BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13639_g1_i1 len=1157 path=[1143:0-503 1647:504-743 1887:744-746
1890:747-1156]

Length=1157
                                                                      Score     E

ref|XP_007052352.1|  WRKY family transcription factor                   292   5e-94   
ref|XP_009595924.1|  PREDICTED: probable WRKY transcription facto...    288   4e-92   
ref|XP_009604138.1|  PREDICTED: probable WRKY transcription facto...    287   1e-91   
emb|CDP09423.1|  unnamed protein product                                278   2e-88   
ref|XP_003529027.1|  PREDICTED: probable WRKY transcription facto...    278   4e-88   
gb|KHN12046.1|  Putative WRKY transcription factor 12                   278   6e-88   
ref|XP_010052790.1|  PREDICTED: probable WRKY transcription facto...    276   2e-87   
ref|XP_010086778.1|  putative WRKY transcription factor 12              276   3e-87   
ref|XP_004229735.1|  PREDICTED: probable WRKY transcription facto...    275   7e-87   
ref|XP_011017378.1|  PREDICTED: probable WRKY transcription facto...    273   1e-86   
ref|XP_003521060.1|  PREDICTED: probable WRKY transcription facto...    273   3e-86   
ref|XP_004515333.1|  PREDICTED: probable WRKY transcription facto...    271   8e-86   
ref|XP_011032445.1|  PREDICTED: probable WRKY transcription facto...    270   5e-85   
ref|XP_009788556.1|  PREDICTED: probable WRKY transcription facto...    269   7e-85   
gb|AEJ09955.1|  STP                                                     269   7e-85   
ref|XP_009797802.1|  PREDICTED: probable WRKY transcription facto...    268   3e-84   
ref|XP_006375168.1|  hypothetical protein POPTR_0014s04890g             268   3e-84   
ref|XP_002270527.1|  PREDICTED: probable WRKY transcription facto...    265   2e-83   Vitis vinifera
ref|XP_006347986.1|  PREDICTED: probable WRKY transcription facto...    261   2e-81   
gb|AEQ29015.1|  WRKY2                                                   259   1e-80   
ref|XP_007219496.1|  hypothetical protein PRUPE_ppa022287mg             258   4e-80   
ref|XP_008232541.1|  PREDICTED: probable WRKY transcription facto...    258   5e-80   
ref|XP_002301237.2|  hypothetical protein POPTR_0002s13980g             255   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011101863.1|  PREDICTED: probable WRKY transcription facto...    256   2e-79   
ref|XP_008437760.1|  PREDICTED: probable WRKY transcription facto...    254   5e-79   
ref|XP_004133758.1|  PREDICTED: probable WRKY transcription facto...    253   8e-79   
gb|KHN40537.1|  Putative WRKY transcription factor 12                   253   2e-78   
ref|XP_009373203.1|  PREDICTED: probable WRKY transcription facto...    251   1e-77   
ref|NP_001235408.1|  uncharacterized protein LOC100526878               251   1e-77   
gb|EYU40347.1|  hypothetical protein MIMGU_mgv1a026438mg                251   2e-77   
ref|NP_001237545.1|  transcription factor                               250   3e-77   
ref|XP_003636165.1|  WRKY transcription factor                          256   4e-76   
ref|XP_004306977.1|  PREDICTED: probable WRKY transcription facto...    248   4e-76   
gb|AGQ04204.1|  WRKY transcription factor 16                            245   1e-75   
ref|XP_010258736.1|  PREDICTED: probable WRKY transcription facto...    244   4e-75   
ref|XP_010258737.1|  PREDICTED: probable WRKY transcription facto...    237   1e-72   
ref|XP_010919760.1|  PREDICTED: probable WRKY transcription facto...    237   2e-72   
ref|XP_008794915.1|  PREDICTED: probable WRKY transcription facto...    233   9e-71   
ref|XP_011093231.1|  PREDICTED: probable WRKY transcription facto...    231   1e-70   
ref|XP_009397047.1|  PREDICTED: probable WRKY transcription facto...    230   6e-70   
ref|XP_010246101.1|  PREDICTED: probable WRKY transcription facto...    230   7e-70   
ref|XP_010919759.1|  PREDICTED: probable WRKY transcription facto...    227   1e-68   
ref|XP_008794917.1|  PREDICTED: probable WRKY transcription facto...    226   3e-68   
ref|XP_006445445.1|  hypothetical protein CICLE_v10023956mg             226   1e-67   
ref|XP_010246102.1|  PREDICTED: probable WRKY transcription facto...    224   2e-67   
ref|XP_008794914.1|  PREDICTED: probable WRKY transcription facto...    223   6e-67   
ref|XP_009407832.1|  PREDICTED: probable WRKY transcription facto...    220   4e-66   
ref|XP_010692038.1|  PREDICTED: probable WRKY transcription facto...    221   6e-66   
ref|XP_008794916.1|  PREDICTED: probable WRKY transcription facto...    216   2e-64   
ref|XP_006294932.1|  hypothetical protein CARUB_v10023987mg             215   9e-64   
ref|XP_010524442.1|  PREDICTED: probable WRKY transcription facto...    214   1e-63   
ref|XP_010559087.1|  PREDICTED: probable WRKY transcription facto...    213   2e-63   
ref|NP_566025.2|  putative WRKY transcription factor 12                 209   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881979.1|  WRKY family transcription factor                   209   1e-61   
gb|ABK28536.1|  unknown                                                 209   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647614.1|  PREDICTED: probable WRKY transcription facto...    208   2e-61   
gb|AAM14881.1|  Expressed protein                                       207   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ24028.1|  hypothetical protein OsJ_07759                          207   3e-61   Oryza sativa Japonica Group [Japonica rice]
emb|CAC39034.1|  WRKY-like DNA-binding protein                          207   9e-61   Oryza sativa [red rice]
gb|EAY86917.1|  hypothetical protein OsI_08301                          206   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_004953301.1|  PREDICTED: probable WRKY transcription facto...    205   6e-60   
gb|ADX60183.1|  WRKY transcription factor                               202   5e-59   
gb|AGQ46321.1|  zinc finger transcription factor WRKY12                 202   1e-58   
ref|XP_002452824.1|  hypothetical protein SORBIDRAFT_04g033240          201   3e-58   Sorghum bicolor [broomcorn]
emb|CDX95615.1|  BnaC03g24960D                                          199   3e-58   
gb|AIE43865.1|  WRKY transcription factor 25                            211   5e-58   
emb|CDY30483.1|  BnaA04g25840D                                          200   5e-58   
ref|XP_008678893.1|  PREDICTED: probable WRKY transcription facto...    199   1e-57   
ref|XP_008363203.1|  PREDICTED: probable WRKY transcription facto...    194   3e-57   
ref|XP_009133687.1|  PREDICTED: probable WRKY transcription facto...    197   6e-57   
emb|CDX83415.1|  BnaA03g20910D                                          196   6e-57   
ref|NP_001288854.1|  probable WRKY transcription factor 12              196   8e-57   
ref|XP_010518079.1|  PREDICTED: probable WRKY transcription facto...    196   8e-57   
ref|XP_010508256.1|  PREDICTED: probable WRKY transcription facto...    195   2e-56   
ref|XP_010506408.1|  PREDICTED: probable WRKY transcription facto...    195   3e-56   
tpg|DAA05099.1|  TPA: WRKY transcription factor 34                      191   3e-56   
ref|XP_006397656.1|  hypothetical protein EUTSA_v10001624mg             195   4e-56   
ref|XP_003581484.1|  PREDICTED: probable WRKY transcription facto...    195   6e-56   
ref|XP_004956420.1|  PREDICTED: probable WRKY transcription facto...    195   6e-56   
gb|KFK37278.1|  hypothetical protein AALP_AA4G236300                    194   9e-56   
ref|XP_009143064.1|  PREDICTED: probable WRKY transcription facto...    194   1e-55   
gb|ADD81254.1|  WRKY12                                                  194   1e-55   
ref|XP_003572766.2|  PREDICTED: probable WRKY transcription facto...    191   2e-55   
gb|EMS50538.1|  putative WRKY transcription factor 12                   191   4e-55   
gb|ACD80364.1|  WRKY3 transcription factor                              192   6e-55   Triticum aestivum [Canadian hard winter wheat]
emb|CDY71963.1|  BnaCnng75330D                                          191   7e-55   
gb|AJA32886.1|  WRKY transcription factor                               191   8e-55   
ref|NP_001053464.1|  Os04g0545000                                       191   2e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04349.2|  OSJNBb0038F03.13                                       191   2e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67250.1|  OSIGBa0101C23.2                                        191   2e-54   Oryza sativa [red rice]
ref|XP_009133686.1|  PREDICTED: probable WRKY transcription facto...    190   2e-54   
gb|EMT01578.1|  Putative WRKY transcription factor 12                   188   5e-54   
ref|XP_002448267.1|  hypothetical protein SORBIDRAFT_06g024220          190   5e-54   Sorghum bicolor [broomcorn]
emb|CDY23453.1|  BnaC04g49810D                                          188   1e-53   
emb|CDY48258.1|  BnaC04g05170D                                          187   2e-53   
gb|ACN34879.1|  unknown                                                 184   6e-52   Zea mays [maize]
ref|NP_001151912.1|  WRKY36 - superfamily of TFs having WRKY and ...    184   9e-52   Zea mays [maize]
tpg|DAA36632.1|  TPA: putative WRKY DNA-binding domain superfamil...    185   1e-51   
tpg|DAA36631.1|  TPA: putative WRKY DNA-binding domain superfamil...    174   9e-50   
gb|KCW76865.1|  hypothetical protein EUGRSUZ_D01219                     170   3e-47   
gb|AGQ04203.1|  WRKY transcription factor 15                            166   1e-44   
ref|XP_002534045.1|  WRKY transcription factor, putative                160   3e-44   Ricinus communis
ref|XP_010680328.1|  PREDICTED: probable WRKY transcription facto...    164   5e-44   
gb|ADE77827.1|  unknown                                                 164   1e-43   
gb|KHG26723.1|  putative WRKY transcription factor 13 -like protein     158   1e-43   
gb|ACV92012.2|  WRKY transcription factor 10                            162   2e-43   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_008793465.1|  PREDICTED: probable WRKY transcription facto...    162   2e-43   
ref|NP_001237342.1|  WRKY40                                             161   3e-43   
gb|KHN29128.1|  Putative WRKY transcription factor 13                   161   3e-43   
ref|XP_002306363.2|  WRKY transcription factor 13 family protein        161   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002310044.1|  hypothetical protein POPTR_0007s06930g             161   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010268590.1|  PREDICTED: probable WRKY transcription facto...    160   5e-43   
emb|CDP12868.1|  unnamed protein product                                160   6e-43   
gb|AIE43864.1|  WRKY transcription factor 21                            160   8e-43   
gb|KDO40261.1|  hypothetical protein CISIN_1g026950mg                   160   9e-43   
ref|XP_006464513.1|  PREDICTED: probable WRKY transcription facto...    160   9e-43   
gb|ACU14983.1|  unknown                                                 160   1e-42   Glycine max [soybeans]
ref|XP_007048165.1|  WRKY DNA-binding protein 13                        159   2e-42   
ref|XP_002279024.1|  PREDICTED: probable WRKY transcription facto...    159   2e-42   Vitis vinifera
ref|XP_006464514.1|  PREDICTED: probable WRKY transcription facto...    158   2e-42   
ref|XP_010261027.1|  PREDICTED: probable WRKY transcription facto...    158   3e-42   
ref|XP_011100913.1|  PREDICTED: probable WRKY transcription facto...    158   3e-42   
ref|XP_011021959.1|  PREDICTED: probable WRKY transcription facto...    159   3e-42   
ref|XP_011025576.1|  PREDICTED: probable WRKY transcription facto...    158   4e-42   
ref|XP_010915067.1|  PREDICTED: probable WRKY transcription facto...    157   1e-41   
ref|XP_010927976.1|  PREDICTED: probable WRKY transcription facto...    157   1e-41   
ref|XP_006645572.1|  PREDICTED: probable WRKY transcription facto...    156   2e-41   
emb|CAN69500.1|  hypothetical protein VITISV_014490                     152   2e-41   Vitis vinifera
ref|XP_010925080.1|  PREDICTED: probable WRKY transcription facto...    156   3e-41   
ref|XP_004237476.1|  PREDICTED: probable WRKY transcription facto...    155   5e-41   
ref|XP_009630231.1|  PREDICTED: probable WRKY transcription facto...    155   5e-41   
ref|XP_010027754.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...    156   6e-41   
ref|XP_009782635.1|  PREDICTED: probable WRKY transcription facto...    155   6e-41   
ref|XP_008808698.1|  PREDICTED: probable WRKY transcription facto...    155   6e-41   
ref|XP_004288129.1|  PREDICTED: probable WRKY transcription facto...    155   6e-41   
ref|XP_010086912.1|  putative WRKY transcription factor 13              156   7e-41   
ref|XP_009354059.1|  PREDICTED: probable WRKY transcription facto...    155   1e-40   
ref|XP_008232356.1|  PREDICTED: probable WRKY transcription facto...    154   2e-40   
ref|XP_008392017.1|  PREDICTED: probable WRKY transcription facto...    156   2e-40   
ref|XP_008794985.1|  PREDICTED: probable WRKY transcription facto...    155   2e-40   
ref|XP_002455053.1|  hypothetical protein SORBIDRAFT_03g003640          155   2e-40   Sorghum bicolor [broomcorn]
ref|XP_009354053.1|  PREDICTED: probable WRKY transcription facto...    156   2e-40   
gb|KHN34020.1|  Putative WRKY transcription factor 13                   153   3e-40   
ref|XP_007208202.1|  hypothetical protein PRUPE_ppa020629mg             153   3e-40   
ref|XP_004148455.1|  PREDICTED: probable WRKY transcription facto...    154   4e-40   
ref|XP_008365254.1|  PREDICTED: probable WRKY transcription facto...    154   4e-40   
gb|ADU52530.1|  WRKY protein                                            153   4e-40   
ref|XP_008457912.1|  PREDICTED: probable WRKY transcription facto...    154   4e-40   
ref|XP_008440122.1|  PREDICTED: probable WRKY transcription facto...    152   6e-40   
gb|AHC54607.1|  WRKY2                                                   151   7e-40   
ref|XP_007137585.1|  hypothetical protein PHAVU_009G138600g             152   1e-39   
gb|AIE43900.1|  WRKY transcription factor 116                           151   2e-39   
dbj|BAG98515.1|  unnamed protein product                                152   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139655.1|  hypothetical protein PHAVU_008G0481000g            149   2e-39   
ref|NP_001267570.1|  probable WRKY transcription factor 13-like         149   2e-39   
dbj|BAD67781.1|  putative WRKY DNA-binding protein                      152   2e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KCW54344.1|  hypothetical protein EUGRSUZ_I00305                     152   4e-39   
ref|XP_010555312.1|  PREDICTED: probable WRKY transcription facto...    151   5e-39   
ref|NP_195651.1|  putative WRKY transcription factor 13                 152   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KGN48415.1|  hypothetical protein Csa_6G486880                       150   7e-39   
gb|AJA32895.1|  WRKY transcription factor                               151   7e-39   
gb|AIE43897.1|  WRKY transcription factor 45                            147   7e-39   
emb|CDX72701.1|  BnaC07g47230D                                          151   7e-39   
gb|AAQ20912.1|  WRKY12                                                  154   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042221.1|  Os01g0182700                                       154   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003602502.1|  WRKY transcription factor                          149   1e-38   
ref|XP_007159778.1|  hypothetical protein PHAVU_002G266400g             149   1e-38   
ref|XP_003565434.1|  PREDICTED: probable WRKY transcription facto...    150   1e-38   
ref|XP_006411744.1|  hypothetical protein EUTSA_v10025869mg             150   2e-38   
ref|NP_001132878.1|  putative WRKY DNA-binding domain superfamily...    150   2e-38   Zea mays [maize]
ref|XP_009121710.1|  PREDICTED: probable WRKY transcription facto...    150   2e-38   
ref|XP_003602503.1|  WRKY transcription factor                          148   2e-38   
ref|NP_001288884.1|  probable WRKY transcription factor 13              150   3e-38   
ref|XP_006842206.1|  hypothetical protein AMTR_s00078p00171140          147   3e-38   
ref|XP_003523252.2|  PREDICTED: probable WRKY transcription facto...    147   4e-38   
ref|XP_002868904.1|  hypothetical protein ARALYDRAFT_490719             149   4e-38   
gb|KHN09559.1|  Putative WRKY transcription factor 13                   147   6e-38   
gb|ABS18441.1|  WRKY45                                                  144   6e-38   Glycine max [soybeans]
ref|XP_010431912.1|  PREDICTED: probable WRKY transcription facto...    149   7e-38   
ref|XP_003526838.2|  PREDICTED: probable WRKY transcription facto...    147   7e-38   
ref|XP_004502877.1|  PREDICTED: probable WRKY transcription facto...    147   7e-38   
ref|XP_010446487.1|  PREDICTED: probable WRKY transcription facto...    149   9e-38   
ref|XP_006284053.1|  hypothetical protein CARUB_v10005178mg             149   1e-37   
ref|XP_009101879.1|  PREDICTED: probable WRKY transcription facto...    149   1e-37   
ref|XP_010437064.1|  PREDICTED: probable WRKY transcription facto...    148   1e-37   
ref|XP_004968441.1|  PREDICTED: probable WRKY transcription facto...    147   2e-37   
gb|AFK48890.1|  unknown                                                 145   2e-37   
ref|XP_003630131.1|  WRKY transcription factor                          145   3e-37   
gb|AET04607.2|  WRKY family transcription factor                        145   4e-37   
gb|EMT33035.1|  Putative WRKY transcription factor 13                   142   4e-37   
ref|XP_009381151.1|  PREDICTED: probable WRKY transcription facto...    139   2e-36   
ref|XP_009409340.1|  PREDICTED: probable WRKY transcription facto...    142   4e-36   
emb|CDY72079.1|  BnaAnng39820D                                          138   5e-36   
ref|XP_002526469.1|  transcription factor, putative                     140   6e-36   Ricinus communis
ref|XP_006578817.1|  PREDICTED: probable WRKY transcription facto...    141   1e-35   
gb|AIE43905.1|  WRKY transcription factor 66                            139   2e-35   
ref|XP_004504001.1|  PREDICTED: probable WRKY transcription facto...    139   5e-35   
ref|XP_009109469.1|  PREDICTED: probable WRKY transcription facto...    140   7e-35   
gb|AJA32877.1|  WRKY transcription factor                               140   1e-34   
emb|CDY12144.1|  BnaC03g60600D                                          140   1e-34   
ref|XP_009399778.1|  PREDICTED: probable WRKY transcription facto...    137   3e-34   
gb|EPS59077.1|  hypothetical protein M569_15732                         132   5e-34   
gb|KFK30520.1|  hypothetical protein AALP_AA7G273300                    138   7e-34   
ref|XP_009341120.1|  PREDICTED: probable WRKY transcription facto...    135   2e-33   
ref|XP_008344897.1|  PREDICTED: probable WRKY transcription facto...    132   4e-33   
gb|ABI13380.1|  WRKY transcription factor 14                            129   7e-33   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008354007.1|  PREDICTED: probable WRKY transcription facto...    133   7e-33   
gb|AGV75958.1|  WRKY transcription factor 60                            130   2e-32   
ref|XP_009338781.1|  PREDICTED: probable WRKY transcription facto...    132   2e-32   
gb|KHG04292.1|  putative WRKY transcription factor 24 -like protein     130   5e-32   
ref|XP_008375934.1|  PREDICTED: probable WRKY transcription facto...    129   6e-32   
gb|AFH02532.1|  WRKY transcription factor                               129   6e-32   
gb|AIE43816.1|  WRKY transcription factor 2                             129   6e-32   
ref|XP_004979296.1|  PREDICTED: probable WRKY transcription facto...    130   7e-32   
ref|XP_001752717.1|  transcription factor WRKY20                        126   7e-32   
ref|XP_007219783.1|  hypothetical protein PRUPE_ppa024540mg             129   8e-32   
gb|KHG15425.1|  putative WRKY transcription factor 75 -like protein     128   1e-31   
gb|AIE43870.1|  WRKY transcription factor 49                            129   1e-31   
ref|XP_008233664.1|  PREDICTED: probable WRKY transcription facto...    130   1e-31   
gb|AGV75929.1|  WRKY transcription factor 3                             128   1e-31   
gb|EMS53211.1|  putative WRKY transcription factor 24                   130   1e-31   
gb|AIE43890.1|  WRKY transcription factor 15                            128   1e-31   
ref|XP_002320160.2|  hypothetical protein POPTR_0014s08640g             129   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006646294.1|  PREDICTED: probable WRKY transcription facto...    130   1e-31   
gb|KHN18821.1|  Putative WRKY transcription factor 56                   126   1e-31   
ref|XP_008232972.1|  PREDICTED: probable WRKY transcription facto...    129   2e-31   
ref|XP_007219115.1|  hypothetical protein PRUPE_ppa015755mg             129   2e-31   
ref|XP_010917544.1|  PREDICTED: probable WRKY transcription facto...    128   2e-31   
ref|XP_002275528.3|  PREDICTED: probable WRKY transcription facto...    129   2e-31   Vitis vinifera
ref|XP_009372253.1|  PREDICTED: probable WRKY transcription facto...    128   2e-31   
emb|CAN73363.1|  hypothetical protein VITISV_006168                     127   2e-31   Vitis vinifera
ref|XP_011037139.1|  PREDICTED: probable WRKY transcription facto...    128   3e-31   
gb|AHJ78583.1|  WRKY75                                                  127   3e-31   
ref|XP_007226197.1|  hypothetical protein PRUPE_ppa016153mg             127   4e-31   
ref|XP_003548440.1|  PREDICTED: probable WRKY transcription facto...    127   4e-31   
ref|XP_002984180.1|  hypothetical protein SELMODRAFT_18136              124   4e-31   
gb|AGV75932.1|  WRKY transcription factor 8                             127   4e-31   
ref|XP_008222197.1|  PREDICTED: probable WRKY transcription facto...    127   4e-31   
ref|XP_010066855.1|  PREDICTED: probable WRKY transcription facto...    130   5e-31   
emb|CDP00413.1|  unnamed protein product                                130   5e-31   
ref|XP_008657250.1|  PREDICTED: probable WRKY transcription facto...    128   5e-31   
ref|XP_002972266.1|  hypothetical protein SELMODRAFT_29247              124   5e-31   
ref|XP_004306730.1|  PREDICTED: probable WRKY transcription facto...    128   6e-31   
ref|NP_001044163.1|  Os01g0734000                                       129   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386115.1|  PREDICTED: probable WRKY transcription facto...    125   6e-31   
ref|XP_011036106.1|  PREDICTED: probable WRKY transcription facto...    126   7e-31   
ref|XP_004310100.1|  PREDICTED: probable WRKY transcription facto...    126   9e-31   
gb|ACH88751.1|  WRKY DNA binding protein                                126   9e-31   Fragaria x ananassa
ref|XP_007135144.1|  hypothetical protein PHAVU_010G104700g             127   9e-31   
ref|XP_004969857.1|  PREDICTED: probable WRKY transcription facto...    128   1e-30   
emb|CDP12079.1|  unnamed protein product                                126   1e-30   
ref|XP_008792410.1|  PREDICTED: probable WRKY transcription facto...    127   1e-30   
dbj|BAJ86072.1|  predicted protein                                      127   1e-30   
ref|XP_010921433.1|  PREDICTED: probable WRKY transcription facto...    129   1e-30   
gb|ABI13378.1|  WRKY transcription factor 12                            126   1e-30   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008678126.1|  PREDICTED: probable WRKY transcription facto...    127   1e-30   
gb|EMT13814.1|  Putative WRKY transcription factor 24                   124   1e-30   
gb|AGQ04209.1|  WRKY transcription factor 21                            126   1e-30   
ref|XP_009343134.1|  PREDICTED: probable WRKY transcription facto...    126   1e-30   
ref|XP_010558453.1|  PREDICTED: probable WRKY transcription facto...    130   2e-30   
ref|XP_006444939.1|  hypothetical protein CICLE_v10024257mg             125   2e-30   
ref|XP_009764262.1|  PREDICTED: probable WRKY transcription facto...    127   2e-30   
gb|KDO86326.1|  hypothetical protein CISIN_1g046286mg                   125   2e-30   
ref|XP_011020795.1|  PREDICTED: probable WRKY transcription facto...    124   2e-30   
gb|AFW82547.1|  putative WRKY DNA-binding domain superfamily protein    126   2e-30   
ref|NP_001148624.1|  WRKY23 - superfamily of TFs having WRKY and ...    126   2e-30   Zea mays [maize]
ref|XP_002304741.2|  hypothetical protein POPTR_0003s16750g             124   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006658215.1|  PREDICTED: probable WRKY transcription facto...    127   3e-30   
ref|XP_006302661.1|  hypothetical protein CARUB_v10020765mg             127   3e-30   
ref|XP_010112967.1|  putative WRKY transcription factor 56              125   3e-30   
ref|XP_008389898.1|  PREDICTED: probable WRKY transcription facto...    125   3e-30   
ref|XP_002456305.1|  hypothetical protein SORBIDRAFT_03g033780          126   4e-30   Sorghum bicolor [broomcorn]
ref|XP_010261390.1|  PREDICTED: probable WRKY transcription facto...    125   4e-30   
ref|XP_010249071.1|  PREDICTED: probable WRKY transcription facto...    124   4e-30   
ref|XP_010442347.1|  PREDICTED: probable WRKY transcription facto...    123   4e-30   
ref|XP_008439387.1|  PREDICTED: probable WRKY transcription facto...    128   4e-30   
ref|XP_009598201.1|  PREDICTED: probable WRKY transcription facto...    126   4e-30   
tpg|DAA05095.1|  TPA: WRKY transcription factor 30                      126   4e-30   
ref|XP_006284960.1|  hypothetical protein CARUB_v10006263mg             124   4e-30   
ref|XP_010511955.1|  PREDICTED: probable WRKY transcription facto...    127   4e-30   
ref|XP_008809548.1|  PREDICTED: probable WRKY transcription facto...    124   4e-30   
ref|XP_010910323.1|  PREDICTED: probable WRKY transcription facto...    122   5e-30   
ref|XP_004151189.1|  PREDICTED: probable WRKY transcription facto...    127   5e-30   
gb|ADL36856.1|  WRKY domain class transcription factor                  123   5e-30   
ref|XP_006437986.1|  hypothetical protein CICLE_v10032816mg             124   5e-30   
ref|XP_011099003.1|  PREDICTED: probable WRKY transcription facto...    124   5e-30   
ref|XP_006338711.1|  PREDICTED: probable WRKY transcription facto...    122   6e-30   
ref|XP_009105473.1|  PREDICTED: probable WRKY transcription facto...    127   6e-30   
ref|XP_010415567.1|  PREDICTED: probable WRKY transcription facto...    127   6e-30   
ref|XP_003534536.1|  PREDICTED: probable WRKY transcription facto...    124   7e-30   
ref|XP_010112390.1|  putative WRKY transcription factor 75              124   7e-30   
ref|XP_003624078.1|  WRKY transcription factor                          125   7e-30   
ref|XP_003552423.1|  PREDICTED: probable WRKY transcription facto...    124   8e-30   
ref|XP_002880217.1|  WRKY DNA-binding protein 43                        121   8e-30   
gb|ABI13379.1|  WRKY transcription factor 13                            121   8e-30   
emb|CBY88801.1|  WRKY transcription factor                              122   8e-30   
ref|XP_007157586.1|  hypothetical protein PHAVU_002G081600g             126   8e-30   
gb|ABS18452.1|  WRKY64                                                  124   9e-30   
gb|AEO31472.1|  WRKY transcription factor 23-1                          124   9e-30   
gb|KHN29308.1|  Putative WRKY transcription factor 24                   124   9e-30   
gb|KDO81831.1|  hypothetical protein CISIN_1g043122mg                   121   9e-30   
ref|XP_010470908.1|  PREDICTED: probable WRKY transcription facto...    126   1e-29   
ref|XP_010247293.1|  PREDICTED: probable WRKY transcription facto...    124   1e-29   
ref|NP_001288843.1|  probable WRKY transcription factor 57              126   1e-29   
ref|XP_002888714.1|  hypothetical protein ARALYDRAFT_476056             126   1e-29   
ref|XP_009410870.1|  PREDICTED: probable WRKY transcription facto...    123   1e-29   
gb|ABN43184.1|  WRKY transcription factor                               124   1e-29   
emb|CDX70492.1|  BnaC03g05760D                                          122   1e-29   
ref|XP_007051697.1|  WRKY DNA-binding protein 56                        124   1e-29   
ref|XP_008361852.1|  PREDICTED: probable WRKY transcription facto...    123   1e-29   
gb|KGN57179.1|  hypothetical protein Csa_3G168410                       126   1e-29   
ref|NP_001067928.1|  Os11g0490900                                       124   2e-29   
tpg|DAA05137.1|  TPA: WRKY transcription factor 72                      124   2e-29   
gb|KFK37652.1|  hypothetical protein AALP_AA3G010900                    122   2e-29   
ref|NP_001237777.1|  WRKY32 protein                                     126   2e-29   
ref|XP_010090653.1|  putative WRKY transcription factor 75              123   2e-29   
ref|XP_009415894.1|  PREDICTED: probable WRKY transcription facto...    122   2e-29   
ref|XP_008649897.1|  PREDICTED: probable WRKY transcription facto...    124   2e-29   
ref|XP_006573139.1|  PREDICTED: probable WRKY transcription facto...    125   2e-29   
gb|AGQ04205.1|  WRKY transcription factor 17                            124   2e-29   
ref|XP_006574933.1|  PREDICTED: probable WRKY transcription facto...    125   2e-29   
gb|ACV92021.1|  WRKY transcription factor 19                            123   2e-29   
ref|XP_006662941.1|  PREDICTED: probable WRKY transcription facto...    124   2e-29   
gb|EPS62848.1|  hypothetical protein M569_11942                         120   2e-29   
ref|XP_002961159.1|  hypothetical protein SELMODRAFT_69431              119   2e-29   
ref|XP_003533140.1|  PREDICTED: probable WRKY transcription facto...    126   2e-29   
ref|XP_003566009.1|  PREDICTED: probable WRKY transcription facto...    124   2e-29   
ref|XP_009131315.1|  PREDICTED: probable WRKY transcription facto...    121   2e-29   
ref|XP_009405753.1|  PREDICTED: probable WRKY transcription facto...    120   2e-29   
gb|ABK25866.1|  unknown                                                 126   2e-29   
ref|XP_002274549.1|  PREDICTED: probable WRKY transcription facto...    125   3e-29   
gb|AGV75962.1|  WRKY transcription factor 66                            122   3e-29   
ref|XP_008340588.1|  PREDICTED: probable WRKY transcription facto...    126   3e-29   
ref|XP_008670731.1|  PREDICTED: probable WRKY transcription facto...    123   3e-29   
ref|XP_004492805.1|  PREDICTED: probable WRKY transcription facto...    123   3e-29   
ref|XP_008775118.1|  PREDICTED: probable WRKY transcription facto...    122   3e-29   
emb|CBI27268.3|  unnamed protein product                                125   3e-29   
gb|EMS56652.1|  putative WRKY transcription factor 56                   122   3e-29   
ref|XP_010913024.1|  PREDICTED: probable WRKY transcription facto...    122   3e-29   
ref|XP_001773725.1|  transcription factor WRKY22                        119   3e-29   
ref|XP_002441423.1|  hypothetical protein SORBIDRAFT_09g026350          124   3e-29   
ref|XP_009127720.1|  PREDICTED: probable WRKY transcription facto...    125   4e-29   
emb|CDY44466.1|  BnaCnng11190D                                          122   4e-29   
ref|NP_177090.1|  putative WRKY transcription factor 57                 124   4e-29   
emb|CDY40910.1|  BnaC06g30480D                                          125   4e-29   
ref|NP_182136.2|  WRKY DNA-binding protein 43                           119   4e-29   
gb|AHB33831.1|  WRKY transcription factor 24                            121   4e-29   
ref|XP_010055075.1|  PREDICTED: probable WRKY transcription facto...    122   4e-29   
ref|NP_001237527.1|  transcription factor                               124   4e-29   
ref|XP_004961423.1|  PREDICTED: probable WRKY transcription facto...    123   4e-29   
ref|XP_009408611.1|  PREDICTED: probable WRKY transcription facto...    124   5e-29   
ref|XP_003567084.1|  PREDICTED: probable WRKY transcription facto...    122   5e-29   
ref|NP_001268218.1|  WRKY-type DNA binding protein 1                    120   5e-29   
ref|XP_010926844.1|  PREDICTED: probable WRKY transcription facto...    120   5e-29   
ref|XP_008221525.1|  PREDICTED: probable WRKY transcription facto...    125   5e-29   
ref|XP_002301377.2|  hypothetical protein POPTR_0002s16640g             122   6e-29   
ref|XP_009610329.1|  PREDICTED: probable WRKY transcription facto...    124   6e-29   
ref|XP_008657109.1|  PREDICTED: probable WRKY transcription facto...    127   6e-29   
ref|XP_009353824.1|  PREDICTED: probable WRKY transcription facto...    125   6e-29   
ref|XP_010250654.1|  PREDICTED: probable WRKY transcription facto...    121   6e-29   
ref|XP_006343925.1|  PREDICTED: probable WRKY transcription facto...    122   6e-29   
ref|XP_002449513.1|  hypothetical protein SORBIDRAFT_05g017130          122   6e-29   
gb|EYU45423.1|  hypothetical protein MIMGU_mgv1a021286mg                119   7e-29   
gb|AFW78788.1|  putative WRKY DNA-binding domain superfamily protein    124   7e-29   
ref|XP_004295061.1|  PREDICTED: probable WRKY transcription facto...    125   7e-29   
ref|XP_003528613.1|  PREDICTED: probable WRKY transcription facto...    125   8e-29   
ref|NP_001058737.1|  Os07g0111400                                       124   8e-29   
ref|NP_001275604.1|  probable WRKY transcription factor 75-like         120   8e-29   
emb|CDY39732.1|  BnaA04g11210D                                          120   8e-29   
gb|AFK47497.1|  unknown                                                 122   8e-29   
gb|ACN89258.1|  WRKY transcription factor 24                            120   8e-29   
ref|XP_009140098.1|  PREDICTED: probable WRKY transcription facto...    120   8e-29   
tpg|DAA05094.1|  TPA: WRKY transcription factor 29                      124   9e-29   
ref|XP_009775814.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
gb|AIY62466.1|  WRKY29                                                  124   1e-28   
ref|XP_004233585.1|  PREDICTED: probable WRKY transcription facto...    119   1e-28   
ref|XP_006300107.1|  hypothetical protein CARUB_v10016335mg             119   1e-28   
ref|XP_009615508.1|  PREDICTED: probable WRKY transcription facto...    120   1e-28   
ref|XP_010439878.1|  PREDICTED: probable WRKY transcription facto...    119   1e-28   
gb|ABS18428.1|  WRKY26                                                  119   1e-28   
emb|CDY50313.1|  BnaA02g14710D                                          124   1e-28   
ref|XP_009386192.1|  PREDICTED: probable WRKY transcription facto...    119   1e-28   
gb|ABS18445.1|  WRKY49                                                  121   1e-28   
gb|ABI64131.1|  WRKY transcription factor 4                             120   1e-28   
ref|XP_003550853.1|  PREDICTED: probable WRKY transcription facto...    125   1e-28   
gb|AFW84719.1|  putative WRKY DNA-binding domain superfamily protein    127   1e-28   
ref|XP_008672689.1|  PREDICTED: uncharacterized protein LOC100279...    126   1e-28   
gb|ACD80363.1|  WRKY27 transcription factor                             126   1e-28   
emb|CAA88326.1|  DNA-binding protein                                    125   1e-28   
gb|ABI13408.1|  WRKY transcription factor 43                            120   1e-28   
ref|XP_008650015.1|  PREDICTED: uncharacterized protein LOC103630738    125   1e-28   
ref|XP_007223039.1|  hypothetical protein PRUPE_ppa006909mg             124   2e-28   
ref|XP_001759072.1|  transcription factor WRKY29                        117   2e-28   
ref|XP_007043929.1|  WRKY DNA-binding protein 75                        120   2e-28   
ref|XP_011023269.1|  PREDICTED: probable WRKY transcription facto...    120   2e-28   
ref|XP_002458273.1|  hypothetical protein SORBIDRAFT_03g030480          125   2e-28   
gb|KHN03277.1|  Putative WRKY transcription factor 23                   124   2e-28   
ref|XP_002456565.1|  hypothetical protein SORBIDRAFT_03g038510          126   2e-28   
ref|NP_001148212.1|  WRKY23 - superfamily of TFs having WRKY and ...    121   2e-28   
ref|XP_008776994.1|  PREDICTED: probable WRKY transcription facto...    122   2e-28   
ref|XP_008223383.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   
emb|CDY55479.1|  BnaCnng28950D                                          120   2e-28   
ref|XP_009387896.1|  PREDICTED: probable WRKY transcription facto...    119   2e-28   
ref|XP_004245563.1|  PREDICTED: probable WRKY transcription facto...    121   2e-28   
gb|KCW78117.1|  hypothetical protein EUGRSUZ_D02326                     118   2e-28   
ref|XP_009372109.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   
ref|XP_006419357.1|  hypothetical protein CICLE_v10005203mg             124   2e-28   
ref|XP_006488824.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   
gb|ABN43179.1|  WRKY transcription factor                               120   2e-28   
ref|XP_008389416.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
ref|XP_004152302.1|  PREDICTED: probable WRKY transcription facto...    119   2e-28   
gb|AJA32901.1|  WRKY transcription factor                               120   2e-28   
emb|CDY34393.1|  BnaA09g11350D                                          120   2e-28   
ref|XP_008776993.1|  PREDICTED: probable WRKY transcription facto...    122   2e-28   
ref|XP_009356380.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
emb|CDP16710.1|  unnamed protein product                                120   2e-28   
ref|XP_010680728.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
ref|XP_008231192.1|  PREDICTED: probable WRKY transcription facto...    120   2e-28   
ref|NP_001281064.1|  probable WRKY transcription factor 48              124   2e-28   
gb|ABI64133.1|  WRKY transcription factor 6                             117   2e-28   
ref|NP_001145794.1|  uncharacterized protein LOC100279301               125   3e-28   
gb|AIE43866.1|  WRKY transcription factor 32                            123   3e-28   
ref|XP_006600381.1|  PREDICTED: probable WRKY transcription facto...    124   3e-28   
ref|XP_009112904.1|  PREDICTED: probable WRKY transcription facto...    119   3e-28   
ref|XP_007154400.1|  hypothetical protein PHAVU_003G116300g             124   3e-28   
gb|AAK96199.1|AF404861_1  WRKY transcription factor 43 splice var...    117   3e-28   
ref|XP_002512107.1|  hypothetical protein RCOM_1621230                  122   3e-28   
ref|XP_010524740.1|  PREDICTED: probable WRKY transcription facto...    124   3e-28   
gb|KDO42286.1|  hypothetical protein CISIN_1g011483mg                   121   3e-28   
gb|KDO83099.1|  hypothetical protein CISIN_1g045509mg                   122   3e-28   
ref|XP_004297258.1|  PREDICTED: probable WRKY transcription facto...    123   3e-28   
ref|XP_006438805.1|  hypothetical protein CICLE_v10032285mg             122   3e-28   
ref|XP_011019663.1|  PREDICTED: probable WRKY transcription facto...    122   3e-28   
ref|XP_006405331.1|  hypothetical protein EUTSA_v10028213mg             119   3e-28   
ref|XP_007216937.1|  hypothetical protein PRUPE_ppa016459mg             120   3e-28   
gb|ACV92013.1|  WRKY transcription factor 11                            119   3e-28   
ref|XP_002275576.1|  PREDICTED: probable WRKY transcription facto...    119   3e-28   
ref|XP_004239067.1|  PREDICTED: probable WRKY transcription facto...    122   4e-28   
ref|XP_006354313.1|  PREDICTED: probable WRKY transcription facto...    123   4e-28   
ref|XP_004239240.1|  PREDICTED: probable WRKY transcription facto...    119   4e-28   
ref|XP_007222613.1|  hypothetical protein PRUPE_ppa008480mg             122   4e-28   
ref|XP_002312318.2|  hypothetical protein POPTR_0008s10280g             123   4e-28   
ref|XP_011018247.1|  PREDICTED: probable WRKY transcription facto...    122   4e-28   
gb|AAD32677.1|AF140554_1  DNA-binding protein WRKY1                     124   4e-28   
ref|XP_010053764.1|  PREDICTED: probable WRKY transcription facto...    120   4e-28   
emb|CDY25554.1|  BnaC09g11790D                                          119   4e-28   
ref|XP_001775934.1|  transcription factor WRKY31                        115   4e-28   
ref|XP_003577566.1|  PREDICTED: probable WRKY transcription facto...    119   4e-28   
ref|XP_008450119.1|  PREDICTED: probable WRKY transcription facto...    118   4e-28   
ref|XP_011019638.1|  PREDICTED: probable WRKY transcription facto...    123   4e-28   
ref|XP_009394209.1|  PREDICTED: probable WRKY transcription facto...    122   4e-28   
ref|XP_011013412.1|  PREDICTED: probable WRKY transcription facto...    124   4e-28   
ref|XP_011013413.1|  PREDICTED: probable WRKY transcription facto...    124   4e-28   
ref|XP_001773154.1|  transcription factor WRKY18                        115   4e-28   
gb|AAW66459.1|  WRKY transcription factor-b                             118   5e-28   
ref|XP_002311329.2|  hypothetical protein POPTR_0008s09360g             122   5e-28   
gb|ACV92035.1|  WRKY transcription factor 33                            121   5e-28   
ref|XP_004490148.1|  PREDICTED: probable WRKY transcription facto...    121   5e-28   
ref|XP_009147391.1|  PREDICTED: probable WRKY transcription facto...    124   5e-28   
gb|AJA32875.1|  WRKY transcription factor                               124   5e-28   
ref|XP_011081140.1|  PREDICTED: probable WRKY transcription facto...    119   5e-28   
ref|XP_004957145.1|  PREDICTED: probable WRKY transcription facto...    125   5e-28   
ref|XP_007031915.1|  WRKY DNA-binding protein 75                        119   5e-28   
gb|AJA32902.1|  WRKY transcription factor                               123   5e-28   
ref|XP_011012232.1|  PREDICTED: probable WRKY transcription facto...    121   5e-28   
ref|XP_010682719.1|  PREDICTED: probable WRKY transcription facto...    120   5e-28   
ref|XP_003615949.1|  WRKY transcription factor                          125   5e-28   
ref|XP_002514888.1|  WRKY transcription factor, putative                119   5e-28   
gb|AJA32900.1|  WRKY transcription factor                               119   5e-28   
dbj|BAF41990.1|  transcription factor WRKY-1                            119   5e-28   
ref|XP_011042283.1|  PREDICTED: probable WRKY transcription facto...    120   6e-28   
gb|ADK74338.1|  WRKY transcription factor IIc family protein            118   6e-28   
ref|XP_011035813.1|  PREDICTED: probable WRKY transcription factor 3    124   6e-28   
gb|AIY62486.1|  WRKY117                                                 122   6e-28   
ref|XP_008454014.1|  PREDICTED: probable WRKY transcription facto...    119   6e-28   
gb|AIE43871.1|  WRKY transcription factor 74                            122   6e-28   
gb|AGQ04206.1|  WRKY transcription factor 18                            119   6e-28   
ref|XP_011071242.1|  PREDICTED: probable WRKY transcription facto...    118   6e-28   
gb|ABS18451.1|  WRKY62                                                  121   6e-28   
ref|XP_002279385.1|  PREDICTED: probable WRKY transcription facto...    121   7e-28   
ref|XP_003547354.2|  PREDICTED: probable WRKY transcription facto...    122   7e-28   
gb|ADU52533.1|  WRKY protein                                            118   7e-28   
ref|XP_004148012.1|  PREDICTED: probable WRKY transcription facto...    118   7e-28   
gb|AGQ04211.1|  WRKY transcription factor 23                            122   7e-28   
ref|XP_002316097.2|  hypothetical protein POPTR_0010s16760g             121   7e-28   
gb|ABS18436.1|  WRKY39                                                  122   7e-28   
emb|CDP13366.1|  unnamed protein product                                118   7e-28   
ref|XP_009767666.1|  PREDICTED: probable WRKY transcription facto...    118   7e-28   
ref|XP_009387399.1|  PREDICTED: probable WRKY transcription facto...    122   7e-28   
gb|AIE43904.1|  WRKY transcription factor 94                            117   7e-28   
gb|KGN53043.1|  hypothetical protein Csa_4G012390                       119   7e-28   
ref|XP_006348711.1|  PREDICTED: probable WRKY transcription facto...    122   7e-28   
ref|XP_009407400.1|  PREDICTED: probable WRKY transcription facto...    121   7e-28   
gb|AIE43901.1|  WRKY transcription factor 67                            121   8e-28   
ref|XP_009766292.1|  PREDICTED: probable WRKY transcription facto...    121   8e-28   
ref|XP_002301524.2|  WRKY transcription factor 48 family protein        121   8e-28   
emb|CDY54139.1|  BnaCnng26190D                                          121   8e-28   
gb|ABK41486.1|  WRKY transcription factor                               121   8e-28   
emb|CAN66011.1|  hypothetical protein VITISV_024280                     116   8e-28   
ref|XP_001769472.1|  transcription factor WRKY17                        115   8e-28   



