYPVPDCMCNSNTG  381
               R +  LHR+ +G P  R             +      + P P+C+CNS + 
Sbjct  388  SLPRHVKQLHRNRVGAPRRRGGAPSGIRGRARLRLEESFYQNPFPECICNSQSA  441



>gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlisea aurea]
Length=174

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 87/160 (54%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  ++  IY A G     +  + PL+  FP    KE LA P EL  F   +S MA
Sbjct  5    MLRGMGFDRNTNIYLASGKIYNSERYMAPLLDMFPLLQTKEMLASPDELSPFQNYSSRMA  64

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH +TI P+KR++   F N ++    
Sbjct  65   AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRFLYGGHSRTIRPDKRKLAVIFDNPNIGWKS  124

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   I   P PDCMC  N
Sbjct  125  FKRQMLNMRSHSDSKGI-ELKRPNDSIYSVPCPDCMCRVN  163



>ref|XP_011009150.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Populus euphratica]
Length=641

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 10/165 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKA+G P S  IY   G P+ G +++ P + EFP+ ++  +LA   ELE F    + +A
Sbjct  448  FLKAMGYPSSTTIYIVAG-PIYGSDSMAPFLAEFPNVFSHSNLATAEELEPFKPYQNRLA  506

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIP---HFMNASLSES  504
            A+DYIV+  SDVF+ ++ GNM  A+QGHR + G +KTI P+KR  +         +LS  
Sbjct  507  ALDYIVALESDVFIYTYDGNMAKAVQGHRRFEGFRKTINPDKRNFVALMDQLDEGTLSWE  566

Query  503  DFNRIISYLHRDSLGQPELRKPG------RDITKYPVPDCMCNSN  387
            +F+  +  LH D +G P  R+ G       +    P+P C+CNS+
Sbjct  567  EFSSQVQSLHSDRIGAPYRRQAGSFPKEEENFYANPLPGCVCNSS  611



>ref|XP_011009151.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Populus euphratica]
Length=640

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 10/165 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKA+G P S  IY   G P+ G +++ P + EFP+ ++  +LA   ELE F    + +A
Sbjct  447  FLKAMGYPSSTTIYIVAG-PIYGSDSMAPFLAEFPNVFSHSNLATAEELEPFKPYQNRLA  505

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIP---HFMNASLSES  504
            A+DYIV+  SDVF+ ++ GNM  A+QGHR + G +KTI P+KR  +         +LS  
Sbjct  506  ALDYIVALESDVFIYTYDGNMAKAVQGHRRFEGFRKTINPDKRNFVALMDQLDEGTLSWE  565

Query  503  DFNRIISYLHRDSLGQPELRKPG------RDITKYPVPDCMCNSN  387
            +F+  +  LH D +G P  R+ G       +    P+P C+CNS+
Sbjct  566  EFSSQVQSLHSDRIGAPYRRQAGSFPKEEENFYANPLPGCVCNSS  610



>ref|XP_010536455.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=576

 Score =   118 bits (296),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      IY A G   GG+E+L PL   FPHFY+KE +A   ELE F+  +S MA
Sbjct  337  MLRALGYGSDVHIYVASGEVYGGEESLAPLKALFPHFYSKETIATKEELEPFSSYSSRMA  396

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+D++V + SDVF+ ++ GNM   L G R Y GHK TI PN +++   F++  +++  +F
Sbjct  397  ALDFLVCDESDVFVTNNNGNMARILAGRRRYFGHKPTIRPNAKKLYRVFLSKENMTWEEF  456

Query  497  NRIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNTG  381
            + ++    R  +G+P+  +PGR         C+C    G
Sbjct  457  SSVVRTHQRGFMGEPKEVRPGRGEFHENPSTCICEDAKG  495



>ref|XP_010325489.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=495

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 4/155 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      +Y A G   GG++ LQPL + FP+FY KE LA   EL+ F   +S +A
Sbjct  272  MLRALGFNNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKEMLA-GEELQPFLPYSSRLA  330