>ref|XP_007052352.1| WRKY family transcription factor [Theobroma cacao]
 gb|EOX96509.1| WRKY family transcription factor [Theobroma cacao]
Length=207

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 176/242 (73%), Gaps = 41/242 (17%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVSFSTP   H             EMGFVQFE+ NQAVMSFL P          
Sbjct  7    VPNYELQVSFSTPQAIH-------------EMGFVQFEE-NQAVMSFLAP----------  42

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
              + S+   +      ++ + +  + ++GFSH             NDQVGT+DPK  NDE
Sbjct  43   --AQSSHQISQPVNTAASISNSTNSTAMGFSH-------------NDQVGTLDPKAVNDE  87

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+ NA +GNNSWWRSS+S  +K KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  88   NCASNANDGNNSWWRSSAS--EKSKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  145

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CFT
Sbjct  146  VVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFT  205

Query  901  SF  906
            SF
Sbjct  206  SF  207



>ref|XP_009595924.1| PREDICTED: probable WRKY transcription factor 12 [Nicotiana tomentosiformis]
Length=242

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 190/249 (76%), Gaps = 22/249 (9%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpl--  354
            L NY LQVSFS P    ++ H         ++GFV F DHNQ +MSFL P SS SQ    
Sbjct  9    LNNYDLQVSFSAPPSHANNIH---------DLGFVHFADHNQ-MMSFLAPPSSHSQLSSQ  58