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM-NASLSESDF  498
            AIDYIV + SDVF  ++ GNM   L G R Y GHK+TI PN +++   FM    +  + F
Sbjct  331  AIDYIVCDESDVFATNNNGNMAKILAGRRRYMGHKRTIRPNAKRLSALFMARDKMDWATF  390

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMC  396
            +R +    R  LG+PE  KPGR D  ++P   C+C
Sbjct  391  SRKVKSCQRGFLGEPEENKPGRGDFHEFP-STCIC  424



>ref|XP_002969822.1| hypothetical protein SELMODRAFT_231467 [Selaginella moellendorffii]
 gb|EFJ28946.1| hypothetical protein SELMODRAFT_231467 [Selaginella moellendorffii]
Length=382

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 92/167 (55%), Gaps = 10/167 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL+ALG P++  +Y A G   GG++ +Q     +P+   KE L  P EL+ F +  + +A
Sbjct  213  LLRALGYPQNTTVYIAAGEIYGGRQRMQSFTALYPNVVTKETLTSPEELKPFRRFQNRLA  272

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMI---PHFMNASLSES  504
            A+DY+V+  SDVF+P+  GNM  A+QGHR + GH+KT+ P++ +++     F   ++   
Sbjct  273  ALDYMVAVESDVFIPTFDGNMARAVQGHRRFLGHRKTLIPDRTRLVRIFDEFERRAIGWD  332

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKY-------PVPDCMCNSNT  384
                 +   HR+  G+P  RK G    K        P+P C+C + T
Sbjct  333  SVKLQVQKTHRNRQGEPHFRKSGSSNAKLEESFYANPLPGCICENTT  379



>ref|XP_010520421.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=413

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 95/172 (55%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKALG P S  IY A G   GG + L  L   FP+   KE LA   EL+ +   A+  A
Sbjct  236  FLKALGYPPSTLIYIAAGEIYGGDDRLSELRSYFPNLVFKEMLATEKELKGYTGHATKTA  295

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F    +  LSE 
Sbjct  296  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFEKLESGQLSEG  355

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
               ++ +  +H+D  G P  RK   PG              + P P+C+C+S
Sbjct  356  PKLSKRVKQMHQDRQGAPRKRKGPSPGVRGRARFRTEESFYENPFPECICSS  407



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 90/155 (58%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L   FPH  +K+ LA   E      KAS++A
Sbjct  363  LLAALGFDNSTRLYLASHKVYGGEARISTLRSLFPHMEDKKSLASSEERAQIKGKASLLA  422

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS +SD+F+ +  GNM +A+ GHR Y  +KKTI P+   +   F+N +L+  +F 
Sbjct  423  AVDYYVSMHSDIFISASPGNMHNAVVGHRTYE-NKKTIRPSMTLLGQLFLNKNLTWPEFQ  481

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
              +   H++  GQ  LRKP + I  YP PDCMCN+
Sbjct  482  DAVVEGHKNRQGQLRLRKPQQSIYTYPAPDCMCNA  516



>ref|XP_002985158.1| hypothetical protein SELMODRAFT_234721 [Selaginella moellendorffii]
 gb|EFJ13652.1| hypothetical protein SELMODRAFT_234721 [Selaginella moellendorffii]
Length=382

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 92/167 (55%), Gaps = 10/167 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL+ALG P++  +Y A G   GG++ +Q     +P+   KE L  P EL+ F +  + +A
Sbjct  213  LLRALGYPQNTTVYIAAGEIYGGRQRMQSFTALYPNVVTKETLTSPEELKPFRRFQNRLA  272

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMI---PHFMNASLSES  504
            A+DY+V+  SDVF+P+  GNM  A+QGHR + GH+KT+ P++ +++     F   ++   
Sbjct  273  ALDYMVAVESDVFIPTFDGNMARAVQGHRRFLGHRKTLIPDRTRLVRIFDEFERRAIGWD  332

Query  503  DFNRIISYLHRDSLGQPELRKPGRDITKY-------PVPDCMCNSNT  384
                 +   HR+  G+P  RK G    K        P+P C+C + T
Sbjct  333  SVKLQVQKTHRNRQGEPHFRKSGSSNAKLEESFYANPLPGCICENTT  379



>gb|KDP42616.1| hypothetical protein JCGZ_24390 [Jatropha curcas]
Length=524

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 95/172 (55%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG   S  IY A G   G +  L  L   FP+   KE LA P EL+AFAK AS  A
Sbjct  349  FLQALGYSPSTVIYIAAGEIYGCESHLLELTSRFPNTVFKETLATPEELKAFAKHASQTA  408

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSE-  507
            A+DYI+S  SDVF+PS+ GNM   ++GHR + GH+KTI P+++ ++  +    N  L E 
Sbjct  409  ALDYIISIESDVFVPSYSGNMARTVEGHRRFLGHRKTIHPDRKGLVKLYDKLENGQLKEG  468

Query  506  SDFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
            S F+ I+  +H++  G P  RK   PG              + P P+C+C S
Sbjct  469  SSFSYIVQEMHKNRQGAPRKRKGPLPGIKGRARFRTEESFYENPYPECICRS  520



>ref|XP_003564076.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=528

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 94/173 (54%), Gaps = 17/173 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L ALG P S  +Y A G   GG+  +  L   FP   NKE LA   EL  F++ AS MA
Sbjct  349  FLSALGYPSSTPVYIAAGEIYGGESHMVDLQSRFPILMNKEKLASAEELRPFSQYASQMA  408

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNAS---LSES  504
            A+DYIVS  SDVF+PS+ GNM  A+ GHR + GHKKT++P+++ ++  F       L E 
Sbjct  409  ALDYIVSVESDVFIPSYSGNMARAVAGHRRFHGHKKTVSPDRKALVRLFDKVDSGLLDEG  468

Query  503  D-FNRIISYLHRDSLGQPELRK------PGRD-------ITKYPVPDCMCNSN  387
            +  ++ I+ +HR   G P  RK       G D         + P+PDC+C S 
Sbjct  469  ERLSQRITEIHRKRQGSPRKRKGPVSGTKGSDRFRSEEAFYENPLPDCLCQST  521



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 90/158 (57%), Gaps = 1/158 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S  +Y A     GG+  +  L K FP   +K+ LA   E      KAS++A
Sbjct  360  LLAALGFDNSTHLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEERVKIEGKASLLA  419

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS +SD+F+ +  GNM +AL GHRAY  + KTI PN   +   F+N S+  SDF 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNALVGHRAYQ-NLKTIRPNMALLGQLFLNKSMGWSDFQ  478

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSNTG  381
            R +   H+D  GQ  L+K  + I  YP PDCMC ++T 
Sbjct  479  RAVLEGHKDRQGQIRLKKEKQSIYTYPAPDCMCRASTS  516



>gb|EPS69854.1| hypothetical protein M569_04906, partial [Genlisea aurea]
Length=433

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 91/172 (53%), Gaps = 18/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+ALG P+S  IY A G  + G+  L+ L   FP+   KE LA   EL  F+  AS  A
Sbjct  262  FLEALGYPRSTLIYIASG-KIYGETHLRELTSRFPNVVFKEMLATEEELGTFSNHASRSA  320

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNAS----LSE  507
            A+DY+VS  SDVFMPSH GNM   ++GHR + GH+KTITP+++ ++  F        L  
Sbjct  321  ALDYVVSVESDVFMPSHDGNMARVVEGHRRFLGHRKTITPDRKGLVRLFDKLEAGIILDA  380

Query  506  SDFNRIISYLHRDSLGQPELR-------------KPGRDITKYPVPDCMCNS  390
            S   R +  LHR+ +G P  R             +      + P P+C+C S
Sbjct  381  SSLPRYVKQLHRNRVGAPRRRGSSPLGIRGRARLRLEESFYQNPFPECICRS  432



>ref|XP_007048357.1| O-fucosyltransferase family protein isoform 3 [Theobroma cacao]
 gb|EOX92514.1| O-fucosyltransferase family protein isoform 3 [Theobroma cacao]
Length=513

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 95/176 (54%), Gaps = 19/176 (11%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G P S  IY A G   GG   L  L+  FP+   KE LA   EL+AFAK AS  A
Sbjct  332  FLQAVGYPPSTLIYVAAGEIYGGDARLSELMSRFPNLVFKEQLATEKELKAFAKHASQSA  391