Query  355  -----dgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMD  519
                   +++ +    TT   A   + +   +++LGF+H+E  L NRPSWNNN QV T+D
Sbjct  59   LPQPLQAAATTTVTPPTTTTNATVAAASNNISSALGFNHNE--LVNRPSWNNN-QVETLD  115

Query  520  PKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYK  699
            PK  NDENCSGNA+EGNNSWW++SSS  DKGKVK+RRKLREPRFCFQTRSD+DVLDDGYK
Sbjct  116  PKIVNDENCSGNASEGNNSWWKNSSS--DKGKVKIRRKLREPRFCFQTRSDIDVLDDGYK  173

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNS  879
            WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSP DDSNS
Sbjct  174  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPSDDSNS  233

Query  880  SEHDCFTSF  906
            SEHDCFTSF
Sbjct  234  SEHDCFTSF  242



>ref|XP_009604138.1| PREDICTED: probable WRKY transcription factor 12 [Nicotiana tomentosiformis]
Length=237

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 183/242 (76%), Gaps = 19/242 (8%)
 Frame = +1

Query  187  NYGLQVS-FSTphhphhhhhhhphaamhhEMGFVQ-FEDHNQAVMSFLTPLssssqpldg  360
            NY LQVS FSTPH   H            EMGFV  FEDH   VMSFLT   S S  +  
Sbjct  13   NYDLQVSTFSTPHVNIH------------EMGFVHHFEDHQNQVMSFLTSPLSHSSQIPD  60

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
             ++ ++AA  TA      +     ++SLGF HSE  L NR SWNN DQV T+DPK   D+
Sbjct  61   GAASTSAAPPTATCTTLAAGTNNGSSSLGFYHSE--LVNRSSWNN-DQVETLDPKAIIDQ  117

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NCSGNA++GNNSWWRSS S  +KGKVKVRRKLREPRFCFQTRSD+DVLDDGYKWRKYGQK
Sbjct  118  NCSGNASDGNNSWWRSSPS--EKGKVKVRRKLREPRFCFQTRSDIDVLDDGYKWRKYGQK  175

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH PCDDSNSSE+DCF+
Sbjct  176  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHYPCDDSNSSENDCFS  235

Query  901  SF  906
            SF
Sbjct  236  SF  237



>emb|CDP09423.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 178/243 (73%), Gaps = 24/243 (10%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgs  363
            PNY L  SFS PH                EMGFVQFEDH+Q V+SFL P S SS     +
Sbjct  14   PNYELPPSFSAPHPIP-------------EMGFVQFEDHHQ-VLSFLAPSSQSSHISSQT  59

Query  364  sscsnaasttaaaakstsnaaaatasLGFSHSE-PQLSNRPSWNNNDQVGTMDPKGANDE  540
                   + T ++  S  N +      GF H+E    S RPSWNN DQVG+++PK   D+
Sbjct  60   LHGGGENNHTNSSTTSNHNGS-----FGFRHNELVATSTRPSWNN-DQVGSLNPKAVGDQ  113

Query  541  NC-SGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  717
            NC + NA EG NSWWRSS+S  +KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ
Sbjct  114  NCGTNNANEGTNSWWRSSAS--EKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  171

Query  718  KVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCF  897
            KVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CF
Sbjct  172  KVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECF  231

Query  898  TSF  906
            TSF
Sbjct  232  TSF  234



>ref|XP_003529027.1| PREDICTED: probable WRKY transcription factor 12-like [Glycine 
max]
Length=237

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 184/247 (74%), Gaps = 24/247 (10%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTP-----Lssssq  348
            PN+ LQVSF+      H            EMGFVQFE++   V+SFL P         SQ
Sbjct  9    PNFELQVSFTNTPQAIH------------EMGFVQFEEN--QVLSFLAPSAQSQSCQLSQ  54

Query  349  pldgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKG  528
             L+  SS SN A         T+  + + A++GFSH++  L +R SWNNN+QV T+DPK 
Sbjct  55   SLNAGSSGSNTAVAATTTFTVTATTSGSGATIGFSHND--LVSRTSWNNNEQVRTLDPKA  112

Query  529  ANDENCSGNAAEG-NNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWR  705
             NDENC+GN ++G NN+WWRS+ S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKWR
Sbjct  113  VNDENCTGNTSDGGNNTWWRSAGS--EKNKMKVRRKLREPRFCFQTRSDVDVLDDGYKWR  170

Query  706  KYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            KYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE
Sbjct  171  KYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  230

Query  886  HDCFTSF  906
            H+CFTSF
Sbjct  231  HECFTSF  237



>gb|KHN12046.1| Putative WRKY transcription factor 12 [Glycine soja]
Length=238

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 183/248 (74%), Gaps = 25/248 (10%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTP------Lssss  345
            PN+ LQVSF+      H            EMGFVQFE++   V+SFL P         S 
Sbjct  9    PNFELQVSFTNTPQAIH------------EMGFVQFEEN--QVLSFLAPSAQSQSCQLSQ  54

Query  346  qpldgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPK  525
                GSS  + AA  T      T+  + + A++GFSH++  L +R SWNNN+QV T+DPK
Sbjct  55   SLNAGSSGSNTAAVATTTTFTVTATTSGSGATIGFSHND--LVSRTSWNNNEQVRTLDPK  112

Query  526  GANDENCSGNAAEG-NNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKW  702
              NDENC+GN ++G NN+WWRS+ S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKW
Sbjct  113  AVNDENCTGNTSDGGNNTWWRSAGS--EKNKMKVRRKLREPRFCFQTRSDVDVLDDGYKW  170

Query  703  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS
Sbjct  171  RKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  230

Query  883  EHDCFTSF  906
            EH+CFTSF
Sbjct  231  EHECFTSF  238



>ref|XP_010052790.1| PREDICTED: probable WRKY transcription factor 12 [Eucalyptus 
grandis]
 gb|KCW76864.1| hypothetical protein EUGRSUZ_D01219 [Eucalyptus grandis]
Length=222

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 172/242 (71%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQV+FS   H  H            E+GFV FED NQ V+ FLTP          
Sbjct  12   VPNYDLQVTFSGASHGIH------------EIGFVPFEDQNQ-VLGFLTP----------  48

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                  A    AA   +T+ A   T+ +G  H    L  R SWNN DQVG  DPK  +DE
Sbjct  49   ------APPLIAAGEGATAAATTTTSRVGLGHHN-GLVARSSWNN-DQVGAHDPKAVSDE  100

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NCS N +EGNNSWWRSS++  +KGK+KVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQK
Sbjct  101  NCSANPSEGNNSWWRSSTAAAEKGKMKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQK  160

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+ F 
Sbjct  161  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHEGFN  220

Query  901  SF  906
            SF
Sbjct  221  SF  222



>ref|XP_010086778.1| putative WRKY transcription factor 12 [Morus notabilis]
 gb|EXC35651.1| putative WRKY transcription factor 12 [Morus notabilis]
Length=240

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 179/248 (72%), Gaps = 19/248 (8%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQA----VMSFLTPLssssq  348
            +P Y LQVS              P     HEMGFVQFEDH+      V+SFL+P +S   
Sbjct  6    VPGYDLQVS--------AFSAATPATVPIHEMGFVQFEDHDHHSTHNVLSFLSP-ASQPS  56

Query  349  pldgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQV--GTMDP  522
                  S S+          +T+      AS+GF H +  L +RP+  NN+QV  GT+DP
Sbjct  57   TAAAQLSSSSTQLPLNGTTAATATDNTNAASMGFCHGD--LVSRPASWNNEQVLMGTLDP  114

Query  523  KGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKW  702
            K  N+ENC+GNA++G+NSWWRSSS+  DK KVKVRRKLREPRFCFQTRSDVDVLDDGYKW
Sbjct  115  KAVNEENCTGNASDGSNSWWRSSSA--DKSKVKVRRKLREPRFCFQTRSDVDVLDDGYKW  172

Query  703  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSP DDSNSS
Sbjct  173  RKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPSDDSNSS  232

Query  883  EHDCFTSF  906
            EH+CF+SF
Sbjct  233  EHECFSSF  240



>ref|XP_004229735.1| PREDICTED: probable WRKY transcription factor 12 [Solanum lycopersicum]
Length=236

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 186/242 (77%), Gaps = 16/242 (7%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            L NY LQ+S +     + HH          E+GF+ F DHN   ++FL P SS S     
Sbjct  11   LNNYNLQISSAAAATNNIHH----------ELGFIHFADHNN--LTFLPP-SSQSSHSLQ  57

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
            +++ ++ + T +AA  + + AAA    LGFSHS+  L NRPSWNNN+QV T+DPKG NDE
Sbjct  58   AAAAASVSVTPSAAVNTNAAAAAGAGGLGFSHSQ-LLVNRPSWNNNEQVETLDPKGINDE  116

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NCSGNA+EGNNS     SS  DKGKVK+RRKLREPRFCFQTRSD+DVLDDGYKWRKYGQK
Sbjct  117  NCSGNASEGNNS--WWKSSSSDKGKVKIRRKLREPRFCFQTRSDIDVLDDGYKWRKYGQK  174

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS+HDCFT
Sbjct  175  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSDHDCFT  234

Query  901  SF  906
            SF
Sbjct  235  SF  236



>ref|XP_011017378.1| PREDICTED: probable WRKY transcription factor 12 [Populus euphratica]
Length=203

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 173/243 (71%), Gaps = 48/243 (20%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNYGLQVSFSTP   H             EMGFVQFE++   V+SFL P          
Sbjct  8    VPNYGLQVSFSTPQAIH-------------EMGFVQFEEN--QVLSFLAP----------  42

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                    S ++  ++  +        +GF+H            N++QVGTM+PK ++DE
Sbjct  43   --------SQSSQISQPLNTNTTTNIHMGFTH------------NDEQVGTMNPKPSSDE  82

Query  541  NCSGNAA-EGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  717
            NC+GNA  +GNNSWWRSS S  +K ++KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ
Sbjct  83   NCTGNANNDGNNSWWRSSPS--EKNRLKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  140

Query  718  KVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCF  897
            KVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CF
Sbjct  141  KVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECF  200

Query  898  TSF  906
            TSF
Sbjct  201  TSF  203



>ref|XP_003521060.1| PREDICTED: probable WRKY transcription factor 12-like [Glycine 
max]
Length=238

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 182/245 (74%), Gaps = 23/245 (9%)
 Frame = +1

Query  187  NYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTP----Lssssqpl  354
            NY LQVSF+      H            EMGFVQFE++   V+SFL P     SS     
Sbjct  12   NYELQVSFANTPQAIH------------EMGFVQFEEN--QVLSFLAPSAQSQSSQLSQS  57

Query  355  dgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGAN  534
              + +  +  +  AA   +T+  + + A++GFSH++  L +R  WNNN+QV T+DPK  N
Sbjct  58   LNAGNGGSNTAVAAATTTATATTSGSGATIGFSHND--LVSRTCWNNNEQVRTLDPKAVN  115

Query  535  DENCSGNAAEG-NNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKY  711
            DENC+GN ++G NNSWWRS+ S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKWRKY
Sbjct  116  DENCTGNTSDGGNNSWWRSAGS--EKNKMKVRRKLREPRFCFQTRSDVDVLDDGYKWRKY  173

Query  712  GQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHD  891
            GQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+
Sbjct  174  GQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHE  233

Query  892  CFTSF  906
            CFTSF
Sbjct  234  CFTSF  238



>ref|XP_004515333.1| PREDICTED: probable WRKY transcription factor 12-like [Cicer 
arietinum]
Length=225

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 176/242 (73%), Gaps = 23/242 (10%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVSF+      H            EMGFVQFE++   V+SFL+P    S     
Sbjct  7    VPNYELQVSFTNTPQAIH------------EMGFVQFEEN--QVLSFLSP----STQSHQ  48

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
             S   N+  + +      +  A  T + GF+H++  L  R  WNN +QV T+DPK  +DE
Sbjct  49   LSQSLNSGGSGSTTTAIAAAVATTTTAAGFNHND--LVTRTPWNN-EQVRTLDPKAVSDE  105

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+GN ++GNN+WWRS  +  +K KVKVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQK
Sbjct  106  NCTGNTSDGNNTWWRSGGT--EKNKVKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQK  163

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CFT
Sbjct  164  VVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFT  223

Query  901  SF  906
            SF
Sbjct  224  SF  225



>ref|XP_011032445.1| PREDICTED: probable WRKY transcription factor 12 [Populus euphratica]
Length=228

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 170/242 (70%), Gaps = 45/242 (19%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY L VSFSTP   H             EMGFVQFE+ NQ V+SFL P          
Sbjct  32   VPNYELHVSFSTPQAIH-------------EMGFVQFEE-NQ-VLSFLAP----------  66

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                  + S+  +   + +        +GFSH            N+ QVG +DPK ++DE
Sbjct  67   ------SQSSQISQPLNANTTTTNNTHMGFSH------------NDQQVGALDPKASSDE  108

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+GN  +GNNSWWRSSS+  DK K+KVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQK
Sbjct  109  NCTGNNNDGNNSWWRSSSA--DKNKLKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQK  166

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CF+
Sbjct  167  VVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFS  226

Query  901  SF  906
            SF
Sbjct  227  SF  228



>ref|XP_009788556.1| PREDICTED: probable WRKY transcription factor 12 [Nicotiana sylvestris]
Length=213

 Score =   269 bits (687),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 162/214 (76%), Gaps = 29/214 (14%)
 Frame = +1

Query  271  EMGFVQ-FEDHNQAVMSFLT-PLssssqpldgssscsnaasttaaaakstsnaaaatasL  444
            EMGFV  FE H   V+SFLT PL  +S     +++ + ++S                  L
Sbjct  27   EMGFVHHFEHHQNQVLSFLTSPLDGASATPPTATNINGSSS------------------L  68

Query  445  GFSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKV  624
            GF + E  L NR SWNN DQV T+DPK   D+NCSGNA EGNNSWWR+S      GKVKV
Sbjct  69   GFYNGE--LVNRSSWNN-DQVETLDPKAVIDQNCSGNANEGNNSWWRNS------GKVKV  119

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRKLREPRFCFQTRSD+DVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL
Sbjct  120  RRKLREPRFCFQTRSDIDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  179

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            SEDCRMVITTYEGRHNHSPCDDSNSSE+DCF+SF
Sbjct  180  SEDCRMVITTYEGRHNHSPCDDSNSSENDCFSSF  213



>gb|AEJ09955.1| STP [Medicago truncatula]
 gb|AEJ09956.1| STP [Medicago truncatula]
 gb|KEH17897.1| WRKY family transcription factor [Medicago truncatula]
Length=227

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 178/242 (74%), Gaps = 21/242 (9%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVSF+      H            EMGFVQFE++   V+SFL+P   S+Q    
Sbjct  7    VPNYDLQVSFTNTPQAIH------------EMGFVQFEEN--QVLSFLSP---STQSQPS  49

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
              S S  +      A + +     T + GFSH++  ++ R  WNN +QV T+DPK  +DE
Sbjct  50   QLSQSLNSGRGTTNATTGAAVTTTTVAAGFSHND-LVTTRTPWNN-EQVRTLDPKAVSDE  107

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+GN ++GNN+WWRS  +  +K KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  108  NCTGNTSDGNNTWWRSGGA--EKSKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  165

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CFT
Sbjct  166  VVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFT  225

Query  901  SF  906
            SF
Sbjct  226  SF  227



>ref|XP_009797802.1| PREDICTED: probable WRKY transcription factor 12 [Nicotiana sylvestris]
Length=235

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 181/249 (73%), Gaps = 29/249 (12%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            L NY LQVSFS PH                ++GFV F DHNQ +MSFL P SS SQ    
Sbjct  9    LNNYELQVSFSAPH----------------DLGFVHFADHNQ-MMSFLAPPSSHSQLSSQ  51

Query  361  sss-------csnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMD  519
                       +    TT   A + + +   +++LGF+H+E  L NRPSWNN DQV T+D
Sbjct  52   IPQPLQVAAATTVTPPTTTTNATAAAASNNISSALGFNHNE--LVNRPSWNN-DQVETLD  108

Query  520  PKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYK  699
            PK  NDENCSGNA+EGNNS     SS  DKGKVK+RRKLREPRFCFQTRSD+DVLDDGYK
Sbjct  109  PKVVNDENCSGNASEGNNS--WWKSSSSDKGKVKIRRKLREPRFCFQTRSDIDVLDDGYK  166

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNS  879
            WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSP DDSNS
Sbjct  167  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPSDDSNS  226

Query  880  SEHDCFTSF  906
            SEHDCFTSF
Sbjct  227  SEHDCFTSF  235



>ref|XP_006375168.1| hypothetical protein POPTR_0014s04890g [Populus trichocarpa]
 gb|ERP52965.1| hypothetical protein POPTR_0014s04890g [Populus trichocarpa]
Length=228

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 171/243 (70%), Gaps = 46/243 (19%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY L VSFSTP   H             EMGFVQFE+ NQ V+SFL P          
Sbjct  31   VPNYELHVSFSTPQAIH-------------EMGFVQFEE-NQ-VLSFLAP----------  65

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                  + S+  +   + +        +GFSH            N+ QVG +DPK ++DE
Sbjct  66   ------SQSSQISQPLNANTTTTNNTHMGFSH------------NDQQVGALDPKASSDE  107

Query  541  NCSGNAA-EGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  717
            NC+GNA  +GNNSWWRSSS+  DK K+KVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQ
Sbjct  108  NCTGNANNDGNNSWWRSSSA--DKNKLKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQ  165

Query  718  KVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCF  897
            KVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CF
Sbjct  166  KVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECF  225

Query  898  TSF  906
            +SF
Sbjct  226  SSF  228



>ref|XP_002270527.1| PREDICTED: probable WRKY transcription factor 12 [Vitis vinifera]
 emb|CBI16682.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 173/242 (71%), Gaps = 26/242 (11%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVS+ST     H            EMGFVQFE+ NQ V+SFL P          
Sbjct  13   VPNYELQVSYSTTPQGIH------------EMGFVQFEE-NQ-VLSFLAP-------SQS  51

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
            +       + + +    T        ++GF+H++  L  RPSWNN +QVGT+DPK  N+E
Sbjct  52   AQMSQPLNTASTSTPTPTPTNTTTNTTMGFTHND--LLTRPSWNN-EQVGTLDPKAVNEE  108

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+GNA +G+NS     SS  +K KVK RRKLREPRFCFQTRS+VDVLDDGYKWRKYGQK
Sbjct  109  NCTGNANDGSNS--WWRSSSSEKTKVKARRKLREPRFCFQTRSEVDVLDDGYKWRKYGQK  166

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CFT
Sbjct  167  VVKNSLHPRSYYRCTHTNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFT  226

Query  901  SF  906
            SF
Sbjct  227  SF  228



>ref|XP_006347986.1| PREDICTED: probable WRKY transcription factor 12-like [Solanum 
tuberosum]
Length=251

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 141/153 (92%), Gaps = 3/153 (2%)
 Frame = +1

Query  448  FSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR  627
            FSH+E  L NRPSWNNN+QV T+DPKG NDENCSGNA+EGNNS     SS  DKGKVK+R
Sbjct  102  FSHNE-LLVNRPSWNNNEQVETLDPKGINDENCSGNASEGNNS--WWKSSSSDKGKVKIR  158

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RKLREPRFCFQTRSD+DVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS
Sbjct  159  RKLREPRFCFQTRSDIDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  218

Query  808  EDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            EDCRMVITTYEGRHNHSPCDDSNSS+HDCFTSF
Sbjct  219  EDCRMVITTYEGRHNHSPCDDSNSSDHDCFTSF  251



>gb|AEQ29015.1| WRKY2, partial [Panax quinquefolius]
Length=235

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 166/218 (76%), Gaps = 11/218 (5%)
 Frame = +1

Query  271  EMGFVQFEDH----NQAVMS-FLTPLssssqpldgssscsnaasttaaaakstsnaaaat  435
            ++GF+QFEDH    N  VMS FL P S SS      ++     +  AAAA +        
Sbjct  23   QIGFLQFEDHQHHNNNHVMSNFLAP-SHSSHLSHPLANICTTTAAAAAAAAAAPATTGNN  81

Query  436  asLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGK  615
             SLGF+H E     RPSW+N  QVG +D K AN+E CSGNA+E N+SWWRSS S  DKG+
Sbjct  82   WSLGFNHIEHL--ERPSWDNEQQVGRLDAKAANEEKCSGNASEDNHSWWRSSCS--DKGR  137

Query  616  VK-VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            VK VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKR
Sbjct  138  VKLVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKR  197

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            VERLSEDCRMVITTYEGRHNH PCDDSN SE++CFTSF
Sbjct  198  VERLSEDCRMVITTYEGRHNHIPCDDSNYSENECFTSF  235



>ref|XP_007219496.1| hypothetical protein PRUPE_ppa022287mg [Prunus persica]
 gb|EMJ20695.1| hypothetical protein PRUPE_ppa022287mg [Prunus persica]
Length=244

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 179/248 (72%), Gaps = 17/248 (7%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHN---QAVMSFLTPLssssqp  351
            +P+Y +Q+SFS+  +P    H         EMGFVQFEDH+     V+SF+ P S   Q 
Sbjct  8    VPSYEVQISFSSTPNPQQSIH---------EMGFVQFEDHHPHHNQVLSFMAPSSHIQQQ  58

Query  352  l--dgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNN-NDQVGTMDP  522
               +      +  +  ++ A + +   +   ++GFS     L  RPSWNN NDQVGT+DP
Sbjct  59   QPNNSHHPHHHQPAELSSGASAAATTTSNGVTVGFSTHTDLLVARPSWNNSNDQVGTLDP  118

Query  523  KGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKW  702
            K  +DEN +GNA++ +NS     SS  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKW
Sbjct  119  KAISDENGTGNASDCSNS--WWRSSSSEKSKMKVRRKLREPRFCFQTRSDVDVLDDGYKW  176

Query  703  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH+PCDDSNSS
Sbjct  177  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHTPCDDSNSS  236

Query  883  EHDCFTSF  906
            EH+CF+SF
Sbjct  237  EHECFSSF  244



>ref|XP_008232541.1| PREDICTED: probable WRKY transcription factor 12 [Prunus mume]
Length=244

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 179/248 (72%), Gaps = 17/248 (7%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHN---QAVMSFLTPLssssqp  351
            +P+Y +Q+SFS+  +P    H         EMGFVQFEDH+     V+SF+ P S   Q 
Sbjct  8    VPSYEVQISFSSTPNPQQSIH---------EMGFVQFEDHHPHHNQVLSFMAPSSHIQQQ  58

Query  352  l--dgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNN-NDQVGTMDP  522
               +      +  +  ++ A + +   +   ++GFS     L  RPSWNN NDQVGT+DP
Sbjct  59   QPNNSHHPHHHQPAELSSGASAATTTTSNGVTVGFSTHTDLLVARPSWNNSNDQVGTLDP  118

Query  523  KGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKW  702
            K  +DEN +GNA++ +NS     SS  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKW
Sbjct  119  KAISDENGTGNASDCSNS--WWRSSSSEKSKMKVRRKLREPRFCFQTRSDVDVLDDGYKW  176

Query  703  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH+PCDDSNSS
Sbjct  177  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHTPCDDSNSS  236