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-----ASLS  510
            A+DYI+S  SDVF+PS+ GNM  A++GHR + GH+KTITP+ R+ +    +         
Sbjct  392  ALDYIISIESDVFVPSYSGNMARAVEGHRRFLGHRKTITPDSRKGLVRLFDELEGGQHRE  451

Query  509  ESDFNRIISYLHRDSL-GQPELRK---PG----------RDITKYPVPDCMCNSNT  384
             S F+ ++   H++S  G P  RK   PG              + P P+C+C+S  
Sbjct  452  ASSFSYLVRQTHKNSRQGAPRKRKGPSPGIKGKARFRTEESFYENPFPECICSSKV  507



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   + R+Y A     GG+  +  L K FP   NK+ LA   EL     KAS+MA
Sbjct  365  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  424

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +ALQ HRAY  + KTI PN   +   F+N SL  S+F 
Sbjct  425  AVDYYVSMKSDIFISASPGNMHNALQAHRAYL-NLKTIRPNMILLGQVFVNKSLDWSEFE  483

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMC  396
              +   H++  GQ  LRK  + I  YP PDCMC
Sbjct  484  GAVMNGHKNRQGQLRLRKQKQSIYTYPAPDCMC  516



>ref|XP_009398160.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 93/171 (54%), Gaps = 17/171 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L +LG P +  IY A G   GG   L  L   FP   +KE LA   ELE F   AS MA
Sbjct  350  FLSSLGYPSNTPIYVAAGAIYGGGSHLSDLESRFPILLSKEKLASAEELEPFKDYASQMA  409

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSE-  507
            A+DYIVS  SDVF+PS+ GNM  A++GHR + GH+KTI PN++ ++  F      SL E 
Sbjct  410  ALDYIVSVESDVFVPSYLGNMARAVEGHRRFLGHRKTINPNRKDLVQLFDKINRGSLKEG  469

Query  506  SDFNRIISYLHRDSLGQPELRK---PG-RDITKY---------PVPDCMCN  393
               + II  +H+   G P  RK   PG R + ++         P+PDC+C 
Sbjct  470  KKLSNIIVEIHKRRQGSPRKRKGPIPGTRGVERFRSEEAFYENPLPDCLCQ  520



>gb|KHN43011.1| DUF246 domain-containing protein [Glycine soja]
Length=440

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 90/160 (56%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  I+ A G     ++ + PL++ FP+ + KE LA   EL  F   +S MA
Sbjct  271  MLRGMGFTKNTSIFLASGKIYNAEKTMAPLLQMFPNLHTKETLASEEELAPFKNYSSRMA  330

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V   S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N ++    
Sbjct  331  AIDYTVCLQSEVFVTTQGGNFPHFLLGHRRFLYGGHAKTIKPDKRKLALLFDNPNIGWKS  390

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
              R +  +  H DS G  EL++P   I  +P PDCMC SN
Sbjct  391  LKRQLLSMRSHSDSKGV-ELKRPNDSIYSFPCPDCMCRSN  429



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 86/155 (55%), Gaps = 0/155 (0%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L ALG      +Y A     GG   +  L   FP+   K  LA   EL  FA KAS +A
Sbjct  265  MLVALGFSPKTHVYLASYTVYGGSARMDFLHNLFPNMVTKYTLATAEELAPFAGKASQLA  324

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            AIDY+VS +SD+F+ +  GNM ++L  HR Y   +KTI P+   M   F + +L+  +F 
Sbjct  325  AIDYLVSLHSDIFLSASRGNMHNSLAAHRTYLNVRKTIKPDMNLMARLFAHKNLTWPEFR  384

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            R +   H++ +GQ  LR+P + I  YP PDCMC S
Sbjct  385  RSVVEGHKNRMGQVALRQPTQSIYTYPAPDCMCTS  419



>ref|XP_004976498.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=578

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   +Y A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  352  MLRALGFGKDVHVYVASGDVYGGEETLAPLKALFPNFHSKETLASKEELAPFLPYSSRMA  411

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+D+IV + SDVF+ ++ GNM   L G R Y GH++TI PN +++   F+N  S+S   F
Sbjct  412  ALDFIVCDRSDVFVTNNNGNMARMLAGRRRYFGHRRTIRPNAKKLYSLFLNRTSMSWDRF  471

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
               +    +  +G+P   KPGR +  ++P+ DC+C  + G
Sbjct  472  ASKVQTFQKGFMGEPNEIKPGRGEFHEHPM-DCICAKSKG  510



>ref|XP_006280272.1| hypothetical protein CARUB_v10026194mg [Capsella rubella]
 gb|EOA13170.1| hypothetical protein CARUB_v10026194mg [Capsella rubella]
Length=542

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 93/172 (54%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG  +S  IY A G   GG + L  L   FP+   KE LA  GEL+ F   A+  A
Sbjct  365  FLKGLGYSQSTVIYIAAGEIYGGDDRLSELKSRFPNLVFKETLAEKGELKGFTGHATKTA  424

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +    
Sbjct  425  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFSKMERGQLKEG  484

Query  506  SDFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
               + ++  +H+D  G P  RK P + I             + P P+C+C+S
Sbjct  485  RKLSNLVKQMHQDRQGAPRRRKGPTQGIKGRARFRTEEAFYENPYPECICSS  536



>ref|XP_010520413.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=512

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 95/172 (55%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKALG P S  IY A G   GG + L  L   FP+   KE LA   EL+ +   A+  A
Sbjct  335  FLKALGYPPSTLIYIAAGEIYGGDDRLSELRSYFPNLVFKEMLATEKELKGYTGHATKTA  394

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F    +  LSE 
Sbjct  395  ALDYIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFEKLESGQLSEG  454

Query  503  -DFNRIISYLHRDSLGQPELRK---PG----------RDITKYPVPDCMCNS  390
               ++ +  +H+D  G P  RK   PG              + P P+C+C+S
Sbjct  455  PKLSKRVKQMHQDRQGAPRKRKGPSPGVRGRARFRTEESFYENPFPECICSS  506



>emb|CBI19199.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 92/172 (53%), Gaps = 18/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L ALG P S  IY A G   GG   +  L   +P   +KE LA   ELE FA  AS MA
Sbjct  352  FLMALGYPSSTPIYIAAGEIYGGDSHMADLQSRYPILMSKEKLASIDELEPFANHASQMA  411

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN----ASLSE  507
            A+DYIVS  SDVF+PS+ GNM  A++GHR + GH+KTI+P+++  + H  +     SL E
Sbjct  412  ALDYIVSVESDVFIPSYSGNMARAVEGHRRFLGHRKTISPDRQDSLVHLFDKIERGSLKE  471

Query  506  -SDFNRIISYLHRDSLGQPELRKPGRDITK-------------YPVPDCMCN  393
              + +  I  LHR   G P  RK     TK              P+PDC+C+
Sbjct  472  GKNLSNKIMELHRKRQGSPRKRKGPISGTKGMDRFRSEEAFYVNPIPDCLCH  523



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 86/154 (56%), Gaps = 1/154 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG   +  L + FP   +K+ L LP E      KAS++A
Sbjct  350  LLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLA  409

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY +S +SD+F+ +  GNM +AL GHR Y  + KTI PN   M   F+N ++  S+F 
Sbjct  410  ALDYYISIHSDIFISASPGNMHNALVGHRTYL-NLKTIRPNMALMGQLFLNKTMEWSEFE  468

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
              +   H    GQ  LRKP + I  YPVPDCMC 
Sbjct  469  HAVVEGHESRQGQLRLRKPKQSIYTYPVPDCMCQ  502



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = -3

Query  854   LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LL ALG   + R+Y A     GG+  +  L K FP   +K+ L  P E    A KAS+ A
Sbjct  1291  LLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSA  1350

Query  674   AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
             A+DY VS +SDVF+ +  GNM +AL GHRAY  + KTI PN   + P F+N S+  S+F 
Sbjct  1351  AVDYYVSLHSDVFISASPGNMHNALLGHRAYL-NMKTIRPNMVLLGPLFLNKSMEWSEFK  1409