Query  883  EHDCFTSF  906
            EH+CF+SF
Sbjct  237  EHECFSSF  244



>ref|XP_002301237.2| hypothetical protein POPTR_0002s13980g [Populus trichocarpa]
 gb|EEE80510.2| hypothetical protein POPTR_0002s13980g [Populus trichocarpa]
Length=203

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 167/242 (69%), Gaps = 46/242 (19%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNYGLQVSFSTP   H             EMGFVQFE++   V+SFL P          
Sbjct  8    VPNYGLQVSFSTPQAIH-------------EMGFVQFEEN--QVLSFLAP----------  42

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                    S ++  ++  +      + +GFSH            N++QVGTMDPK ++DE
Sbjct  43   --------SQSSQISQPLNTNTTTNSHMGFSH------------NDEQVGTMDPKPSSDE  82

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+GNA   + +     SS  +K ++KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  83   NCTGNA-NNDGNNSWWRSSSSEKNRLKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  141

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPC+DSNSSEH+CFT
Sbjct  142  VVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCEDSNSSEHECFT  201

Query  901  SF  906
            SF
Sbjct  202  SF  203



>ref|XP_011101863.1| PREDICTED: probable WRKY transcription factor 12 [Sesamum indicum]
Length=239

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 166/220 (75%), Gaps = 19/220 (9%)
 Frame = +1

Query  271  EMGFVQFED---HNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatas  441
            EMGFVQFED   HNQ +   +TP              S+  S+   +  +    A + AS
Sbjct  31   EMGFVQFEDDHHHNQVLSFLVTP-----------PPLSHHPSSHNMSLTAKPTTATSNAS  79

Query  442  LGFSHSEPQLSNRPSWNNNDQ-----VGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVD  606
            LGF+H++  +++RPSWNN+        G +DPKG NDENCSGN  EG NSWWR+SSS   
Sbjct  80   LGFNHNDQFVNSRPSWNNDHHQVGGGGGGVDPKGVNDENCSGNTNEGGNSWWRNSSSSEK  139

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
              KVK+RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK
Sbjct  140  SNKVKIRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  199

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNHSPCDDSNSS+HDCFTSF
Sbjct  200  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSDHDCFTSF  239



>ref|XP_008437760.1| PREDICTED: probable WRKY transcription factor 12 [Cucumis melo]
Length=220

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 150/212 (71%), Gaps = 25/212 (12%)
 Frame = +1

Query  271  EMGFVQFEDHNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatasLGF  450
            EMGFVQ E+H+Q V+SFL                            + +N      +   
Sbjct  34   EMGFVQLEEHSQ-VLSFLA---------------------PNNNNNNATNMPPPPFTTTS  71

Query  451  SHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRR  630
             HS   L   PSW N+   GT+DPK  NDENC+  A +  NSWWR++++  DK KVKVRR
Sbjct  72   PHSN-ILPRPPSWTNHQLPGTLDPKPGNDENCTATATDATNSWWRNTNA--DKSKVKVRR  128

Query  631  KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  810
            KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE
Sbjct  129  KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  188

Query  811  DCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            DCRMVITTYEGRHNHSPCDDSNSSEH+ FTSF
Sbjct  189  DCRMVITTYEGRHNHSPCDDSNSSEHEPFTSF  220



>ref|XP_004133758.1| PREDICTED: probable WRKY transcription factor 12-like [Cucumis 
sativus]
 ref|XP_004155207.1| PREDICTED: probable WRKY transcription factor 12-like [Cucumis 
sativus]
 gb|KGN56333.1| hypothetical protein Csa_3G116700 [Cucumis sativus]
Length=219

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 151/212 (71%), Gaps = 26/212 (12%)
 Frame = +1

Query  271  EMGFVQFEDHNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatasLGF  450
            EMGFVQ E+H+Q V+SFL                            +T+N      +   
Sbjct  34   EMGFVQLEEHSQ-VLSFLA----------------------PNNNNNTTNMPPPPFTTTS  70

Query  451  SHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRR  630
             HS   L   PSW N+   GT+DPK  NDENC+  A +  NSWWR++++  DK KVKVRR
Sbjct  71   PHSN-ILPRPPSWTNHQLPGTLDPKPGNDENCTATATDATNSWWRNTNA--DKSKVKVRR  127

Query  631  KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  810
            KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE
Sbjct  128  KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  187

Query  811  DCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            DCRMVITTYEGRHNH+PCDDSNSSEH+ FTSF
Sbjct  188  DCRMVITTYEGRHNHTPCDDSNSSEHEPFTSF  219



>gb|KHN40537.1| Putative WRKY transcription factor 12 [Glycine soja]
Length=225

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 172/243 (71%), Gaps = 28/243 (12%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgs  363
            PNY LQVSF+      H            EMGFVQ+E++   V+ FL+       P   S
Sbjct  9    PNYELQVSFTNTPQALH------------EMGFVQYEENQ--VLGFLS-------PSSQS  47

Query  364  sscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDEN  543
             S   + S  +        A   TA++GF      ++   +WNN DQVGT+DPK   DEN
Sbjct  48   QSSHLSQSLNSDTGVVAVTAPTPTATIGFMSHSGLVTK--TWNN-DQVGTLDPKPVEDEN  104

Query  544  CSGNAAE--GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  717
            C+GN ++   NN+WWRS+++  +K KVK+RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ
Sbjct  105  CTGNGSDQGNNNTWWRSAAT--EKNKVKIRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  162

Query  718  KVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCF  897
            KVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE++CF
Sbjct  163  KVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSENECF  222

Query  898  TSF  906
            TSF
Sbjct  223  TSF  225



>ref|XP_009373203.1| PREDICTED: probable WRKY transcription factor 12 [Pyrus x bretschneideri]
Length=236

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 181/249 (73%), Gaps = 27/249 (11%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFED--HNQAVMSFL----TPLsss  342
            +PNY +Q+SFS+      H           EMGFVQFED  H+  V+SFL    +P+   
Sbjct  8    VPNYEVQISFSSTPQQAIH-----------EMGFVQFEDQHHHNQVLSFLAPSSSPVQVQ  56

Query  343  sqpldgssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNN-DQVGTMD  519
             Q    +S   +  +  + ++ +T+ A +  A++GFS        RPSWNNN +QVGT+D
Sbjct  57   QQLNPNNSHHHHQPAALSTSSSATATATSNAATMGFS-------TRPSWNNNNEQVGTLD  109

Query  520  PKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYK  699
            PKG +DEN +GNA++ +NS     SS  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYK
Sbjct  110  PKGVSDENGTGNASDCSNS--WWRSSSSEKSKMKVRRKLREPRFCFQTRSDVDVLDDGYK  167

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNS  879
            WRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDS S
Sbjct  168  WRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSTS  227

Query  880  SEHDCFTSF  906
            SEH+CF+SF
Sbjct  228  SEHECFSSF  236



>ref|NP_001235408.1| uncharacterized protein LOC100526878 [Glycine max]
 ref|XP_006586646.1| PREDICTED: uncharacterized protein LOC100526878 isoform X1 [Glycine 
max]
 gb|ACU15887.1| unknown [Glycine max]
 gb|KHN11553.1| Putative WRKY transcription factor 12 [Glycine soja]
Length=228

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 177/244 (73%), Gaps = 27/244 (11%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgs  363
            PNY LQVSF+      H            E+GFVQ+E++   V+ FL+           S
Sbjct  9    PNYELQVSFTNTPQAIH------------ELGFVQYEENQ--VLGFLS-----PSSQSQS  49

Query  364  sscsnaasttaaaakstsnaaaatasLGF-SHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
            S  S +  +      + + A AA A++GF SHSE  +    +WNN+ +VGT+DPK   +E
Sbjct  50   SPLSQSLKSDTLVVATATTAIAAAATIGFVSHSELAIK---TWNNDQEVGTLDPKPVEEE  106

Query  541  NCSGNAAE--GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYG  714
            NC+GN ++   NN+WWRS+++  +K K+K+RRKLREPRFCFQTRSDVDVLDDGYKWRKYG
Sbjct  107  NCTGNGSDQGNNNAWWRSAAT--EKNKLKIRRKLREPRFCFQTRSDVDVLDDGYKWRKYG  164

Query  715  QKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDC  894
            QKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE++C
Sbjct  165  QKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSENEC  224

Query  895  FTSF  906
            FTSF
Sbjct  225  FTSF  228



>gb|EYU40347.1| hypothetical protein MIMGU_mgv1a026438mg [Erythranthe guttata]
Length=248

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 161/231 (70%), Gaps = 29/231 (13%)
 Frame = +1

Query  271  EMGFVQFE--DHNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatasL  444
            EMGFV FE  DH+  V+SFL                 +      A   +T+       SL
Sbjct  28   EMGFVHFEEEDHHNQVLSFLV--------APPPPPPPSQQLHGGANKPTTTTNYNNNGSL  79

Query  445  GFS---HSEPQLSNRPSWNNNDQVG--TMDPKGAND-ENCSGN----AAEGNNSWWRSSS  594
            GF+   HSE  L NRPSWNN+  VG   +DPK AND ENCS N    AA   NSWWR+SS
Sbjct  80   GFNNNHHSE--LVNRPSWNNDQPVGGGAVDPKAANDDENCSANTNQAAAPNYNSWWRNSS  137

Query  595  SL-------VDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSY  753
            S         +K KVK+RRKLREPRFCFQTRSDVDVL+DGYKWRKYGQKVVKNSLHPRSY
Sbjct  138  SASGGSSSATEKNKVKIRRKLREPRFCFQTRSDVDVLEDGYKWRKYGQKVVKNSLHPRSY  197

Query  754  YRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            YRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE DCFT+F
Sbjct  198  YRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEQDCFTTF  248



>ref|NP_001237545.1| transcription factor [Glycine max]
 gb|ABY84655.1| transcription factor [Glycine max]
Length=225

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 172/243 (71%), Gaps = 28/243 (12%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgs  363
            PNY LQVSF+      H            EMGFVQ+E++   V+ FL+       P   S
Sbjct  9    PNYELQVSFTNTPQALH------------EMGFVQYEEN--QVLGFLS-------PSSQS  47

Query  364  sscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDEN  543
             S   + S  +        A   TA++GF      ++   +WNN DQVGT+DPK   DEN
Sbjct  48   QSSHLSQSLNSDTGVVAVTATTPTATIGFMSHSGLVTK--TWNN-DQVGTLDPKPVEDEN  104

Query  544  CSGNAAE--GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  717
            C+GN ++   NN+WWRS+++  +K KVK+RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ
Sbjct  105  CTGNGSDQGNNNTWWRSAAT--EKNKVKIRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQ  162

Query  718  KVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCF  897
            KVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE++CF
Sbjct  163  KVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSENECF  222

Query  898  TSF  906
            TSF
Sbjct  223  TSF  225



>ref|XP_003636165.1| WRKY transcription factor [Medicago truncatula]
Length=515

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 125/134 (93%), Gaps = 2/134 (1%)
 Frame = +1

Query  505  VGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVL  684
            V T+DPK  +DENC+GN ++GNN+WWRS  +  +K KVKVRRKLREPRFCFQTRSDVDVL
Sbjct  384  VRTLDPKAVSDENCTGNTSDGNNTWWRSGGA--EKSKVKVRRKLREPRFCFQTRSDVDVL  441

Query  685  DDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC  864
            DDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHNHSPC
Sbjct  442  DDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHSPC  501

Query  865  DDSNSSEHDCFTSF  906
            DDSNSSEH+CFTSF
Sbjct  502  DDSNSSEHECFTSF  515



>ref|XP_004306977.1| PREDICTED: probable WRKY transcription factor 12-like [Fragaria 
vesca subsp. vesca]
Length=254

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 161/224 (72%), Gaps = 15/224 (7%)
 Frame = +1

Query  271  EMGFVQFEDHNQ---AVMSFLTPLssssqpldgssscsnaasttaaaakstsnaa-----  426
            EMGFVQFEDH+     V+SFL P  +               S+++   ++T+  +     
Sbjct  34   EMGFVQFEDHHHHHNQVLSFLAPSPAQQSHPPPPPPPPQQQSSSSHHHQTTAVNSCGITV  93

Query  427  ----aatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSS  594
                A   + GFSHS   L  +PSWNNNDQ  T+DPKG +DE  +GN ++ +NS     S
Sbjct  94   TTTAATNTNTGFSHSH-DLVTKPSWNNNDQAATLDPKGVSDETGTGNGSDCSNS--WWRS  150

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S  +K K+KVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN
Sbjct  151  SNSEKNKMKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  210

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            CRVKKRVERLSEDCRMVITTYEGRHNH P DDSNSSEH+CFTSF
Sbjct  211  CRVKKRVERLSEDCRMVITTYEGRHNHIPSDDSNSSEHECFTSF  254



>gb|AGQ04204.1| WRKY transcription factor 16 [Jatropha curcas]
 gb|KDP28874.1| hypothetical protein JCGZ_14645 [Jatropha curcas]
Length=207

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 163/242 (67%), Gaps = 42/242 (17%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            + NY LQVSFSTP   H             EMGFV FE+ NQ V SFL P          
Sbjct  8    VANYELQVSFSTPQAIH-------------EMGFVPFEE-NQ-VFSFLAP----------  42

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                 + +  ++  ++  +        +GFS            ++NDQVGT+DPK   +E
Sbjct  43   -----SNSHQSSQISQPLNTTTTTNNHMGFS------------SHNDQVGTLDPKARIEE  85

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NC+ + A   N+ W  +SS  +K KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  86   NCTASGANDGNNSWWRNSSSSEKNKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  145

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH+CFT
Sbjct  146  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFT  205

Query  901  SF  906
            SF
Sbjct  206  SF  207



>ref|XP_010258736.1| PREDICTED: probable WRKY transcription factor 12 isoform X1 [Nelumbo 
nucifera]
Length=216

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 130/148 (88%), Gaps = 4/148 (3%)
 Frame = +1

Query  466  QLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNN-SWWRSSSSLVDKGKVKVRRKLRE  642
            +++ RP WN+  QVG +D K  N+EN SGN  +GNN SWWR+SSS  DK KVK RRKLRE
Sbjct  72   EVATRPLWNDT-QVGKLDAKTINEENSSGNVNDGNNNSWWRNSSS--DKNKVKARRKLRE  128

Query  643  PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRM  822
            PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRM
Sbjct  129  PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRM  188

Query  823  VITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            VITTYEGRH HSPCDDSNS+EH+CF SF
Sbjct  189  VITTYEGRHTHSPCDDSNSAEHECFGSF  216



>ref|XP_010258737.1| PREDICTED: probable WRKY transcription factor 12 isoform X2 [Nelumbo 
nucifera]
Length=215

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +1

Query  466  QLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNN-SWWRSSSSLVDKGKVKVRRKLRE  642
            +++ RP WN+  QVG +D K  N+EN SGN  +GNN SWWR+SSS  DK KVK RRKLRE
Sbjct  72   EVATRPLWNDT-QVGKLDAKTINEENSSGNVNDGNNNSWWRNSSS--DKNKVKARRKLRE  128

Query  643  PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRM  822
            PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP SYYRCTH+NCRVKKRVERLSEDCRM
Sbjct  129  PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP-SYYRCTHNNCRVKKRVERLSEDCRM  187

Query  823  VITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            VITTYEGRH HSPCDDSNS+EH+CF SF
Sbjct  188  VITTYEGRHTHSPCDDSNSAEHECFGSF  215



>ref|XP_010919760.1| PREDICTED: probable WRKY transcription factor 12 isoform X2 [Elaeis 
guineensis]
Length=212

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 5/145 (3%)
 Frame = +1

Query  472  SNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRF  651
            +++P+W+N ++VGT DPK  ND+N S  A +G NSWW+S+SS  +K KVKVRRK+REPRF
Sbjct  73   TSKPAWSN-EEVGTSDPKVGNDQNSS--ARDGVNSWWKSASS--EKSKVKVRRKMREPRF  127

Query  652  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  831
            CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT
Sbjct  128  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  187

Query  832  TYEGRHNHSPCDDSNSSEHDCFTSF  906
            TYEGRH HSPCDD+N+SEH+ F SF
Sbjct  188  TYEGRHTHSPCDDANTSEHEYFNSF  212



>ref|XP_008794915.1| PREDICTED: probable WRKY transcription factor 12 isoform X2 [Phoenix 
dactylifera]
Length=211

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 4/138 (3%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSD  672
            +N++VGT DPK  ND+N SG   +G +SWW+S+SS  +K KVKVRRK+REPRFCFQTRSD
Sbjct  78   SNEEVGTSDPKVGNDQNSSGR--DGVDSWWKSASS--EKSKVKVRRKMREPRFCFQTRSD  133

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH 
Sbjct  134  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHT  193

Query  853  HSPCDDSNSSEHDCFTSF  906
            HSPCDD+NSSEH+ F SF
Sbjct  194  HSPCDDANSSEHEYFNSF  211



>ref|XP_011093231.1| PREDICTED: probable WRKY transcription factor 12 [Sesamum indicum]
Length=181

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 148/213 (69%), Gaps = 34/213 (16%)
 Frame = +1

Query  274  MGFVQFEDHNQAVMSFL-TPLssssqpldgssscsnaasttaaaakstsnaaaatasLGF  450
            MGF+ F+DH+  +++FL TP                    +   A   +      ASLGF
Sbjct  1    MGFLHFDDHDNHLLNFLPTP-------------SPPLHQISPPLAGGATTINNTAASLGF  47

Query  451  SHSEPQLSNRPSWNNNDQVGTM-DPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR  627
            +H              DQV  + DPK  NDENC  +  EG+ SWWRSSS  ++K KVKVR
Sbjct  48   TH--------------DQVAALQDPKTVNDENCKLD--EGH-SWWRSSS--LEKNKVKVR  88

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCT SNCRVKKRVERLS
Sbjct  89   RKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTQSNCRVKKRVERLS  148

Query  808  EDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            EDCRMVITTYEGRHNHSPCDDSNSS+H+ FTSF
Sbjct  149  EDCRMVITTYEGRHNHSPCDDSNSSQHNSFTSF  181



>ref|XP_009397047.1| PREDICTED: probable WRKY transcription factor 12 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 3/138 (2%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSD  672
            +N++V T D KG ND+  S     G NSWWRSSS  ++KGKVKVRRK+REPRFCFQTRSD
Sbjct  78   SNEEVATSDSKGRNDQTGSCRDG-GANSWWRSSS--LEKGKVKVRRKMREPRFCFQTRSD  134

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH 
Sbjct  135  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHT  194

Query  853  HSPCDDSNSSEHDCFTSF  906
            HSPCDD++SSEH+CF+SF
Sbjct  195  HSPCDDASSSEHECFSSF  212



>ref|XP_010246101.1| PREDICTED: probable WRKY transcription factor 12 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 152/213 (71%), Gaps = 17/213 (8%)
 Frame = +1

Query  271  EMGFVQFEDHNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatasLGF  450
            EMGFVQFE+     +SFL P   S        S     S+++ +  +          +G 
Sbjct  26   EMGFVQFEESQG--LSFLLPCQPSHHHHHHQLSLPINNSSSSNSKTT----------VGL  73

Query  451  SHSEPQLSNRPSWNNNDQVGTMDPKG-ANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR  627
            S  +  ++ RP+  NNDQVG ++PK   NDEN SG A   +++     +S  DK KVKVR
Sbjct  74   SGDD--VATRPTPWNNDQVGRLEPKTTVNDENSSGIA--NDDNSSWWRNSSSDKSKVKVR  129

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLS
Sbjct  130  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLS  189

Query  808  EDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            EDCRMVITTYEGRH HSPCDDSNSSEH+CF+SF
Sbjct  190  EDCRMVITTYEGRHTHSPCDDSNSSEHECFSSF  222



>ref|XP_010919759.1| PREDICTED: probable WRKY transcription factor 12 isoform X1 [Elaeis 
guineensis]
Length=213

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 6/146 (4%)
 Frame = +1

Query  472  SNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSW-WRSSSSLVDKGKVKVRRKLREPR  648
            +++P+W+N ++VGT DPK  ND+N S  A +G NS  W+S+SS  +K KVKVRRK+REPR
Sbjct  73   TSKPAWSN-EEVGTSDPKVGNDQNSS--ARDGVNSCRWKSASS--EKSKVKVRRKMREPR  127

Query  649  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  828
            FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI
Sbjct  128  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  187

Query  829  TTYEGRHNHSPCDDSNSSEHDCFTSF  906
            TTYEGRH HSPCDD+N+SEH+ F SF
Sbjct  188  TTYEGRHTHSPCDDANTSEHEYFNSF  213



>ref|XP_008794917.1| PREDICTED: probable WRKY transcription factor 12 isoform X4 [Phoenix 
dactylifera]
Length=210

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%), Gaps = 5/138 (4%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSD  672
            +N++VGT DPK  ND+N SG   +G +SWW+S+SS  +K KVKVRRK+REPRFCFQTRSD
Sbjct  78   SNEEVGTSDPKVGNDQNSSGR--DGVDSWWKSASS--EKSKVKVRRKMREPRFCFQTRSD  133

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHP SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH 
Sbjct  134  VDVLDDGYKWRKYGQKVVKNSLHP-SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHT  192

Query  853  HSPCDDSNSSEHDCFTSF  906
            HSPCDD+NSSEH+ F SF
Sbjct  193  HSPCDDANSSEHEYFNSF  210



>ref|XP_006445445.1| hypothetical protein CICLE_v10023956mg [Citrus clementina]
 ref|XP_006464409.1| PREDICTED: probable WRKY transcription factor 12-like [Citrus 
sinensis]
 gb|ESR58685.1| hypothetical protein CICLE_v10023956mg [Citrus clementina]
 gb|KDO85471.1| hypothetical protein CISIN_1g026216mg [Citrus sinensis]
Length=241

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 9/157 (6%)
 Frame = +1

Query  442  LGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAA--EGNNSWWRSSSSLVDKGK  615
            LGF+H+        + +++ QVG ++P+  N+ENC+ N A  EG+NSWWRSSSS     K
Sbjct  92   LGFTHTS-------NHDHHHQVGPLNPRAVNNENCTSNHASDEGHNSWWRSSSSSEKINK  144

Query  616  VKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRV  795
            VK RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVKKRV
Sbjct  145  VKARRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVKKRV  204

Query  796  ERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            ERLSEDCRMVITTYEGRHNHSPCDDSNSS+H+CF  F
Sbjct  205  ERLSEDCRMVITTYEGRHNHSPCDDSNSSDHECFAHF  241



>ref|XP_010246102.1| PREDICTED: probable WRKY transcription factor 12 isoform X2 [Nelumbo 
nucifera]
Length=221

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 151/213 (71%), Gaps = 18/213 (8%)
 Frame = +1

Query  271  EMGFVQFEDHNQAVMSFLTPLssssqpldgssscsnaasttaaaakstsnaaaatasLGF  450
            EMGFVQFE+     +SFL P   S        S     S+++ +  +          +G 
Sbjct  26   EMGFVQFEESQG--LSFLLPCQPSHHHHHHQLSLPINNSSSSNSKTT----------VGL  73

Query  451  SHSEPQLSNRPSWNNNDQVGTMDPKG-ANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR  627
            S  +  ++ RP+  NNDQVG ++PK   NDEN SG A   +++     +S  DK KVKVR
Sbjct  74   SGDD--VATRPTPWNNDQVGRLEPKTTVNDENSSGIA--NDDNSSWWRNSSSDKSKVKVR  129

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP SYYRCTH+NCRVKKRVERLS
Sbjct  130  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP-SYYRCTHNNCRVKKRVERLS  188

Query  808  EDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            EDCRMVITTYEGRH HSPCDDSNSSEH+CF+SF
Sbjct  189  EDCRMVITTYEGRHTHSPCDDSNSSEHECFSSF  221



>ref|XP_008794914.1| PREDICTED: probable WRKY transcription factor 12 isoform X1 [Phoenix 
dactylifera]
Length=212

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 5/139 (4%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSW-WRSSSSLVDKGKVKVRRKLREPRFCFQTRS  669
            +N++VGT DPK  ND+N SG   +G +S  W+S+SS  +K KVKVRRK+REPRFCFQTRS
Sbjct  78   SNEEVGTSDPKVGNDQNSSGR--DGVDSCRWKSASS--EKSKVKVRRKMREPRFCFQTRS  133

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
            DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH
Sbjct  134  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  193

Query  850  NHSPCDDSNSSEHDCFTSF  906
             HSPCDD+NSSEH+ F SF
Sbjct  194  THSPCDDANSSEHEYFNSF  212



>ref|XP_009407832.1| PREDICTED: probable WRKY transcription factor 12 [Musa acuminata 
subsp. malaccensis]
Length=213

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 123/139 (88%), Gaps = 5/139 (4%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSW-WRSSSSLVDKGKVKVRRKLREPRFCFQTRS  669
            +N++VGT D K  ND+  S  + +G+NS  WR SS  ++KGKVKV+RK+REPRFCFQTRS
Sbjct  79   SNEEVGTSDSKDPNDQTSS--SKDGDNSCRWRGSS--LEKGKVKVKRKMREPRFCFQTRS  134

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
            DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRH
Sbjct  135  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRH  194

Query  850  NHSPCDDSNSSEHDCFTSF  906
             HSPCDD NSSEH+CF+SF
Sbjct  195  THSPCDDENSSEHECFSSF  213



>ref|XP_010692038.1| PREDICTED: probable WRKY transcription factor 48 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = +1

Query  469  LSNRPSWN---NNDQV-GTMDPKG---ANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR  627
            ++ R SWN    + QV G+  PK     ++ N  G   E  +SWW+SS+S  +K K+K+R
Sbjct  103  VTTRHSWNISTTDQQVEGSSAPKATMAGDNTNGDGRNDEAEHSWWKSSTS--EKNKMKIR  160

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RKLREPRFCFQTRSD+DVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS
Sbjct  161  RKLREPRFCFQTRSDIDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  220

Query  808  EDCRMVITTYEGRHNHSPCDDSNSSEHD-CFTSF  906
            EDCRMVITTYEGRHNHSPCDDS+SSEHD CF+SF
Sbjct  221  EDCRMVITTYEGRHNHSPCDDSSSSEHDQCFSSF  254



>ref|XP_008794916.1| PREDICTED: probable WRKY transcription factor 12 isoform X3 [Phoenix 
dactylifera]
Length=211

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 122/139 (88%), Gaps = 6/139 (4%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSW-WRSSSSLVDKGKVKVRRKLREPRFCFQTRS  669
            +N++VGT DPK  ND+N SG   +G +S  W+S+SS  +K KVKVRRK+REPRFCFQTRS
Sbjct  78   SNEEVGTSDPKVGNDQNSSGR--DGVDSCRWKSASS--EKSKVKVRRKMREPRFCFQTRS  133

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
            DVDVLDDGYKWRKYGQKVVKNSLHP SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH
Sbjct  134  DVDVLDDGYKWRKYGQKVVKNSLHP-SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  192

Query  850  NHSPCDDSNSSEHDCFTSF  906
             HSPCDD+NSSEH+ F SF
Sbjct  193  THSPCDDANSSEHEYFNSF  211



>ref|XP_006294932.1| hypothetical protein CARUB_v10023987mg, partial [Capsella rubella]
 gb|EOA27830.1| hypothetical protein CARUB_v10023987mg, partial [Capsella rubella]
Length=232

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 115/138 (83%), Gaps = 5/138 (4%)
 Frame = +1

Query  508  GTMDPKGAND--ENCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFCFQTRSD  672
            G + PK  ND  EN  G  N    +NSWWRSSS  +D K KVK+RRKLREPRFCFQT+SD
Sbjct  95   GPLGPKVVNDDQENFRGGTNNDAHSNSWWRSSSGSIDMKNKVKIRRKLREPRFCFQTKSD  154

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRHN
Sbjct  155  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHN  214

Query  853  HSPCDDSNSSEHDCFTSF  906
            H P DDS S +HDC +SF
Sbjct  215  HIPSDDSTSPDHDCISSF  232



>ref|XP_010524442.1| PREDICTED: probable WRKY transcription factor 12 [Tarenaya hassleriana]
Length=211

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  487  WNNNDQVGTMDPKGAND---ENCSGNAAEGNNSWWRSSSSLVDKGKVK-VRRKLREPRFC  654
            ++N+ Q G MDPK  +D   EN + N  +G+ SWWRSS++  +K K   VRRK+REPRFC
Sbjct  68   FSNSTQSGGMDPKAVDDHREENRARNGNDGHASWWRSSAAAAEKNKANKVRRKMREPRFC  127

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS+VDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT
Sbjct  128  FQTRSEVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  187

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRH HSPCDDS SSEH+C +SF
Sbjct  188  YEGRHCHSPCDDSTSSEHECLSSF  211



>ref|XP_010559087.1| PREDICTED: probable WRKY transcription factor 12 [Tarenaya hassleriana]
Length=215

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 118/145 (81%), Gaps = 5/145 (3%)
 Frame = +1

Query  487  WNNNDQVGTMDPKGANDE-NCSGNAAEG---NNSWWRSSSSLVDKGKV-KVRRKLREPRF  651
            +++  Q G +  K  +D+ NC      G   + SWWRSS    +K KV KVRRK+REPRF
Sbjct  71   FSDTTQGGALGSKRVDDDDNCHRENRTGHSNDTSWWRSSGVTAEKSKVNKVRRKMREPRF  130

Query  652  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  831
            CFQTRSDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVIT
Sbjct  131  CFQTRSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVIT  190

Query  832  TYEGRHNHSPCDDSNSSEHDCFTSF  906
            TYEGRHNHSPCDDS SSEH+C +SF
Sbjct  191  TYEGRHNHSPCDDSTSSEHECLSSF  215



>ref|NP_566025.2| putative WRKY transcription factor 12 [Arabidopsis thaliana]
 sp|Q93WY4.1|WRK12_ARATH RecName: Full=Probable WRKY transcription factor 12; AltName: 
Full=WRKY DNA-binding protein 12 [Arabidopsis thaliana]
 gb|AAK96195.1|AF404857_1 WRKY transcription factor 12 [Arabidopsis thaliana]
 gb|ABE65906.1| WRKY family transcription factor [Arabidopsis thaliana]
 gb|ABI93901.1| At2g44745 [Arabidopsis thaliana]
 gb|AEC10462.1| putative WRKY transcription factor 12 [Arabidopsis thaliana]
Length=218

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND--ENCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND  EN  G  N    +NSWWRS+S   D K KVK+RRKLREPRFC
Sbjct  75   NNLQGGGPLGSKVVNDDQENFGGGTNNDAHSNSWWRSNSGSGDMKNKVKIRRKLREPRFC  134

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  135  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  194

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS S +HDC +SF
Sbjct  195  YEGRHNHIPSDDSTSPDHDCLSSF  218



>ref|XP_002881979.1| WRKY family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58238.1| WRKY family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=218

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND--ENCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND  EN  G  N    +NSWWRS+S   D K KVK+RRKLREPRFC
Sbjct  75   NNLQGGGPLGSKVVNDDQENFRGGTNTDAHSNSWWRSNSGSGDMKNKVKIRRKLREPRFC  134

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  135  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  194

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS S +HDC +SF
Sbjct  195  YEGRHNHIPSDDSTSPDHDCLSSF  218



>gb|ABK28536.1| unknown [Arabidopsis thaliana]
Length=219

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND--ENCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND  EN  G  N    +NSWWRS+S   D K KVK+RRKLREPRFC
Sbjct  75   NNLQGGGPLGSKVVNDDQENFGGGTNNDAHSNSWWRSNSGSGDMKNKVKIRRKLREPRFC  134

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  135  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  194

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS S +HDC +SF
Sbjct  195  YEGRHNHIPSDDSTSPDHDCLSSF  218



>ref|XP_006647614.1| PREDICTED: probable WRKY transcription factor 12-like [Oryza 
brachyantha]
Length=214

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +1

Query  448  FSHSEPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSS--SSLVDKGKVK  621
               S     + P+    ++V T   K  N+         G+N+WWR +  +++ +KGK+K
Sbjct  63   LGKSTAAAGSMPNIGGAEEVATSVTKAGNEST----TCNGSNTWWRGTTMAAMGEKGKMK  118

Query  622  VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVER  801
            +RRK+REPRFCFQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVER
Sbjct  119  IRRKMREPRFCFQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVER  178

Query  802  LSEDCRMVITTYEGRHNHSPCDDSNSSEH-DCFTSF  906
            LS DCRMVITTYEGRH HSPCDD+ S EH +CF+SF
Sbjct  179  LSTDCRMVITTYEGRHTHSPCDDTASGEHTNCFSSF  214



>gb|AAM14881.1| Expressed protein [Arabidopsis thaliana]
 gb|AAM65705.1| WRKY transcription factor 12 [Arabidopsis thaliana]
Length=191

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND--ENCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND  EN  G  N    +NSWWRS+S   D K KVK+RRKLREPRFC
Sbjct  48   NNLQGGGPLGSKVVNDDQENFGGGTNNDAHSNSWWRSNSGSGDMKNKVKIRRKLREPRFC  107

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  108  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  167

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS S +HDC +SF
Sbjct  168  YEGRHNHIPSDDSTSPDHDCLSSF  191



>gb|EAZ24028.1| hypothetical protein OsJ_07759 [Oryza sativa Japonica Group]
Length=212

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 7/145 (5%)
 Frame = +1

Query  481  PSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSS--SSLVDKGKVKVRRKLREPRFC  654
            P+    ++V T   K  N+         G+ +WWR S  +++ +KGK+K+RRK+REPRFC
Sbjct  72   PNIGGAEEVATTVTKAGNEST----TCNGSTTWWRGSTMAAMGEKGKMKIRRKMREPRFC  127

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVERLS DCRMVITT
Sbjct  128  FQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITT  187

Query  835  YEGRHNHSPCDDSNSSEH-DCFTSF  906
            YEGRH HSPCDD++S EH +CF+SF
Sbjct  188  YEGRHTHSPCDDNSSGEHTNCFSSF  212



>emb|CAC39034.1| WRKY-like DNA-binding protein [Oryza sativa]
Length=212

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 7/145 (5%)
 Frame = +1

Query  481  PSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLV--DKGKVKVRRKLREPRFC  654
            P+    ++V T   K  N+         G+ +WWR S+     +KGK+K+RRK+REPRFC
Sbjct  72   PNIGGAEEVATTVTKAGNEST----TCNGSTTWWRGSTMAAAGEKGKMKIRRKMREPRFC  127

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVERLS DCRMVITT
Sbjct  128  FQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITT  187

Query  835  YEGRHNHSPCDDSNSSEH-DCFTSF  906
            YEGRH HSPCDD++S EH +CF+SF
Sbjct  188  YEGRHTHSPCDDNSSGEHTNCFSSF  212



>gb|EAY86917.1| hypothetical protein OsI_08301 [Oryza sativa Indica Group]
Length=212

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 7/145 (5%)
 Frame = +1

Query  481  PSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLV--DKGKVKVRRKLREPRFC  654
            P+    ++V T   K  N+         G+ +WWR S+     +KGK+K+RRK+REPRFC
Sbjct  72   PNIGGAEEVATTVTKAGNEST----TCNGSTTWWRGSTMAAAGEKGKMKIRRKMREPRFC  127

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVERLS DCRMVITT
Sbjct  128  FQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITT  187

Query  835  YEGRHNHSPCDDSNSSEH-DCFTSF  906
            YEGRH HSPCDD++S EH +CF+SF
Sbjct  188  YEGRHTHSPCDDNSSGEHTNCFSSF  212



>ref|XP_004953301.1| PREDICTED: probable WRKY transcription factor 12-like [Setaria 
italica]
Length=228

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 118/152 (78%), Gaps = 12/152 (8%)
 Frame = +1

Query  460  EPQLSNRPSWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSS-SLVDKGKVKVRRKL  636
            +P     PS    D+V T   KG ND           ++WW+ S+ ++ D+GK+KVRRK+
Sbjct  86   KPTADFMPSTVGADEVCTSLTKGCNDSA---------STWWKGSAPTMADRGKMKVRRKM  136

Query  637  REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDC  816
            REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVERLS DC
Sbjct  137  REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDC  196

Query  817  RMVITTYEGRHNHSPC-DDSNSSEH-DCFTSF  906
            RMV+TTYEGRH HSPC DD+ S +H DCF+SF
Sbjct  197  RMVMTTYEGRHTHSPCSDDAASGDHTDCFSSF  228



>gb|ADX60183.1| WRKY transcription factor [Zea mays]
Length=231

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 116/134 (87%), Gaps = 7/134 (5%)
 Frame = +1

Query  526  GANDENCSGNAAEG----NNSWWR-SSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDD  690
            GA  + C+    +G    N++WW+ S++++ ++GK+KVRRK+REPRFCFQTRSDVDVLDD
Sbjct  98   GAETKVCTSLTTKGCNESNSTWWKGSAATIAERGKMKVRRKMREPRFCFQTRSDVDVLDD  157

Query  691  GYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-D  867
            GYKWRKYGQKVVKNSLHPRSY+RCTHSNCRVKKRVERLS DCRMV+TTYEGRH HSPC D
Sbjct  158  GYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVMTTYEGRHTHSPCSD  217

Query  868  DSNSSEH-DCFTSF  906
            D++S +H DCF+SF
Sbjct  218  DASSGDHTDCFSSF  231



>gb|AGQ46321.1| zinc finger transcription factor WRKY12 [Miscanthus lutarioriparius]
Length=233

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 4/119 (3%)
 Frame = +1

Query  562  EGNNSWWRSSSS--LVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS  735
            E N++WW+ S++  + ++GK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS
Sbjct  115  ESNSTWWKGSAAATIAERGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS  174

Query  736  LHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-DDSNSSEH-DCFTSF  906
            LHPRSY+RCTHSNCRVKKRVERLS DCRMV+TTYEGRH HSPC DD++S +H DCF+SF
Sbjct  175  LHPRSYFRCTHSNCRVKKRVERLSTDCRMVMTTYEGRHTHSPCSDDASSGDHTDCFSSF  233



>ref|XP_002452824.1| hypothetical protein SORBIDRAFT_04g033240 [Sorghum bicolor]
 gb|EES05800.1| hypothetical protein SORBIDRAFT_04g033240 [Sorghum bicolor]
Length=234

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 4/119 (3%)
 Frame = +1

Query  562  EGNNSWWRSSSS--LVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS  735
            + N +WW+ S++  + ++GK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS
Sbjct  116  DSNGTWWKGSAATTIAERGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNS  175

Query  736  LHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-DDSNSSEH-DCFTSF  906
            LHPRSY+RCTHSNCRVKKRVERLS DCRMV+TTYEGRH HSPC DD++S++H DCFTSF
Sbjct  176  LHPRSYFRCTHSNCRVKKRVERLSTDCRMVMTTYEGRHTHSPCSDDASSADHTDCFTSF  234



>emb|CDX95615.1| BnaC03g24960D [Brassica napus]
Length=190

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 114/145 (79%), Gaps = 6/145 (4%)
 Frame = +1

Query  490  NNNDQVGTMDPKGANDE--NCSG--NAAEGNNSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND+  N  G  N    +NSWWRSSS   + K KVK+RRKLREPRFC
Sbjct  46   NNLQDGGPLGSKVVNDDQDNIRGGINNDVHSNSWWRSSSESGEMKNKVKIRRKLREPRFC  105

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  106  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  165

Query  835  YEGRHNHSPCDDSNSSEHD-CFTSF  906
            YEGRHNH P DDS S E D C +SF
Sbjct  166  YEGRHNHIPSDDSTSPERDHCLSSF  190



>gb|AIE43865.1| WRKY transcription factor 25 [Gossypium hirsutum]
Length=679

 Score =   211 bits (538),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 146/224 (65%), Gaps = 47/224 (21%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVSFS+   P    H         E GF+QFE+ NQ VMSFL+P          
Sbjct  7    VPNYMLQVSFSSSTPPPQAIH---------ETGFLQFEE-NQ-VMSFLSP----------  45

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDP--KGAN  534
                     +        SN   +T +L F              +NDQVGT+DP  K AN
Sbjct  46   ---------SQPLTTSPVSNTTNSTTALRFI------------THNDQVGTLDPIPKAAN  84

Query  535  DENCSGNAAEGNN-SWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKY  711
            DEN    A +GNN SWWRSS+S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKWRKY
Sbjct  85   DENNCSKANDGNNNSWWRSSAS--EKSKLKVRRKLREPRFCFQTRSDVDVLDDGYKWRKY  142

Query  712  GQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEG  843
            GQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITTYEG
Sbjct  143  GQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEG  186



>emb|CDY30483.1| BnaA04g25840D [Brassica napus]
Length=220

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 115/150 (77%), Gaps = 12/150 (8%)
 Frame = +1

Query  487  WNNNDQVG-TMDPKGAND--ENCSGNAAEGNNS-------WWRSSSSLVDKGKVKVRRKL  636
            ++NN QVG  +  K  ND  EN  G      +S        WRSS  +  K KVK+RRKL
Sbjct  73   FSNNLQVGGPLGSKVVNDDHENIGGGINNDVHSNSCDCICRWRSSGEM--KNKVKIRRKL  130

Query  637  REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDC  816
            REPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDC
Sbjct  131  REPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDC  190

Query  817  RMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            RMVITTYEGRHNH P DDS S +HDC +SF
Sbjct  191  RMVITTYEGRHNHIPSDDSTSPDHDCLSSF  220



>ref|XP_008678893.1| PREDICTED: probable WRKY transcription factor 12 [Zea mays]
 gb|AFW63231.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
Length=235

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +1

Query  562  EGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH  741
            E N++WW++S++  ++GK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH
Sbjct  121  ESNSAWWKASAA--ERGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH  178

Query  742  PRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-DDSNSSEH-DCFTSF  906
            PRSY+RCTHSNCRVKKRVERLS DCRMV+TTYEGRH HSPC DD++S +H DCF+SF
Sbjct  179  PRSYFRCTHSNCRVKKRVERLSTDCRMVMTTYEGRHTHSPCSDDASSGDHTDCFSSF  235



>ref|XP_008363203.1| PREDICTED: probable WRKY transcription factor 12 [Malus domestica]
Length=112

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  622  VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVER  801
            VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVER
Sbjct  18   VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVER  77

Query  802  LSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            LSEDCRMVITTYEGRHNHSPCDDS SSEH+CF+SF
Sbjct  78   LSEDCRMVITTYEGRHNHSPCDDSTSSEHECFSSF  112



>ref|XP_009133687.1| PREDICTED: probable WRKY transcription factor 12 isoform X2 [Brassica 
rapa]
Length=215

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 111/144 (77%), Gaps = 6/144 (4%)
 Frame = +1

Query  490  NNNDQVGTMDPKGANDENCSGNAAEGN----NSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND+  +      N    NSWWRSSS   + K KVK+RRKLREPRFC
Sbjct  73   NNLQGGGPLGSKVVNDDQDNIRGGINNDVHYNSWWRSSSESGEMKNKVKIRRKLREPRFC  132

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  133  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  192

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS   +H C +SF
Sbjct  193  YEGRHNHIPSDDSPERDH-CLSSF  215



>emb|CDX83415.1| BnaA03g20910D [Brassica napus]
Length=188

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 111/144 (77%), Gaps = 6/144 (4%)
 Frame = +1

Query  490  NNNDQVGTMDPKGANDENCSGNAAEGN----NSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND+  +      N    NSWWRSSS   + K KVK+RRKLREPRFC
Sbjct  46   NNLQGGGPLGSKVVNDDQDNIRGGINNDVHYNSWWRSSSESGEMKNKVKIRRKLREPRFC  105

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  106  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  165

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS   +H C +SF
Sbjct  166  YEGRHNHIPSDDSPERDH-CLSSF  188



>ref|NP_001288854.1| probable WRKY transcription factor 12 [Brassica rapa]
 gb|AHB33823.1| WRKY transcription factor 12 [Brassica rapa]
Length=218

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 115/146 (79%), Gaps = 6/146 (4%)
 Frame = +1

Query  487  WNNNDQVG-TMDPKGAND--ENCSG---NAAEGNNSWWRSSSSLVDKGKVKVRRKLREPR  648
            ++NN QVG  +  K  ND  EN  G   N    N+ W  SS S   K KVK+RRKLREPR
Sbjct  73   FSNNLQVGGPLGSKVVNDDHENIGGGINNDVHSNSWWRSSSGSGEMKNKVKIRRKLREPR  132

Query  649  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  828
            FCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVI
Sbjct  133  FCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVI  192

Query  829  TTYEGRHNHSPCDDSNSSEHDCFTSF  906
            TTYEGRHNH P DDS S +HDC +SF
Sbjct  193  TTYEGRHNHIPSDDSTSPDHDCLSSF  218



>ref|XP_010518079.1| PREDICTED: probable WRKY transcription factor 12 [Camelina sativa]
Length=219

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 113/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND--ENCSG---NAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFC  654
            NN    GT+  K  ND  EN  G   N A  N+ W  SS S   K KVK+RRKLREPRFC
Sbjct  76   NNLQGGGTLGSKVVNDDQENFRGGTNNDAHSNSWWRSSSGSGDMKNKVKIRRKLREPRFC  135

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVITT
Sbjct  136  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITT  195

Query  835  YEGRHNHSPCDDSNSSEHDCFTSF  906
            YEGRHNH P DDS S +HDC +SF
Sbjct  196  YEGRHNHIPSDDSTSPDHDCISSF  219



>ref|XP_010508256.1| PREDICTED: probable WRKY transcription factor 12 [Camelina sativa]
Length=222

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVK
Sbjct  123  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVK  182

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNH P DDS S +HDC +SF
Sbjct  183  KRVERLSEDCRMVITTYEGRHNHIPSDDSTSPDHDCISSF  222



>ref|XP_010506408.1| PREDICTED: probable WRKY transcription factor 12 [Camelina sativa]
Length=221

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVK
Sbjct  122  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVK  181

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNH P DDS S +HDC +SF
Sbjct  182  KRVERLSEDCRMVITTYEGRHNHIPSDDSTSPDHDCISSF  221



>tpg|DAA05099.1| TPA_inf: WRKY transcription factor 34 [Oryza sativa]
Length=107

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = +1

Query  604  DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRV  783
            +KGK+K+RRK+REPRFCFQTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCTHSNCRV
Sbjct  6    EKGKMKIRRKMREPRFCFQTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRV  65

Query  784  KKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH-DCFTSF  906
            KKRVERLS DCRMVITTYEGRH HSPCDD++S EH +CF+SF
Sbjct  66   KKRVERLSTDCRMVITTYEGRHTHSPCDDNSSGEHTNCFSSF  107



>ref|XP_006397656.1| hypothetical protein EUTSA_v10001624mg [Eutrema salsugineum]
 gb|ESQ39109.1| hypothetical protein EUTSA_v10001624mg [Eutrema salsugineum]
Length=221

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVK
Sbjct  122  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVK  181

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNH P DDS S +HDC +SF
Sbjct  182  KRVERLSEDCRMVITTYEGRHNHIPSDDSTSPDHDCLSSF  221