Query  494   RIISYLHRDSLGQPELRKPGRDITKYPVPDCMC  396
             + +   HR+  GQ  LRK  + I  YP PDCMC
Sbjct  1410  KAVLTGHRNRQGQIRLRKETQSIYTYPAPDCMC  1442



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   S R+Y A     GG+  +  L + FP   +K+ LA   E      KAS++A
Sbjct  400  LLAALGFDNSTRLYLASHKVYGGEARISTLRQLFPFMEDKKSLASSEERSQITGKASLLA  459

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS +SD+F+ +  GNM +A+ GHR Y  + KTI PN   M   F+N S+S SDF 
Sbjct  460  AVDYYVSMHSDIFISASPGNMHNAMVGHRTY-NNLKTIRPNMALMGQLFLNKSISWSDFQ  518

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            + +   H+   GQ  LR P + I  YP PDCMC +
Sbjct  519  QSVMEGHQSRQGQIRLRNPKQSIYTYPSPDCMCEA  553



>ref|XP_011038632.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=569

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  IY A G     ++ + PL++ FP+   K+ LAL  EL+ F   +S MA
Sbjct  400  MLRGMGFDKNTHIYLASGKIYNSEKYMAPLLEMFPNLLTKDMLALDEELDPFKNYSSRMA  459

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N  +    
Sbjct  460  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRFLYGGHSKTIRPDKRKLALLFDNPKIGWKS  519

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   +  YP PDCMC  N
Sbjct  520  FKRHMMNMRSHSDSKGF-ELKRPNDSVYSYPCPDCMCRVN  558



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   + R+Y A     GG+  +  L + FP   +K+ LA   E      KAS++A
Sbjct  367  LLAALGFNNTTRLYLASYKVYGGEARISTLRRLFPDMEDKKSLASAEERAKVEGKASLLA  426

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL GHRAY  + KTI PN   +   F+N S+  SDF 
Sbjct  427  AVDYYVSMQSDIFISASPGNMHNALVGHRAYM-NLKTIRPNMALLGKLFVNKSMEWSDFQ  485

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
            R +S  H+   GQ  LRK  + I  YP PDCMC +
Sbjct  486  RAVSDGHKTRXGQMRLRKEKQSIYTYPAPDCMCRA  520



>ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
 gb|EEF02050.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
Length=569

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G  K+  IY A G     ++ + PL++ FP+   K+ LAL  EL+ F   +S MA
Sbjct  400  MLRGMGFDKNTHIYLASGKIYNSEKYMAPLLEMFPNLLTKDMLALDEELDPFKNYSSRMA  459

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N  +    
Sbjct  460  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRFLYGGHSKTIRPDKRKLALLFDNPKIGWKS  519

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   +  YP PDCMC  N
Sbjct  520  FKRHMMNMRSHSDSKGF-ELKRPNDSVYSYPCPDCMCRVN  558



>ref|XP_003580329.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=566

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 3/160 (2%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG  K   +Y A G   GG+E L PL   FP+F++KE LA   EL  F   +S MA
Sbjct  340  MLRALGFGKDVHLYVASGDVYGGEETLAPLKALFPNFHSKETLASKEELAPFLPFSSRMA  399

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMN-ASLSESDF  498
            A+DY+V + SDVF+ ++ GNM   L G R Y GHK+TI PN +++   F+N  S+S   F
Sbjct  400  ALDYVVCDGSDVFVTNNNGNMARMLAGRRRYFGHKRTIRPNSKKLSSLFLNRTSMSWDTF  459

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMCNSNTG  381
               +    +  +G+P   KPG+ +  ++P+ DC+C    G
Sbjct  460  ASKVQMFQKGFMGEPNEIKPGKGEFHEHPM-DCICARTKG  498



>ref|XP_002323547.2| hypothetical protein POPTR_0016s11700g [Populus trichocarpa]
 gb|EEF05308.2| hypothetical protein POPTR_0016s11700g [Populus trichocarpa]
Length=723