>ref|XP_003581484.1| PREDICTED: probable WRKY transcription factor 12 [Brachypodium 
distachyon]
Length=239

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 6/116 (5%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G +SWW+ +    +KGK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  125  GASSWWKGA----EKGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  180

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC--DDSNSSEHDCFTSF  906
            RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH H+PC  DD+   EH    +F
Sbjct  181  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDDAGGGEHTGACAF  236



>ref|XP_004956420.1| PREDICTED: probable WRKY transcription factor 12-like [Setaria 
italica]
Length=236

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +1

Query  565  GNNSWWRSSSSLV-DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH  741
            G++SWW+ S++   +KG++KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH
Sbjct  117  GSSSWWKGSAAAAGEKGRMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLH  176

Query  742  PRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHD  891
            PRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH H+PC D      D
Sbjct  177  PRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDADGAGD  226



>gb|KFK37278.1| hypothetical protein AALP_AA4G236300 [Arabis alpina]
Length=222

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVK
Sbjct  123  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVK  182

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNH P D+S S +HDC +SF
Sbjct  183  KRVERLSEDCRMVITTYEGRHNHIPSDESTSPDHDCLSSF  222



>ref|XP_009143064.1| PREDICTED: probable WRKY transcription factor 12 [Brassica rapa]
Length=215

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVK
Sbjct  116  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVK  175

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRH+H P D+SNS +HDC +SF
Sbjct  176  KRVERLSEDCRMVITTYEGRHSHIPSDESNSPDHDCLSSF  215



>gb|ADD81254.1| WRKY12 [Brassica rapa subsp. pekinensis]
Length=215

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVK
Sbjct  116  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVK  175

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRH+H P D+SNS +HDC +SF
Sbjct  176  KRVERLSEDCRMVITTYEGRHSHIPSDESNSPDHDCLSSF  215



>ref|XP_003572766.2| PREDICTED: probable WRKY transcription factor 12 [Brachypodium 
distachyon]
Length=158

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +1

Query  499  DQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLV--DKGKVKVRRKLREPRFCFQTRSD  672
            ++VGT    G   E  + N     ++WWR S+  V  +KGK+KVRRK+REPRFCFQTRSD
Sbjct  7    EEVGTSITAGVGCEG-ANNGYSSTSTWWRGSAMSVAGEKGKMKVRRKMREPRFCFQTRSD  65

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHPRSY+RCT SNCRVKKRVERLS DCRMVITTYEGRH 
Sbjct  66   VDVLDDGYKWRKYGQKVVKNSLHPRSYFRCTQSNCRVKKRVERLSTDCRMVITTYEGRHT  125

Query  853  HSPCDDSNSSEHD  891
            HSPC D  S   D
Sbjct  126  HSPCSDDASPADD  138



>gb|EMS50538.1| putative WRKY transcription factor 12 [Triticum urartu]
Length=192

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 110/147 (75%), Gaps = 12/147 (8%)
 Frame = +1

Query  490  NNNDQVGTMDPKGAND----ENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCF  657
                + GT   + AN+       +  +  G +SWW+ +    +KGK+KVRRK+REPRFCF
Sbjct  50   GGTGEAGTSAARAANEFASTTTTTTASCHGPSSWWKGA----EKGKMKVRRKMREPRFCF  105

Query  658  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  837
            QTRS+VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY
Sbjct  106  QTRSEVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  165

Query  838  EGRHNHSPCD-DSNSSEHD---CFTSF  906
            EGRH HSPC  D  + +H     FTSF
Sbjct  166  EGRHTHSPCSADDAAGDHTGSCAFTSF  192



>gb|ACD80364.1| WRKY3 transcription factor [Triticum aestivum]
Length=229

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 8/118 (7%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G +SWW+ +    +KGK+KVRRK+REPRFCFQTRS+VDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  116  GPSSWWKGA----EKGKMKVRRKMREPRFCFQTRSEVDVLDDGYKWRKYGQKVVKNSLHP  171

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-DDSNSSEHD---CFTSF  906
            RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH H+PC DD    +H     FTSF
Sbjct  172  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDDAGGDHTGSCAFTSF  229



>emb|CDY71963.1| BnaCnng75330D [Brassica napus]
Length=214

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVK
Sbjct  115  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVK  174

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRH+H P D+S S +HDC +SF
Sbjct  175  KRVERLSEDCRMVITTYEGRHSHIPSDESTSPDHDCLSSF  214



>gb|AJA32886.1| WRKY transcription factor [Brassica oleracea var. capitata]
Length=218

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            + KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVK
Sbjct  119  RNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVK  178

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRHNH P DDS S +HD  +SF
Sbjct  179  KRVERLSEDCRMVITTYEGRHNHIPSDDSTSPDHDYLSSF  218



>ref|NP_001053464.1| Os04g0545000 [Oryza sativa Japonica Group]
 dbj|BAF15378.1| Os04g0545000 [Oryza sativa Japonica Group]
 dbj|BAG93597.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60267.1| WRKY transcription factor [Oryza sativa Japonica Group]
Length=250

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 4/106 (4%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G NSWW+ +    +KGK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  134  GPNSWWKGT----EKGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  189

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRH H+PC D  ++
Sbjct  190  RSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDATT  235



>emb|CAE04349.2| OSJNBb0038F03.13 [Oryza sativa Japonica Group]
 tpg|DAA05101.1| TPA_inf: WRKY transcription factor 36 [Oryza sativa (japonica 
cultivar-group)]
 gb|EEE61434.1| hypothetical protein OsJ_15659 [Oryza sativa Japonica Group]
Length=246

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 4/106 (4%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G NSWW+ +    +KGK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  130  GPNSWWKGT----EKGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  185

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRH H+PC D  ++
Sbjct  186  RSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDATT  231



>emb|CAH67250.1| OSIGBa0101C23.2 [Oryza sativa Indica Group]
 gb|EEC77739.1| hypothetical protein OsI_16855 [Oryza sativa Indica Group]
Length=247

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 4/106 (4%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G NSWW+ +    +KGK+KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  131  GPNSWWKGT----EKGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  186

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            RSYYRCTH+NCRVKKRVERLSEDCRMVITTYEGRH H+PC D  ++
Sbjct  187  RSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDATT  232



>ref|XP_009133686.1| PREDICTED: probable WRKY transcription factor 12 isoform X1 [Brassica 
rapa]
Length=221

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 111/150 (74%), Gaps = 12/150 (8%)
 Frame = +1

Query  490  NNNDQVGTMDPKGANDENCSGNAAEGN----NSWWRSSSSLVD-KGKVKVRRKLREPRFC  654
            NN    G +  K  ND+  +      N    NSWWRSSS   + K KVK+RRKLREPRFC
Sbjct  73   NNLQGGGPLGSKVVNDDQDNIRGGINNDVHYNSWWRSSSESGEMKNKVKIRRKLREPRFC  132

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHP------RSYYRCTHSNCRVKKRVERLSEDC  816
            FQT+SDVDVLDDGYKWRKYGQKVVKNSLHP      RSYYRCTH+NCRVKKRVERLSEDC
Sbjct  133  FQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRCGYTYRSYYRCTHNNCRVKKRVERLSEDC  192

Query  817  RMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            RMVITTYEGRHNH P DDS   +H C +SF
Sbjct  193  RMVITTYEGRHNHIPSDDSPERDH-CLSSF  221



>gb|EMT01578.1| Putative WRKY transcription factor 12 [Aegilops tauschii]
Length=178

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 8/118 (7%)
 Frame = +1

Query  565  GNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            G +SWW+ +    +KGK+KVRRK+REPRFCFQTRS+VDVLDDGYKWRKYGQKVVKNSLHP
Sbjct  65   GPSSWWKGA----EKGKMKVRRKMREPRFCFQTRSEVDVLDDGYKWRKYGQKVVKNSLHP  120

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPC-DDSNSSEHD---CFTSF  906
            RSYYRCTHSNCRVKKRVERL+EDCR+VITTYEGRH H+PC DD    +H     FTSF
Sbjct  121  RSYYRCTHSNCRVKKRVERLAEDCRLVITTYEGRHTHTPCSDDDAGGDHTGSCAFTSF  178



>ref|XP_002448267.1| hypothetical protein SORBIDRAFT_06g024220 [Sorghum bicolor]
 gb|EES12595.1| hypothetical protein SORBIDRAFT_06g024220 [Sorghum bicolor]
Length=248

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  502  QVGTMDPKGANDENCSGNAAEGNNS--WWRSSSSLVDKG-KVKVRRKLREPRFCFQTRSD  672
            + GT   K A +   +     G +S  WW+  ++  +KG ++KVRRK+REPRFCFQTRSD
Sbjct  105  EAGTSVAKAAGEIASTTTTCNGPSSCNWWKGPAAAGEKGGRMKVRRKMREPRFCFQTRSD  164

Query  673  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH 
Sbjct  165  VDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHT  224

Query  853  HSPC  864
            HSPC
Sbjct  225  HSPC  228



>emb|CDY23453.1| BnaC04g49810D [Brassica napus]
Length=218

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 112/146 (77%), Gaps = 6/146 (4%)
 Frame = +1

Query  487  WNNNDQVG-TMDPKGAND--ENCSG---NAAEGNNSWWRSSSSLVDKGKVKVRRKLREPR  648
            ++NN QVG  +  K  ND  EN  G   N    N+ W  SS S   + KVK RRKLREPR
Sbjct  73   FSNNLQVGGPLGSKVVNDDHENIGGGMNNDVHSNSWWRSSSGSGEMRSKVKTRRKLREPR  132

Query  649  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  828
            FCFQT+SDVDVL DGYKWRKYGQKVVKNSLHPRSYYRCTH+NCRVKKRVERLSEDCRMVI
Sbjct  133  FCFQTKSDVDVLADGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVI  192

Query  829  TTYEGRHNHSPCDDSNSSEHDCFTSF  906
            TTYEGRHNH P DDS S +HD  +SF
Sbjct  193  TTYEGRHNHIPSDDSTSPDHDYLSSF  218



>emb|CDY48258.1| BnaC04g05170D [Brassica napus]
Length=215

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K KVK+RRKLREPRFCFQT+SDVDVLDDGYKWRKYGQK+VKNSLHPRSYYRCTH+NCRVK
Sbjct  116  KNKVKIRRKLREPRFCFQTKSDVDVLDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVK  175

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            KRVERLSEDCRMVITTYEGRH+H P D+S S +HD  +SF
Sbjct  176  KRVERLSEDCRMVITTYEGRHSHIPSDESTSPDHDSLSSF  215



>gb|ACN34879.1| unknown [Zea mays]
Length=212

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 98/131 (75%), Gaps = 8/131 (6%)
 Frame = +1

Query  502  QVGTMDPKGANDENCSGNAAEGNNS-----WWRSSSSLV---DKGKVKVRRKLREPRFCF  657
            + GT           +  AA   NS     WW+  ++       G++KVRRK+REPRFCF
Sbjct  64   EAGTSSAAAKATGEIASTAATACNSPSSCNWWKGPAAAAAGEKGGRMKVRRKMREPRFCF  123

Query  658  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  837
            QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMV+TTY
Sbjct  124  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVMTTY  183

Query  838  EGRHNHSPCDD  870
            EGRH HSPC D
Sbjct  184  EGRHTHSPCSD  194



>ref|NP_001151912.1| WRKY36 - superfamily of TFs having WRKY and zinc finger domains 
[Zea mays]
 gb|ACG44923.1| WRKY36 - superfamily of TFs having WRKY and zinc finger domains 
[Zea mays]
Length=252

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 98/131 (75%), Gaps = 8/131 (6%)
 Frame = +1

Query  502  QVGTMDPKGANDENCSGNAAEGNNS-----WWRSSSSLV---DKGKVKVRRKLREPRFCF  657
            + GT           +  AA   NS     WW+  ++       G++KVRRK+REPRFCF
Sbjct  104  EAGTSSAAAKATGEIASTAATACNSPSSCNWWKGPAAAAAGEKGGRMKVRRKMREPRFCF  163

Query  658  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  837
            QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMV+TTY
Sbjct  164  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVMTTY  223

Query  838  EGRHNHSPCDD  870
            EGRH HSPC D
Sbjct  224  EGRHTHSPCSD  234



>tpg|DAA36632.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05803.1| WRKY transcription factor, partial [Zea mays]
Length=284

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 98/131 (75%), Gaps = 8/131 (6%)
 Frame = +1

Query  502  QVGTMDPKGANDENCSGNAAEGNNS-----WWRSSSSLV---DKGKVKVRRKLREPRFCF  657
            + GT           +  AA   NS     WW+  ++       G++KVRRK+REPRFCF
Sbjct  136  EAGTSSAAAKATGEIASTAATACNSPSSCNWWKGPAAAAAGEKGGRMKVRRKMREPRFCF  195

Query  658  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  837
            QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMV+TTY
Sbjct  196  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVMTTY  255

Query  838  EGRHNHSPCDD  870
            EGRH HSPC D
Sbjct  256  EGRHTHSPCSD  266



>tpg|DAA36631.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea 
mays]
Length=103

 Score =   174 bits (441),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  616  VKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRV  795
            +KVRRK+REPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRV
Sbjct  1    MKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRV  60

Query  796  ERLSEDCRMVITTYEGRHNHSPCDD  870
            ERLSEDCRMV+TTYEGRH HSPC D
Sbjct  61   ERLSEDCRMVMTTYEGRHTHSPCSD  85



>gb|KCW76865.1| hypothetical protein EUGRSUZ_D01219 [Eucalyptus grandis]
Length=171

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 120/188 (64%), Gaps = 31/188 (16%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQV+FS   H  H            E+GFV FED NQ V+ FLTP          
Sbjct  12   VPNYDLQVTFSGASHGIH------------EIGFVPFEDQNQ-VLGFLTP----------  48

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                  A    AA   +T+ A   T+ +G  H    L  R SWNN DQVG  DPK  +DE
Sbjct  49   ------APPLIAAGEGATAAATTTTSRVGLGHHN-GLVARSSWNN-DQVGAHDPKAVSDE  100

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            NCS N +EGNNSWWRSS++  +KGK+KVRRKLREPRFCFQTRS+VDVLDDGYKWRKYGQK
Sbjct  101  NCSANPSEGNNSWWRSSTAAAEKGKMKVRRKLREPRFCFQTRSEVDVLDDGYKWRKYGQK  160

Query  721  VVKNSLHP  744
            VVKNSLHP
Sbjct  161  VVKNSLHP  168



>gb|AGQ04203.1| WRKY transcription factor 15 [Jatropha curcas]
 gb|KDP35281.1| hypothetical protein JCGZ_09440 [Jatropha curcas]
Length=249

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  544  CSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKV  723
            C  N   G ++      S +   K+K RRK+REPRFCF+T SD+DVLDDGYKWRKYGQKV
Sbjct  126  CLSNKRNGGDNEHHLGISAMKMKKIKARRKVREPRFCFKTMSDIDVLDDGYKWRKYGQKV  185

Query  724  VKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            VKN+LHPRSYYRCT  NCRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  186  VKNTLHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHSPSHDLEDSQ  239



>ref|XP_002534045.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF28338.1| WRKY transcription factor, putative [Ricinus communis]
Length=103

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+LHPRSYYRCT  NCRVKKR
Sbjct  3    KIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTLHPRSYYRCTQDNCRVKKR  62

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            VERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  63   VERLAEDPRMVITTYEGRHAHSPSHDLEDSQ  93



>ref|XP_010680328.1| PREDICTED: probable WRKY transcription factor 13 [Beta vulgaris 
subsp. vulgaris]
Length=247

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+LHPRSYYRCT  N
Sbjct  140  STMKMKKIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTLHPRSYYRCTQDN  199

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP +D + S+
Sbjct  200  CRVKKRVERLAEDPRMVITTYEGRHIHSPSNDLDESQ  236



>gb|ADE77827.1| unknown [Picea sitchensis]
Length=282

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  568  NNSWWRSSSSL-VDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHP  744
            +N WW +SSS  V   KVKVRRKL EPRFCFQT SDVDVLDDGYKWRKYGQKVVKN+ HP
Sbjct  169  SNLWWGASSSCDVKMKKVKVRRKLMEPRFCFQTMSDVDVLDDGYKWRKYGQKVVKNTHHP  228

Query  745  RSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            RSYYRCT +NCRVKKRVERL++D RMVITTYEGRH HSPC D+ S +HD  +S 
Sbjct  229  RSYYRCTQNNCRVKKRVERLADDPRMVITTYEGRHTHSPCSDTQSEQHDFLSSL  282



>gb|KHG26723.1| putative WRKY transcription factor 13 -like protein [Gossypium 
arboreum]
Length=103

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            ++K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  3    RIKGRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  62

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            VERL+ED RMVITTYEGRH HSP  DS  S+H
Sbjct  63   VERLAEDPRMVITTYEGRHAHSPSHDSEDSQH  94



>gb|ACV92012.2| WRKY transcription factor 10 [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa]
Length=232

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  126  STIKMKKIKARRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  185

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  186  CRVKKRVERLAEDPRMVITTYEGRHAHSPSHDLEESQ  222



>ref|XP_008793465.1| PREDICTED: probable WRKY transcription factor 13 [Phoenix dactylifera]
Length=241

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 104/151 (69%), Gaps = 6/151 (4%)
 Frame = +1

Query  442  LGFSHSEPQLSNRP-SWN-----NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLV  603
            +G S  +   SN P  WN     NN +    +   +N+ N SG +   ++S    S S +
Sbjct  77   IGASAVQRSSSNSPWPWNEEWSLNNKRSSVGEEHHSNNRNNSGTSNGPSSSINCLSVSAL  136

Query  604  DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRV  783
               K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRV
Sbjct  137  RMKKMKARRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRV  196

Query  784  KKRVERLSEDCRMVITTYEGRHNHSPCDDSN  876
            KKRVERL+ED RMVITTYEGRH HSP  D +
Sbjct  197  KKRVERLAEDPRMVITTYEGRHAHSPSHDED  227



>ref|NP_001237342.1| WRKY40 [Glycine max]
 gb|ABC26914.1| WRKY40 [Glycine max]
Length=235

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  128  SAMKMKKIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  187

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP +D   S+
Sbjct  188  CRVKKRVERLAEDPRMVITTYEGRHVHSPSNDLEDSQ  224



>gb|KHN29128.1| Putative WRKY transcription factor 13 [Glycine soja]
Length=235

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  128  SAMKMKKIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  187

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP +D   S+
Sbjct  188  CRVKKRVERLAEDPRMVITTYEGRHVHSPSNDLEDSQ  224



>ref|XP_002306363.2| WRKY transcription factor 13 family protein [Populus trichocarpa]
 gb|ABK93467.1| unknown [Populus trichocarpa]
 gb|EEE93359.2| WRKY transcription factor 13 family protein [Populus trichocarpa]
Length=232

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  126  STIKLKKIKARRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  185

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  186  CRVKKRVERLAEDPRMVITTYEGRHAHSPSHDLEESQ  222



>ref|XP_002310044.1| hypothetical protein POPTR_0007s06930g [Populus trichocarpa]
 ref|XP_006380480.1| WRKY transcription factor 13 family protein [Populus trichocarpa]
 gb|EEE90494.1| hypothetical protein POPTR_0007s06930g [Populus trichocarpa]
 gb|ERP58277.1| WRKY transcription factor 13 family protein [Populus trichocarpa]
Length=233

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  127  SSIKMKKIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  186

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  187  CRVKKRVERLAEDPRMVITTYEGRHAHSPSLDLEESQ  223



>ref|XP_010268590.1| PREDICTED: probable WRKY transcription factor 13 [Nelumbo nucifera]
Length=224

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   KVK RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  118  SAMKMKKVKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  177

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D ++S+
Sbjct  178  CRVKKRVERLAEDPRMVITTYEGRHIHSPSHDLDNSQ  214



>emb|CDP12868.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            + +   K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  111  ATIKMKKIKARRKVREPRFCFKTLSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  170

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D + S+
Sbjct  171  CRVKKRVERLAEDPRMVITTYEGRHIHSPSQDEDDSQ  207



>gb|AIE43864.1| WRKY transcription factor 21 [Gossypium hirsutum]
Length=215

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   ++K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  109  SAMKMKRIKGRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  168

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            CRVKKRVER +ED RMVITTYEGRH HSP  DS  S H
Sbjct  169  CRVKKRVERQAEDPRMVITTYEGRHAHSPAQDSEDSHH  206



>gb|KDO40261.1| hypothetical protein CISIN_1g026950mg [Citrus sinensis]
Length=230

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SD+DVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  129  KIKSRRKVREPRFCFKTMSDIDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  188

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            VERL+ED RMVITTYEGRH HSP  D   S
Sbjct  189  VERLAEDPRMVITTYEGRHVHSPSHDQEDS  218



>ref|XP_006464513.1| PREDICTED: probable WRKY transcription factor 13-like isoform 
X1 [Citrus sinensis]
Length=230

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SD+DVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  129  KIKSRRKVREPRFCFKTMSDIDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  188

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            VERL+ED RMVITTYEGRH HSP  D   S
Sbjct  189  VERLAEDPRMVITTYEGRHVHSPSHDQEDS  218



>gb|ACU14983.1| unknown [Glycine max]
Length=235

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K++ RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  128  SAMKMKKIEARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  187

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP +D   S+
Sbjct  188  CRVKKRVERLAEDPRMVITTYEGRHVHSPSNDLEDSQ  224



>ref|XP_007048165.1| WRKY DNA-binding protein 13 [Theobroma cacao]
 gb|EOX92322.1| WRKY DNA-binding protein 13 [Theobroma cacao]
Length=226

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   ++K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  120  SAMKMKRIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  179

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  180  CRVKKRVERLAEDPRMVITTYEGRHVHSPSHDLEDSQ  216



>ref|XP_002279024.1| PREDICTED: probable WRKY transcription factor 13 [Vitis vinifera]
 emb|CBI21534.3| unnamed protein product [Vitis vinifera]
 gb|AFH53058.1| WRKY13 transcription factor [Vitis amurensis]
Length=226

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  120  SAMKMKKIKARRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  179

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  180  CRVKKRVERLAEDPRMVITTYEGRHIHSPSHDLEESQ  216



>ref|XP_006464514.1| PREDICTED: probable WRKY transcription factor 13-like isoform 
X2 [Citrus sinensis]
Length=200

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SD+DVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  99   KIKSRRKVREPRFCFKTMSDIDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  158

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            VERL+ED RMVITTYEGRH HSP  D   S
Sbjct  159  VERLAEDPRMVITTYEGRHVHSPSHDQEDS  188



>ref|XP_010261027.1| PREDICTED: probable WRKY transcription factor 13 [Nelumbo nucifera]
Length=223

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            KVK RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  122  KVKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  181

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            VERL+ED RMVITTYEGRH HSP  D + S
Sbjct  182  VERLAEDPRMVITTYEGRHVHSPSHDLDQS  211



>ref|XP_011100913.1| PREDICTED: probable WRKY transcription factor 13 [Sesamum indicum]
Length=225

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  119  SAMKMKKIKGRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  178

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL++D RMVITTYEGRH HSP  D + S+
Sbjct  179  CRVKKRVERLADDPRMVITTYEGRHIHSPSHDEDDSQ  215



>ref|XP_011021959.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
 ref|XP_011021960.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
 ref|XP_011021961.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
 ref|XP_011021962.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
 ref|XP_011021963.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
Length=232

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKV KN+ HPRSYYRCT  N
Sbjct  126  STIKLKKIKARRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVGKNTQHPRSYYRCTQDN  185

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  186  CRVKKRVERLAEDPRMVITTYEGRHAHSPSHDLEESQ  222



>ref|XP_011025576.1| PREDICTED: probable WRKY transcription factor 13 [Populus euphratica]
Length=232

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKV KN+ HPRSYYRCT  N
Sbjct  126  SSIKMKKIKARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVGKNTQHPRSYYRCTQDN  185

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  186  CRVKKRVERLAEDPRMVITTYEGRHAHSPSLDLEESQ  222



>ref|XP_010915067.1| PREDICTED: probable WRKY transcription factor 13 [Elaeis guineensis]
Length=240

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  589  SSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH  768
            S S +   K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT 
Sbjct  132  SVSALRMKKMKARRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQ  191

Query  769  SNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSN  876
             NCRVKKRVERL+ED RMVITTYEGRH HSP  D +
Sbjct  192  DNCRVKKRVERLAEDPRMVITTYEGRHAHSPSHDED  227



>ref|XP_010927976.1| PREDICTED: probable WRKY transcription factor 13 [Elaeis guineensis]
Length=237

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 3/98 (3%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K R+K+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT SNC+VKKR
Sbjct  138  KLKTRKKVREPRFCFKTLSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTESNCQVKKR  197

Query  793  VERLSEDCRMVITTYEGRHNHSPC---DDSNSSEHDCF  897
            VERL+ED RMVITTYEGRH HSP    D+S +S+H  F
Sbjct  198  VERLAEDPRMVITTYEGRHIHSPSHDDDESRASDHINF  235



>ref|XP_006645572.1| PREDICTED: probable WRKY transcription factor 13-like, partial 
[Oryza brachyantha]
Length=227

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  129  KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  188

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RLS DCRMVITTYEGRH HSP
Sbjct  189  RLSTDCRMVITTYEGRHVHSP  209



>emb|CAN69500.1| hypothetical protein VITISV_014490 [Vitis vinifera]
Length=104

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 81/96 (84%), Gaps = 3/96 (3%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  5    KIKARRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  64

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSSEHDCFT  900
            VERL+ED RMVITTYEGRH HSP   S+  E  C T
Sbjct  65   VERLAEDPRMVITTYEGRHIHSP---SHDLEEMCVT  97



>ref|XP_010925080.1| PREDICTED: probable WRKY transcription factor 13 [Elaeis guineensis]
Length=235

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            KVK R+ +REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKK+
Sbjct  137  KVKTRKNVREPRFCFKTLSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTGDNCRVKKK  196

Query  793  VERLSEDCRMVITTYEGRHNHSPC---DDSNSSEHDCF  897
            VERL+ED RMVITTYEGRH HSP    DDS +S+H  F
Sbjct  197  VERLAEDPRMVITTYEGRHTHSPSHDEDDSRASDHINF  234



>ref|XP_004237476.1| PREDICTED: probable WRKY transcription factor 13 [Solanum lycopersicum]
Length=234

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  592  SSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHS  771
            SS+  K     RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  
Sbjct  127  SSIKMKKIKSSRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQD  186

Query  772  NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            NCRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  187  NCRVKKRVERLAEDPRMVITTYEGRHVHSPSQDEEDSQ  224



>ref|XP_009630231.1| PREDICTED: probable WRKY transcription factor 13 [Nicotiana tomentosiformis]
Length=228

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL
Sbjct  132  RRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERL  191

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSE  885
            +ED RMVITTYEGRH HSP  D   S+
Sbjct  192  AEDPRMVITTYEGRHVHSPSLDEEDSQ  218



>ref|XP_010027754.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
13 [Eucalyptus grandis]
Length=264

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  161  SALKMKKIKGRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  220

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            CRVKKRVERL+ED RMVITTYEGRH     +DS +S
Sbjct  221  CRVKKRVERLAEDPRMVITTYEGRHXSQDVEDSQAS  256



>ref|XP_009782635.1| PREDICTED: probable WRKY transcription factor 28 isoform X1 [Nicotiana 
sylvestris]
Length=225

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL
Sbjct  129  RRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERL  188

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSE  885
            +ED RMVITTYEGRH HSP  D   S+
Sbjct  189  AEDPRMVITTYEGRHVHSPSLDEEDSQ  215



>ref|XP_008808698.1| PREDICTED: probable WRKY transcription factor 13 [Phoenix dactylifera]
Length=236

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +1

Query  448  FSHSEPQLSNRPSWNNNDQVGTMDPK----GANDENCSGNAAEGNNSWWRSSSSLVDKGK  615
            F  S  Q S+   W+ ++Q G +  K    GA D++   N +  N+   R     +   K
Sbjct  79   FGASSEQRSSNNLWSWSEQEGDLGDKRSSAGAEDDHNKKNNSS-NHDIHRLPVGAIGMKK  137

Query  616  VKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRV  795
            VK R+ +R+PRFCF+T S+VDVLDDGYKWRKYGQK VKN+ HPRSYYRCT  NCRVKKRV
Sbjct  138  VKTRKNVRDPRFCFKTLSEVDVLDDGYKWRKYGQKFVKNTQHPRSYYRCTEDNCRVKKRV  197

Query  796  ERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            ER +ED RMVITTYEGRH HSP  D + S
Sbjct  198  ERFAEDPRMVITTYEGRHTHSPSHDEDDS  226



>ref|XP_004288129.1| PREDICTED: probable WRKY transcription factor 13-like [Fragaria 
vesca subsp. vesca]
Length=243

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +1

Query  613  KVK-VRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKK  789
            K+K +RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKK
Sbjct  142  KIKAIRRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTMDNCRVKK  201

Query  790  RVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            RVERL+ED RMVITTYEGRH HSP  D   SE
Sbjct  202  RVERLAEDPRMVITTYEGRHAHSPSHDLEDSE  233



>ref|XP_010086912.1| putative WRKY transcription factor 13 [Morus notabilis]
 gb|EXB24793.1| putative WRKY transcription factor 13 [Morus notabilis]
Length=257

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  151  SAMKMKKIKGRRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  210

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED RMVITTYEGRH HSP  D   S+
Sbjct  211  CRVKKRVERLAEDPRMVITTYEGRHVHSPSHDLEDSQ  247



>ref|XP_009354059.1| PREDICTED: probable WRKY transcription factor 13 [Pyrus x bretschneideri]
 ref|XP_009354060.1| PREDICTED: probable WRKY transcription factor 13 [Pyrus x bretschneideri]
Length=272

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +1

Query  529  ANDENC-----SGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDG  693
             +DE C     S    + ++ +    S++  K    +RRK+REPRFCF+T SDVDVLDDG
Sbjct  137  VSDEYCLNSKRSSGGDDSHHPYLGGLSAMKMKKMKAIRRKVREPRFCFKTLSDVDVLDDG  196

Query  694  YKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            YKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  197  YKWRKYGQKVVKNTQHPRSYYRCTMDNCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  255



>ref|XP_008232356.1| PREDICTED: probable WRKY transcription factor 13 [Prunus mume]
Length=239

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  SSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHS  771
            S++  K    +RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  
Sbjct  130  SAMKMKKMKAIRRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTMD  189

Query  772  NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  190  NCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  222



>ref|XP_008392017.1| PREDICTED: probable WRKY transcription factor 13 [Malus domestica]
Length=313

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +1

Query  529  ANDENC-----SGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDG  693
             +DE C     S    + ++ +    S++  K    +RRK+REPRFCF+T SDVDVLDDG
Sbjct  178  VSDEYCLSSKRSSGGDDSHHPYLGGLSAMKMKKMKAIRRKVREPRFCFKTLSDVDVLDDG  237

Query  694  YKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            YKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  238  YKWRKYGQKVVKNTQHPRSYYRCTMDNCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  296



>ref|XP_008794985.1| PREDICTED: probable WRKY transcription factor 13 [Phoenix dactylifera]
Length=289

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 3/98 (3%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K R+K+REPRFCF+T S+VDVLDDGYKWRKYGQK+VKN+ HPRSYYRCT SNC+VKKR
Sbjct  190  KLKARKKVREPRFCFKTLSEVDVLDDGYKWRKYGQKIVKNTQHPRSYYRCTESNCQVKKR  249

Query  793  VERLSEDCRMVITTYEGRHNHSPC---DDSNSSEHDCF  897
            VERL+ED RMVITTYEGRH HSP    D+  +S+H  F
Sbjct  250  VERLAEDPRMVITTYEGRHLHSPSRDEDELRASDHISF  287



>ref|XP_002455053.1| hypothetical protein SORBIDRAFT_03g003640 [Sorghum bicolor]
 gb|EES00173.1| hypothetical protein SORBIDRAFT_03g003640 [Sorghum bicolor]
Length=295

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  196  KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  255

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RL+ED RMVITTYEGRH HSP
Sbjct  256  RLAEDPRMVITTYEGRHVHSP  276



>ref|XP_009354053.1| PREDICTED: probable WRKY transcription factor 13 [Pyrus x bretschneideri]
Length=308

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +1

Query  529  ANDENC-----SGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDG  693
             +DE C     S    + ++ +    S++  K    +RRK+REPRFCF+T SDVDVLDDG
Sbjct  173  VSDEYCLNSKRSSGGDDSHHPYLGGLSAMKMKKMKAIRRKVREPRFCFKTLSDVDVLDDG  232

Query  694  YKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            YKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  233  YKWRKYGQKVVKNTQHPRSYYRCTMDNCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  291



>gb|KHN34020.1| Putative WRKY transcription factor 13 [Glycine soja]
Length=227

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SD+DVLDDGYKWRKYGQKVVK++ HPRSYYRC   NCRVKKR
Sbjct  135  KIKARRKVREPRFCFKTMSDMDVLDDGYKWRKYGQKVVKSTHHPRSYYRCIQDNCRVKKR  194

Query  793  VERLSEDCRMVITTYEGRHNHSPCDD  870
            VER +ED RMVITTYEGRH HSP +D
Sbjct  195  VERFAEDPRMVITTYEGRHVHSPSND  220



>ref|XP_007208202.1| hypothetical protein PRUPE_ppa020629mg [Prunus persica]
 gb|EMJ09401.1| hypothetical protein PRUPE_ppa020629mg [Prunus persica]
Length=231

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  SSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHS  771
            S++  K    +RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  
Sbjct  122  SAMKMKKMKAIRRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTMD  181

Query  772  NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  182  NCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  214



>ref|XP_004148455.1| PREDICTED: probable WRKY transcription factor 12-like [Cucumis 
sativus]
 gb|KGN62098.1| hypothetical protein Csa_2G297220 [Cucumis sativus]
Length=246

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRF F+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  +CRVKKRVERL
Sbjct  150  RRKVREPRFSFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDHCRVKKRVERL  209

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSE  885
            +ED RMVITTYEGRH HSP  DS  SE
Sbjct  210  AEDPRMVITTYEGRHVHSPSHDSEDSE  236



>ref|XP_008365254.1| PREDICTED: probable WRKY transcription factor 13 [Malus domestica]
 gb|ADL36863.1| WRKY domain class transcription factor [Malus domestica]
Length=270

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  SSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHS  771
            S++  K    +RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  
Sbjct  161  SAMKMKKMKAIRRKVREPRFCFKTLSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTMD  220

Query  772  NCRVKKRVERLSEDCRMVITTYEGRHNHSPCDD  870
            NCRVKKRVERL+ED RMVITTYEGRH HSP  D
Sbjct  221  NCRVKKRVERLAEDPRMVITTYEGRHVHSPSHD  253



>gb|ADU52530.1| WRKY protein [Cucumis sativus]
Length=239

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRF F+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  +CRVKKRVERL
Sbjct  143  RRKVREPRFSFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDHCRVKKRVERL  202

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSE  885
            +ED RMVITTYEGRH HSP  DS  SE
Sbjct  203  AEDPRMVITTYEGRHVHSPSHDSEDSE  229



>ref|XP_008457912.1| PREDICTED: probable WRKY transcription factor 13 [Cucumis melo]
Length=248

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRF F+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  +CRVKKRVERL
Sbjct  152  RRKVREPRFSFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDHCRVKKRVERL  211

Query  805  SEDCRMVITTYEGRHNHSPCDDSNSSE  885
            +ED RMVITTYEGRH HSP  DS  SE
Sbjct  212  AEDPRMVITTYEGRHVHSPSHDSEDSE  238



>ref|XP_008440122.1| PREDICTED: probable WRKY transcription factor 12 [Cucumis melo]
Length=237

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +1

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            N  G+  + N+   R   S +   ++K R+K+REPRF F+T +DVDVLDDGYKWRKYGQK
Sbjct  108  NYGGDDDKENDGKPRLRVSTMKMKRIKGRKKVREPRFSFKTMTDVDVLDDGYKWRKYGQK  167

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            VVKN+LHPRSYYRCT  NC+VKKRVERL++D RMVITTYEGRH HSP D
Sbjct  168  VVKNTLHPRSYYRCTEENCKVKKRVERLADDPRMVITTYEGRHAHSPSD  216



>gb|AHC54607.1| WRKY2 [Chrysanthemum x morifolium]
Length=200

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K K RRK+REPRFCF+T SDVD+LDDGYKWRKYGQKVVKN+ HPRSYYRCT   C VKKR
Sbjct  98   KFKSRRKVREPRFCFKTMSDVDILDDGYKWRKYGQKVVKNTQHPRSYYRCTQDTCHVKKR  157

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            VERL +D RMVITTYEGRH HSP  + + SE
Sbjct  158  VERLVDDPRMVITTYEGRHAHSPSQNEDDSE  188



>ref|XP_007137585.1| hypothetical protein PHAVU_009G138600g [Phaseolus vulgaris]
 gb|ESW09579.1| hypothetical protein PHAVU_009G138600g [Phaseolus vulgaris]
Length=235

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL
Sbjct  139  RRKVREPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERL  198

Query  805  SEDCRMVITTYEGRHNHSPCDD  870
            +ED RMVITTYEGRH HSP ++
Sbjct  199  AEDPRMVITTYEGRHVHSPSNE  220



>gb|AIE43900.1| WRKY transcription factor 116 [Gossypium hirsutum]
Length=222

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   ++K RRK+REPRFC +T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  N
Sbjct  115  SAMKMKRIKARRKVREPRFCIKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDN  174

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSE  885
            CRVKKRVERL+ED  MVITTYEGRH HSP  D + S+
Sbjct  175  CRVKKRVERLAEDPGMVITTYEGRHVHSPSHDLDDSQ  211



>dbj|BAG98515.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70062.1| hypothetical protein OsI_00664 [Oryza sativa Indica Group]
 gb|EEE54001.1| hypothetical protein OsJ_00642 [Oryza sativa Japonica Group]
Length=280

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  182  KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  241

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RL+ED RMVITTYEGRH HSP
Sbjct  242  RLAEDPRMVITTYEGRHVHSP  262



>ref|XP_007139655.1| hypothetical protein PHAVU_008G0481000g, partial [Phaseolus vulgaris]
 gb|ESW11649.1| hypothetical protein PHAVU_008G0481000g, partial [Phaseolus vulgaris]
Length=169

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 122/188 (65%), Gaps = 28/188 (15%)
 Frame = +1

Query  184  PNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgs  363
            PNY LQVSF+      H            E+GFVQ+E++   V+ FL+           S
Sbjct  9    PNYELQVSFTNTPQAIH------------ELGFVQYEENQ--VLGFLS---------PSS  45

Query  364  sscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDEN  543
             S S+  S +       +      A++GF +  P ++   +WNN DQVGT+DPK A++EN
Sbjct  46   QSQSSHLSQSLNTDVVVNTTTTTAATIGFMNHTPLVTK--TWNN-DQVGTLDPKAADEEN  102

Query  544  CSGNAAEGNNS-WWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
            C+ NA+EGNN+ WWRS+++  +K KVK+RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  103  CTENASEGNNNVWWRSAAA-TEKNKVKIRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  161

Query  721  VVKNSLHP  744
            VVKNSLHP
Sbjct  162  VVKNSLHP  169



>ref|NP_001267570.1| probable WRKY transcription factor 13-like [Cucumis sativus]
 gb|ADU52523.1| WRKY protein [Cucumis sativus]
Length=162

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  568  NNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPR  747
            N+   R   S +   ++K R+K+REPRF F+T +DVDVLDDGYKWRKYGQKVVKN+LHPR
Sbjct  42   NDGKPRLRVSTMKMKRIKGRKKVREPRFSFKTMTDVDVLDDGYKWRKYGQKVVKNTLHPR  101

Query  748  SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            SYYRCT  NC+VKKRVERL++D RMVITTYEGRH HSP D
Sbjct  102  SYYRCTEENCKVKKRVERLADDPRMVITTYEGRHAHSPSD  141



>dbj|BAD67781.1| putative WRKY DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAD68054.1| putative WRKY DNA-binding protein [Oryza sativa Japonica Group]
 tpg|DAA05641.1| TPA_inf: WRKY transcription factor 79 [Oryza sativa (japonica 
cultivar-group)]
Length=271

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  173  KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  232

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RL+ED RMVITTYEGRH HSP
Sbjct  233  RLAEDPRMVITTYEGRHVHSP  253



>gb|KCW54344.1| hypothetical protein EUGRSUZ_I00305 [Eucalyptus grandis]
Length=273

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  167  KIKGRRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  226

Query  793  VERLSEDCRMVITTYEGRH  849
            VERL+ED RMVITTYEGRH
Sbjct  227  VERLAEDPRMVITTYEGRH  245



>ref|XP_010555312.1| PREDICTED: probable WRKY transcription factor 13 [Tarenaya hassleriana]
Length=277

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S++D+LDDGY+WRKYGQKVVKN+ HPRSYYRCT  NCRVKKR
Sbjct  176  KLKSRRKVREPRFCFKTLSEIDILDDGYRWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKR  235

Query  793  VERLSEDCRMVITTYEGRHNHSPCDDSNSS  882
            VERL++D RMVITTYEGRH HSP  D + S
Sbjct  236  VERLADDPRMVITTYEGRHVHSPSHDHDDS  265



>ref|NP_195651.1| putative WRKY transcription factor 13 [Arabidopsis thaliana]
 sp|Q9SVB7.1|WRK13_ARATH RecName: Full=Probable WRKY transcription factor 13; AltName: 
Full=WRKY DNA-binding protein 13 [Arabidopsis thaliana]
 gb|AAL13042.1|AF421153_1 WRKY transcription factor 13 [Arabidopsis thaliana]
 emb|CAB44676.1| putative WRKY DNA-binding protein [Arabidopsis thaliana]
 emb|CAB80604.1| putative WRKY DNA-binding protein [Arabidopsis thaliana]
 dbj|BAH30567.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE87071.1| putative WRKY transcription factor 13 [Arabidopsis thaliana]
Length=304

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 4/96 (4%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  199  KLKTRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  258

Query  793  VERLSEDCRMVITTYEGRHNHSPC----DDSNSSEH  888
            VERL++D RMVITTYEGRH HSP     DDS S+ H
Sbjct  259  VERLADDPRMVITTYEGRHLHSPSNHLDDDSLSTSH  294



>gb|KGN48415.1| hypothetical protein Csa_6G486880 [Cucumis sativus]
Length=244

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  568  NNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPR  747
            N+   R   S +   ++K R+K+REPRF F+T +DVDVLDDGYKWRKYGQKVVKN+LHPR
Sbjct  124  NDGKPRLRVSTMKMKRIKGRKKVREPRFSFKTMTDVDVLDDGYKWRKYGQKVVKNTLHPR  183

Query  748  SYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            SYYRCT  NC+VKKRVERL++D RMVITTYEGRH HSP D
Sbjct  184  SYYRCTEENCKVKKRVERLADDPRMVITTYEGRHAHSPSD  223



>gb|AJA32895.1| WRKY transcription factor [Brassica oleracea var. capitata]
Length=282

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  178  KLKTRRKVREPRFCFETLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKR  237

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  238  VERLADDPRMVITTYEGRHLHSPSN  262



>gb|AIE43897.1| WRKY transcription factor 45 [Gossypium hirsutum]
Length=168

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 114/190 (60%), Gaps = 41/190 (22%)
 Frame = +1

Query  187  NYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgss  366
            NY LQVSFSTP   +             EMGFVQFE+ NQ V+S L              
Sbjct  10   NYELQVSFSTPQPIN-------------EMGFVQFEE-NQ-VLSLLA-------------  41

Query  367  scsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDEN-  543
               ++     +   +T+     + ++GF+          + NNN  V T DPK ANDEN 
Sbjct  42   LAHSSHHHQISQPLNTTTTTTNSTAMGFT----------THNNNQVVNTEDPKAANDENN  91

Query  544  CSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKV  723
            C   A +GNNSWWRSS+S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK 
Sbjct  92   CPSKANDGNNSWWRSSAS--EKSKLKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKG  149

Query  724  VKNSLHPRSY  753
            VKNSLHPRSY
Sbjct  150  VKNSLHPRSY  159



>emb|CDX72701.1| BnaC07g47230D [Brassica napus]
Length=282

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  178  KLKTRRKVREPRFCFETLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKR  237

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  238  VERLADDPRMVITTYEGRHLHSPSN  262



>gb|AAQ20912.1| WRKY12 [Oryza sativa Japonica Group]
Length=409

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  98   KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  157

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RL+ED RMVITTYEGRH HSP
Sbjct  158  RLAEDPRMVITTYEGRHVHSP  178



>ref|NP_001042221.1| Os01g0182700 [Oryza sativa Japonica Group]
 dbj|BAF04135.1| Os01g0182700 [Oryza sativa Japonica Group]
Length=424

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVE
Sbjct  113  KARRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVE  172

Query  799  RLSEDCRMVITTYEGRHNHSP  861
            RL+ED RMVITTYEGRH HSP
Sbjct  173  RLAEDPRMVITTYEGRHVHSP  193



>ref|XP_003602502.1| WRKY transcription factor [Medicago truncatula]
 gb|AES72753.1| WRKY family transcription factor [Medicago truncatula]
Length=244

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  151  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  210

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  211  PRMVITTYEGRHAHSPSNELEESQ  234



>ref|XP_007159778.1| hypothetical protein PHAVU_002G266400g [Phaseolus vulgaris]
 gb|ESW31772.1| hypothetical protein PHAVU_002G266400g [Phaseolus vulgaris]
Length=229

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  136  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  195

Query  814  CRMVITTYEGRHNHSPCDD  870
             RMVITTYEGRH HSP +D
Sbjct  196  PRMVITTYEGRHVHSPSND  214



>ref|XP_003565434.1| PREDICTED: probable WRKY transcription factor 12 [Brachypodium 
distachyon]
Length=260

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            RRK+REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL
Sbjct  164  RRKVREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTHHPRSYYRCTQDKCRVKKRVERL  223

Query  805  SEDCRMVITTYEGRHNHSP  861
            +ED RMVITTYEGRH HSP
Sbjct  224  AEDPRMVITTYEGRHVHSP  242



>ref|XP_006411744.1| hypothetical protein EUTSA_v10025869mg [Eutrema salsugineum]
 gb|ESQ53197.1| hypothetical protein EUTSA_v10025869mg [Eutrema salsugineum]
Length=295

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  595  SLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSN  774
            S +   K+K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   
Sbjct  185  STLKMKKLKTRRKVREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDK  244

Query  775  CRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            CRVKKRVERL++D RMVITTYEGRH HSP +
Sbjct  245  CRVKKRVERLADDPRMVITTYEGRHLHSPSN  275