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 95/165 (58%), Gaps = 10/165 (6%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LKA+G P S  IY   G P+ G +++ P + EFP+ ++  +LA   ELE F    + +A
Sbjct  530  FLKAMGYPSSTTIYIVAG-PIYGSDSMAPFLAEFPNVFSHSNLATAEELEPFKPYQNRLA  588

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQ---MIPHFMNASLSES  504
            A+DYIV+  SDVF+ ++ GNM  A+QGHR + G +KTI P+K+    +I      +LS  
Sbjct  589  ALDYIVALESDVFIYTYDGNMAKAVQGHRRFEGFRKTINPDKQNFVALIDQLDEGTLSWE  648

Query  503  DFNRIISYLHRDSLGQPELRKPG------RDITKYPVPDCMCNSN  387
            +F+  +  LH D +G P  R+ G       +    P+P C+CNS+
Sbjct  649  EFSSQVQSLHSDRIGAPYRRQAGSFPKEEENFYANPLPGCVCNSS  693



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 0/155 (0%)
 Frame = -3

Query  851  LKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMAA  672
            L ALG     R+Y A     GG+  L  L   FP   +K  LA+  EL  F +KAS+ AA
Sbjct  316  LAALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQDKASLAIDAELRPFERKASLSAA  375

Query  671  IDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFNR  492
            +DY V   SD F+ +  GNM +A+ GHR Y   +KT+ P+   +   F N+S+   +F  
Sbjct  376  LDYYVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQN  435

Query  491  IISYLHRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
             +   HR+ LGQ  LR+P + I  YP PDCMC SN
Sbjct  436  RVYNGHRNRLGQVRLRQPKQSIYTYPAPDCMCKSN  470



>ref|XP_008467134.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=563

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ +G   S  IY A G     +  + PL++ FP+   KE LA P EL  F   +S MA
Sbjct  394  MLRGMGFDNSTFIYLASGKIYDAERNMAPLLEMFPNLLTKEMLASPEELSPFKNFSSRMA  453

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHR--AYAGHKKTITPNKRQMIPHFMNASLSESD  501
            AIDY V  +S+VF+ + GGN  H L GHR   Y GH KTI P+KR++   F N ++   +
Sbjct  454  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPTIGWKN  513

Query  500  FNRIISYL--HRDSLGQPELRKPGRDITKYPVPDCMCNSN  387
            F R +  +  H DS G  EL++P   I  +P PDCMC +N
Sbjct  514  FKRHMLNMRSHSDSKGF-ELKRPNDSIYTFPCPDCMCFTN  552



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG   + R+Y A     GG+  +  L K FP   NK+ LA   EL     KAS+MA
Sbjct  365  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  424

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS  SD+F+ +  GNM +AL  HRAY  + KTI PN   +   F+N SL  S+F 
Sbjct  425  AVDYYVSMKSDIFISASPGNMHNALLAHRAYL-NLKTIRPNMILLGQVFVNKSLEWSEFE  483

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCNS  390
              +   HR+  GQ  LRK  + I  YP PDCMC +
Sbjct  484  GAVVNGHRNRQGQLRLRKQKQSIYTYPAPDCMCKA  518



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 1/154 (1%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            LL ALG  KS R+Y A     GG+  +  L + FP   +K+ LA   E      KAS++A
Sbjct  320  LLAALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLA  379

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSESDFN  495
            A+DY VS +S++F+ +  GNM +AL GHR Y  + KTI PN   +   F+N SLS S+F 
Sbjct  380  ALDYYVSMHSNIFISASPGNMHNALMGHRTYE-NLKTIKPNMALLGQLFLNKSLSWSEFQ  438

Query  494  RIISYLHRDSLGQPELRKPGRDITKYPVPDCMCN  393
            + +   H +  GQ  +RKP + I  YP PDCMC+
Sbjct  439  QAVVEGHENRQGQIRIRKPKQSIYTYPAPDCMCH  472



>ref|XP_004245776.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=592

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 4/155 (3%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
            +L+ALG      +Y A G   GG++ LQPL + FP+FY KE LA   EL+ F   +S +A
Sbjct  369  MLRALGFNNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKEMLA-GEELQPFLPYSSRLA  427

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFM-NASLSESDF  498
            AIDYIV + SDVF  ++ GNM   L G R Y GHK+TI PN +++   FM    +  + F
Sbjct  428  AIDYIVCDESDVFATNNNGNMAKILAGRRRYMGHKRTIRPNAKRLSALFMARDKMDWATF  487

Query  497  NRIISYLHRDSLGQPELRKPGR-DITKYPVPDCMC  396
            +R +    R  LG+PE  KPGR D  ++P   C+C
Sbjct  488  SRKVKSCQRGFLGEPEENKPGRGDFHEFP-STCIC  521



>ref|XP_006394134.1| hypothetical protein EUTSA_v10004008mg [Eutrema salsugineum]
 gb|ESQ31420.1| hypothetical protein EUTSA_v10004008mg [Eutrema salsugineum]
Length=517

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 92/172 (53%), Gaps = 17/172 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             LK LG P+S  IY A G   GG E L  L   FP+   KE LA   EL  F   A+  A
Sbjct  342  FLKGLGYPQSTVIYIAAGEIYGGDERLSELKSRFPNLVFKEKLATEDELRGFTGHATKTA  401

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHFMNASLSE----  507
            A+D I+S  SDVF+PSH GNM  A++GHR + GH++TITP+++ ++  F      +    
Sbjct  402  ALDCIISVESDVFVPSHSGNMARAVEGHRRFLGHRRTITPDRKGLVKLFNKVERGQIKEG  461

Query  506  SDFNRIISYLHRDSLGQPELRK-PGRDIT------------KYPVPDCMCNS  390
            + F+ ++  +H+   G P  RK P + I             + P P+C+C+S
Sbjct  462  AKFSNLVQQMHQARQGAPRRRKGPTQGIKGRARFRTEEAFYENPYPECICSS  513



>gb|EEE52890.1| hypothetical protein OsJ_35473 [Oryza sativa Japonica Group]
Length=480

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 93/170 (55%), Gaps = 17/170 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G P+S  IY A G   GG + +  L   FP+  +KE LA   EL  F   AS +A
Sbjct  306  FLRAMGYPESTWIYLAAGEIYGGDKYISKLRSYFPNLVSKEVLATKEELGKFNDHASQVA  365

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYIVS  SDVF+PSH GNM  A++GHR + GH+KT+TP++R ++  F       L E 
Sbjct  366  ALDYIVSVESDVFIPSHSGNMARAVEGHRRFLGHRKTVTPDRRGLVELFDLLQKGELMEG  425

Query  503  -DFNRIISYLHRDSLGQPELR-------------KPGRDITKYPVPDCMC  396
              F+ +++ +H++  G P  R             +      + P P+C+C
Sbjct  426  PKFSSLVTEMHKNRQGAPRKRYGSLPGSKGRARLRTEESFYENPFPECIC  475



>ref|XP_004977171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Setaria italica]
Length=398

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 93/170 (55%), Gaps = 17/170 (10%)
 Frame = -3

Query  854  LLKALGAPKSARIYWAGGIPLGGKEALQPLIKEFPHFYNKEDLALPGELEAFAKKASIMA  675
             L+A+G P+S  IY A G   GG + +  L   FP+  +KE LA   ELE F+  AS +A
Sbjct  224  FLRAMGYPESTWIYLAAGEIYGGDKYISKLRSYFPNLVSKEMLATKEELEKFSNHASQVA  283

Query  674  AIDYIVSENSDVFMPSHGGNMGHALQGHRAYAGHKKTITPNKRQMIPHF---MNASLSES  504
            A+DYI+S  SDVF+PSH GNM  A++GHR + GH+KTITP++R ++  F       L E 
Sbjct  284  ALDYIISVESDVFVPSHSGNMAKAVEGHRRFLGHRKTITPDRRGLVELFDLLEKGELMEG  343

Query  503  -DFNRIISYLHRDSLGQPELR-------------KPGRDITKYPVPDCMC  396
               + +++ +H+   G P  R             +      + P P+C+C
Sbjct  344  PKLSSVVTDMHKYRQGAPRKRYGSLPGSKGRARLRTEESFYENPFPECIC  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2714028746400