>ref|NP_001132878.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
 gb|ACF81905.1| unknown [Zea mays]
 tpg|DAA53144.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04399.1| WRKY transcription factor, partial [Zea mays]
Length=293

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  199  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  258

Query  814  CRMVITTYEGRHNHSPCDDSN  876
             RMVITTYEGRH HSP  D +
Sbjct  259  PRMVITTYEGRHVHSPSRDED  279



>ref|XP_009121710.1| PREDICTED: probable WRKY transcription factor 13 [Brassica rapa]
 emb|CDY41978.1| BnaA01g05500D [Brassica napus]
Length=298

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 5/103 (5%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT + CRVKKR
Sbjct  194  KLKTRRKVREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQNKCRVKKR  253

Query  793  VERLSEDCRMVITTYEGRHNHSPC----DDSNS-SEHDCFTSF  906
            VERL++D RMVITTYEGRH H P     DDS S S H   ++F
Sbjct  254  VERLADDPRMVITTYEGRHLHPPSNHLDDDSLSFSHHSPLSNF  296



>ref|XP_003602503.1| WRKY transcription factor [Medicago truncatula]
 gb|AES72754.1| WRKY family transcription factor [Medicago truncatula]
Length=220

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  127  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  186

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  187  PRMVITTYEGRHAHSPSNELEESQ  210



>ref|NP_001288884.1| probable WRKY transcription factor 13 [Brassica rapa]
 gb|AHB33824.1| WRKY transcription factor 13 [Brassica rapa]
 emb|CDY53184.1| BnaA06g40630D [Brassica napus]
Length=293

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   C VKKR
Sbjct  189  KLKTRRKVREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCSVKKR  248

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL+ED RMVITTYEGRH HSP +
Sbjct  249  VERLAEDPRMVITTYEGRHLHSPSN  273



>ref|XP_006842206.1| hypothetical protein AMTR_s00078p00171140 [Amborella trichopoda]
 gb|ERN03881.1| hypothetical protein AMTR_s00078p00171140 [Amborella trichopoda]
Length=215

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  640  EPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCR  819
            EPRFCF+T SD+DVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED R
Sbjct  125  EPRFCFKTMSDIDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPR  184

Query  820  MVITTYEGRHNHSPCDDSNSSEHDCFTSF  906
            MVITTYEGRH HSP  D+ +S      +F
Sbjct  185  MVITTYEGRHVHSPSHDTENSPTSSHINF  213



>ref|XP_003523252.2| PREDICTED: probable WRKY transcription factor 13 isoform X1 [Glycine 
max]
Length=234

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  141  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  200

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  201  PRMVITTYEGRHVHSPSNELEDSQ  224



>ref|XP_002868904.1| hypothetical protein ARALYDRAFT_490719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45163.1| hypothetical protein ARALYDRAFT_490719 [Arabidopsis lyrata subsp. 
lyrata]
Length=303

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  199  KLKTRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  258

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  259  VERLADDPRMVITTYEGRHLHSPSN  283



>gb|KHN09559.1| Putative WRKY transcription factor 13 [Glycine soja]
Length=236

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  143  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  202

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  203  PRMVITTYEGRHVHSPSNELEDSQ  226



>gb|ABS18441.1| WRKY45 [Glycine max]
Length=140

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  47   VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  106

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  107  PRMVITTYEGRHVHSPSNELEYSQ  130



>ref|XP_010431912.1| PREDICTED: probable WRKY transcription factor 13 [Camelina sativa]
Length=302

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  198  KLKTRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  257

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  258  VERLADDPRMVITTYEGRHLHSPSN  282



>ref|XP_003526838.2| PREDICTED: probable WRKY transcription factor 13-like isoform 
X1 [Glycine max]
Length=236

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  143  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  202

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  203  PRMVITTYEGRHVHSPSNELEDSQ  226



>ref|XP_004502877.1| PREDICTED: probable WRKY transcription factor 13-like [Cicer 
arietinum]
Length=234

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  141  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  200

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  201  PRMVITTYEGRHVHSPSNELEDSQ  224



>ref|XP_010446487.1| PREDICTED: probable WRKY transcription factor 13 [Camelina sativa]
Length=302

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  198  KLKTRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  257

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  258  VERLADDPRMVITTYEGRHLHSPSN  282



>ref|XP_006284053.1| hypothetical protein CARUB_v10005178mg, partial [Capsella rubella]
 gb|EOA16951.1| hypothetical protein CARUB_v10005178mg, partial [Capsella rubella]
Length=343

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  239  KLKTRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  298

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  299  VERLADDPRMVITTYEGRHLHSPSN  323



>ref|XP_009101879.1| PREDICTED: probable WRKY transcription factor 13 [Brassica rapa]
Length=331

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            ++K RRK+REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   C VKKR
Sbjct  227  RLKTRRKVREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCSVKKR  286

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL+ED RMVITTYEGRH HSP +
Sbjct  287  VERLAEDPRMVITTYEGRHLHSPSN  311



>ref|XP_010437064.1| PREDICTED: probable WRKY transcription factor 13 [Camelina sativa]
Length=303

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+K RRK+REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKR
Sbjct  199  KLKSRRKVREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKR  258

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            VERL++D RMVITTYEGRH HSP +
Sbjct  259  VERLADDPRMVITTYEGRHLHSPSN  283



>ref|XP_004968441.1| PREDICTED: probable WRKY transcription factor 13-like [Setaria 
italica]
Length=291

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  197  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  256

Query  814  CRMVITTYEGRHNHSPCDDSN  876
             RMVITTYEGRH HSP  D +
Sbjct  257  PRMVITTYEGRHVHSPSRDED  277



>gb|AFK48890.1| unknown [Medicago truncatula]
Length=220

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REP FCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+ED
Sbjct  127  VREPMFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAED  186

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  187  PRMVITTYEGRHAHSPSNELEESQ  210



>ref|XP_003630131.1| WRKY transcription factor [Medicago truncatula]
Length=215

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  634  LREPRFCFQTRS-DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  810
            +REPRFCF+T S DVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+E
Sbjct  123  VREPRFCFKTLSTDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQENCRVKKRVERLAE  182

Query  811  DCRMVITTYEGRHNHSPCDDSNSSE  885
            D RMVITTYEGRH HSP +D   S+
Sbjct  183  DPRMVITTYEGRHVHSPSNDLEDSQ  207



>gb|AET04607.2| WRKY family transcription factor [Medicago truncatula]
Length=234

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  634  LREPRFCFQTRS-DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  810
            +REPRFCF+T S DVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL+E
Sbjct  142  VREPRFCFKTLSTDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQENCRVKKRVERLAE  201

Query  811  DCRMVITTYEGRHNHSPCDDSNSSE  885
            D RMVITTYEGRH HSP +D   S+
Sbjct  202  DPRMVITTYEGRHVHSPSNDLEDSQ  226



>gb|EMT33035.1| Putative WRKY transcription factor 13 [Aegilops tauschii]
Length=142

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL+ED
Sbjct  49   VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAED  108

Query  814  CRMVITTYEGRHNHSP  861
             RMVITTYEGRH HSP
Sbjct  109  PRMVITTYEGRHVHSP  124



>ref|XP_009381151.1| PREDICTED: probable WRKY transcription factor 13 [Musa acuminata 
subsp. malaccensis]
Length=114

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  640  EPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCR  819
            EPRFCF+T SDVDVLDDGYKWRKYGQKVVK++ HPRSYYRCT  +CRVKKR+ERL+ED R
Sbjct  23   EPRFCFKTMSDVDVLDDGYKWRKYGQKVVKDTQHPRSYYRCTQGDCRVKKRIERLAEDPR  82

Query  820  MVITTYEGRHNHSPCDDSNSSE  885
            MVITTYEGRH HSP      S+
Sbjct  83   MVITTYEGRHAHSPSHHEEESQ  104



>ref|XP_009409340.1| PREDICTED: probable WRKY transcription factor 57 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  640  EPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCR  819
            EPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR+ER++ED R
Sbjct  148  EPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQENCRVKKRIERMAEDPR  207

Query  820  MVITTYEGRHNHSP  861
            MVITTYEGRH HSP
Sbjct  208  MVITTYEGRHVHSP  221



>emb|CDY72079.1| BnaAnng39820D, partial [Brassica napus]
Length=111

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL++D
Sbjct  15   VREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKRVERLADD  74

Query  814  CRMVITTYEGRHNHSP  861
             RMVITTYEGRH HSP
Sbjct  75   PRMVITTYEGRHLHSP  90



>ref|XP_002526469.1| transcription factor, putative [Ricinus communis]
 gb|EEF35860.1| transcription factor, putative [Ricinus communis]
Length=185

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 124/224 (55%), Gaps = 51/224 (23%)
 Frame = +1

Query  181  LPNYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldg  360
            +PNY LQVSFSTP   H             EMGFVQFE++   V+SFL P          
Sbjct  8    VPNYELQVSFSTPQAIH-------------EMGFVQFEENQ--VLSFLAP----------  42

Query  361  ssscsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDE  540
                  + S  ++      N    T  +GFS             +NDQVG +DPK  N++
Sbjct  43   ------SHSQQSSQISQPLNTTTTTTQIGFS------------THNDQVGNLDPKATNED  84

Query  541  NCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQK  720
             C+ +A +GNNSWWRSSSS  +K KVKVRR+LREPRFCFQTRSDVDVLDDGYKWRKYGQK
Sbjct  85   TCTASANDGNNSWWRSSSS-SEKNKVKVRRRLREPRFCFQTRSDVDVLDDGYKWRKYGQK  143

Query  721  VVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHN  852
            VVKNSLHP  Y       C+V   +  +      V   +E   N
Sbjct  144  VVKNSLHPSVY-------CKVNAELSEIPSPEHEVSFLFENSEN  180



>ref|XP_006578817.1| PREDICTED: probable WRKY transcription factor 13 isoform X2 [Glycine 
max]
Length=233

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGYKWRKYGQKVVKN+ HP SYYRCT  NCRVKKRVERL+ED
Sbjct  141  VREPRFCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHP-SYYRCTQDNCRVKKRVERLAED  199

Query  814  CRMVITTYEGRHNHSPCDDSNSSE  885
             RMVITTYEGRH HSP ++   S+
Sbjct  200  PRMVITTYEGRHVHSPSNELEDSQ  223



>gb|AIE43905.1| WRKY transcription factor 66 [Gossypium hirsutum]
Length=179

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 109/187 (58%), Gaps = 35/187 (19%)
 Frame = +1

Query  187  NYGLQVSFSTphhphhhhhhhphaamhhEMGFVQFEDHNQAVMSFLTPLssssqpldgss  366
            NY LQVSFSTP   +             EMGFVQFE++          + S       S 
Sbjct  10   NYELQVSFSTPQPIN-------------EMGFVQFEENQ---------VLSLLALAHSSH  47

Query  367  scsnaasttaaaakstsnaaaatasLGFSHSEPQLSNRPSWNNNDQVGTMDPKGANDEN-  543
               +    +     +T+     + ++GF+          + NNN  V T DPK ANDEN 
Sbjct  48   HHHHHHQISQPLNTTTTTTTTNSTAMGFT----------THNNNQVVNTEDPKAANDENN  97

Query  544  CSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKV  723
            C   A +GNNSWWRSS+S  +K K+KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKV
Sbjct  98   CPSKANDGNNSWWRSSAS--EKSKLKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKV  155

Query  724  VKNSLHP  744
            VKNSLHP
Sbjct  156  VKNSLHP  162



>ref|XP_004504001.1| PREDICTED: probable WRKY transcription factor 12-like [Cicer 
arietinum]
Length=227

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  634  LREPRFCFQTRS-DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSE  810
            +REPRFCF+T S DVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NC VKKRVERL+E
Sbjct  134  VREPRFCFKTLSIDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTEENCGVKKRVERLAE  193

Query  811  DCRMVITTYEGRHNHSPCDDSN  876
            D RMVITTYEGRH H+P + +N
Sbjct  194  DPRMVITTYEGRHVHTPSNHNN  215



>ref|XP_009109469.1| PREDICTED: probable WRKY transcription factor 13 [Brassica rapa]
Length=296

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL++D
Sbjct  199  VREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKRVERLADD  258

Query  814  CRMVITTYEGRHNHSPCD  867
             RMVITTYEGRH HSP +
Sbjct  259  PRMVITTYEGRHLHSPSN  276



>gb|AJA32877.1| WRKY transcription factor [Brassica oleracea var. capitata]
Length=295

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL++D
Sbjct  198  VREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKRVERLADD  257

Query  814  CRMVITTYEGRHNHSPCD  867
             RMVITTYEGRH HSP +
Sbjct  258  PRMVITTYEGRHLHSPSN  275



>emb|CDY12144.1| BnaC03g60600D [Brassica napus]
Length=295

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T SDVDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL++D
Sbjct  198  VREPRFCFKTLSDVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQEKCRVKKRVERLADD  257

Query  814  CRMVITTYEGRHNHSPCD  867
             RMVITTYEGRH HSP +
Sbjct  258  PRMVITTYEGRHLHSPSN  275



>ref|XP_009399778.1| PREDICTED: probable WRKY transcription factor 13 [Musa acuminata 
subsp. malaccensis]
Length=216

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  640  EPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCR  819
            EPRFCF+T S+VDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKR+ERL ED R
Sbjct  125  EPRFCFKTMSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQENCRVKKRIERLPEDPR  184

Query  820  MVITTYEGRHNH  855
            MVITTYEGRH H
Sbjct  185  MVITTYEGRHVH  196



>gb|EPS59077.1| hypothetical protein M569_15732, partial [Genlisea aurea]
Length=91

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  649  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  828
            FCF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT  NCRVKKRVERL++D RMVI
Sbjct  20   FCFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTADNCRVKKRVERLADDPRMVI  79

Query  829  TTYEGRHNHSP  861
            TTYEGRH HSP
Sbjct  80   TTYEGRHVHSP  90



>gb|KFK30520.1| hypothetical protein AALP_AA7G273300 [Arabis alpina]
Length=293

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  634  LREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSED  813
            +REPRFCF+T S+VDVLDDGY+WRKYGQKVVKN+ HPRSYYRCT   C+VKKRVERL++D
Sbjct  196  VREPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCKVKKRVERLADD  255

Query  814  CRMVITTYEGRHNHSPCD  867
             RMVITTYEGRH HSP +
Sbjct  256  PRMVITTYEGRHLHSPSN  273



>ref|XP_009341120.1| PREDICTED: probable WRKY transcription factor 24 [Pyrus x bretschneideri]
Length=218

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVD-KGKVKVRR-KLREPRFCFQTR  666
            N+DQ+ +  P    D N SG+A  GN    +     V  KG  K+R+     PRF FQTR
Sbjct  76   NHDQINSFKPMAMMDNNISGSA--GNTGADQEEKVGVKRKGGGKMRKPAASRPRFAFQTR  133

Query  667  SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGR  846
            S+ D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG 
Sbjct  134  SEDDILDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDTSIVMTTYEGI  193

Query  847  HNHSPCD  867
            HNH PC+
Sbjct  194  HNH-PCE  199



>ref|XP_008344897.1| PREDICTED: probable WRKY transcription factor 43 [Malus domestica]
Length=169

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 15/132 (11%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR--RKLRE-----PRF  651
            N+DQ+ +  P    D N SG+A       W + +   +K  VK +   K+R+     PRF
Sbjct  27   NHDQINSFKPMXMMDNNISGSA-------WNTGADQEEKVGVKRKGGXKMRKAAASRPRF  79

Query  652  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  831
             FQTRS+ D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  +V+T
Sbjct  80   AFQTRSEDDILDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVT  139

Query  832  TYEGRHNHSPCD  867
            TYEG HNH PC+
Sbjct  140  TYEGIHNH-PCE  150



>gb|ABI13380.1| WRKY transcription factor 14, partial [Hordeum vulgare subsp. 
vulgare]
Length=88

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  652  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  831
            CF+T SDVDVLDDGYKWRKYGQKVVKN+ HPRSYYRCT   CRVKKRVERL+ED RMVIT
Sbjct  1    CFKTMSDVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAEDPRMVIT  60

Query  832  TYEGRHNHSP  861
            TYEGRH HSP
Sbjct  61   TYEGRHVHSP  70



>ref|XP_008354007.1| PREDICTED: probable WRKY transcription factor 24 [Malus domestica]
Length=218

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 15/132 (11%)
 Frame = +1

Query  493  NNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVR--RKLRE-----PRF  651
            N+DQ+ +  P    D N SG+A       W + +   +K  VK +   K+R+     PRF
Sbjct  76   NHDQINSFKPMXMMDNNISGSA-------WNTGADQEEKVGVKRKGGXKMRKAAASRPRF  128

Query  652  CFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVIT  831
             FQTRS+ D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  +V+T
Sbjct  129  AFQTRSEDDILDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVT  188

Query  832  TYEGRHNHSPCD  867
            TYEG HNH PC+
Sbjct  189  TYEGIHNH-PCE  199



>gb|AGV75958.1| WRKY transcription factor 60 [Gossypium hirsutum]
Length=166

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +1

Query  514  MDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVK--------VRRKLREPRFCFQTRS  669
            M P      +  GN+ +G     +S+  L+ K +VK        + +K+R+PR+ FQTRS
Sbjct  24   MAPNSQAFNSFHGNSVDGFLGL-KSTEDLIQKPEVKDFMKSSQKMEKKIRKPRYAFQTRS  82

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
             VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C+VKK+V+RL++D  +V+TTYEG H
Sbjct  83   QVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHEGCKVKKQVQRLTKDESVVVTTYEGMH  142

Query  850  NHSPCDDSNSSEH  888
             H     +++ EH
Sbjct  143  THPIQKPTDNFEH  155



>ref|XP_009338781.1| PREDICTED: probable WRKY transcription factor 24 [Pyrus x bretschneideri]
 ref|XP_009350324.1| PREDICTED: probable WRKY transcription factor 24 [Pyrus x bretschneideri]
Length=221

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 16/136 (12%)
 Frame = +1

Query  487  WNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRK----LRE----  642
            W ++DQ+ +  P    D+N SG+A          S +   + KV ++RK    +R+    
Sbjct  74   WLSHDQINSFKPMAMVDKNISGSAGT------IISEAADQEEKVGIKRKAGGRMRKAAAS  127

Query  643  -PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCR  819
             PRF F TRS  D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  
Sbjct  128  RPRFAFHTRSTDDILDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDTS  187

Query  820  MVITTYEGRHNHSPCD  867
            +V+TTYEG HNH PC+
Sbjct  188  IVVTTYEGIHNH-PCE  202



>gb|KHG04292.1| putative WRKY transcription factor 24 -like protein [Gossypium 
arboreum]
Length=189

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  601  VDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCR  780
            +DK K    +K   PRF FQTRS+ D+LDDGY+WRKYGQK VKNS+HPRSYYRCTH  C 
Sbjct  83   MDKRKGSKIKKTSRPRFAFQTRSEDDILDDGYRWRKYGQKAVKNSIHPRSYYRCTHHTCN  142

Query  781  VKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  143  VKKQVQRLSKDTSIVVTTYEGIHNH-PCE  170



>ref|XP_008375934.1| PREDICTED: probable WRKY transcription factor 43 isoform X1 [Malus 
domestica]
 ref|XP_008356921.1| PREDICTED: probable WRKY transcription factor 43 isoform X1 [Malus 
domestica]
Length=173

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 92/137 (67%), Gaps = 17/137 (12%)
 Frame = +1

Query  487  WNNNDQVG-TMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRK----LRE---  642
            W ++DQ+  +  P    D+N SG+A  GN      S +   + KV ++RK    +R+   
Sbjct  25   WLSHDQINNSFKPMAMVDKNISGSA--GNII----SEAADQEEKVGIKRKAGGRMRKAAA  78

Query  643  --PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDC  816
              PRF FQTRS  D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D 
Sbjct  79   SRPRFAFQTRSTDDILDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDT  138

Query  817  RMVITTYEGRHNHSPCD  867
             +V+TTYEG HNH PC+
Sbjct  139  SIVVTTYEGTHNH-PCE  154



>gb|AFH02532.1| WRKY transcription factor [Gossypium barbadense]
Length=166

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +1

Query  514  MDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVK--------VRRKLREPRFCFQTRS  669
            M P      +  GN+ +G     +S+  L+ K + K        + +K+R+PR+ FQTRS
Sbjct  24   MAPNSQAFNSFHGNSVDGFLGL-KSTEDLIQKPEAKDFMKSSQKMEKKIRKPRYAFQTRS  82

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
             VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C+VKK+V+RL++D  +V+TTYEG H
Sbjct  83   QVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHEGCKVKKQVQRLTKDESVVVTTYEGMH  142

Query  850  NHSPCDDSNSSEH  888
             H     +++ EH
Sbjct  143  THPIQKPTDNFEH  155



>gb|AIE43816.1| WRKY transcription factor 2 [Gossypium hirsutum]
Length=161

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +1

Query  514  MDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVK--------VRRKLREPRFCFQTRS  669
            M P      +  GN+ +G     +S+  L+ K + K        + +K+R+PR+ FQTRS
Sbjct  19   MAPNSQAFNSFHGNSVDGFLGL-KSTEDLIQKPEAKDFMKSSQKMEKKIRKPRYAFQTRS  77

Query  670  DVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRH  849
             VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C+VKK+V+RL++D  +V+TTYEG H
Sbjct  78   QVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHEGCKVKKQVQRLTKDESVVVTTYEGMH  137

Query  850  NHSPCDDSNSSEH  888
             H     +++ EH
Sbjct  138  THPIQKPTDNFEH  150



>ref|XP_004979296.1| PREDICTED: probable WRKY transcription factor 75-like [Setaria 
italica]
Length=207

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 88/144 (61%), Gaps = 15/144 (10%)
 Frame = +1

Query  460  EPQLSNRPSWNNNDQVGTMDP---KGANDENCSGNAAEGNNSWWRSSSSLVDK--GKVKV  624
            +P  S     +N+ + G   P    G   E+ +G AA G           VD+  GK K 
Sbjct  46   QPGHSFLAELSNSSKDGGASPPAAAGGRGESSAGPAAAGGE---------VDRPSGKRKG  96

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
             +K R PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+V+RL
Sbjct  97   EKKERRPRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRL  156

Query  805  SEDCRMVITTYEGRHNHSPCDDSN  876
            S D  +V+TTYEG H H P + SN
Sbjct  157  SRDEGVVVTTYEGTHTH-PIEKSN  179



>ref|XP_001752717.1| transcription factor WRKY20 [Physcomitrella patens]
 gb|EDQ82588.1| transcription factor WRKY20 [Physcomitrella patens]
Length=84

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            KG VK+ +++REPR+  QTRS+VDVL+DGYKWRKYGQK VKNS HPRSYYRCT   C V+
Sbjct  2    KGTVKLNKRVREPRYAIQTRSEVDVLEDGYKWRKYGQKAVKNSTHPRSYYRCTSHTCPVR  61

Query  787  KRVERLSEDCRMVITTYEGRHNH  855
            KR+ER ++D  +VITTYEG HNH
Sbjct  62   KRIERKADDPGLVITTYEGTHNH  84



>ref|XP_007219783.1| hypothetical protein PRUPE_ppa024540mg [Prunus persica]
 gb|EMJ20982.1| hypothetical protein PRUPE_ppa024540mg [Prunus persica]
Length=174

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  613  KVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKR  792
            K+ V +K   PRF FQTRS  D+LDDGY+WRKYGQK VKNSL+PRSYYRCTH  C VKK+
Sbjct  72   KISVMKKASRPRFAFQTRSADDILDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCSVKKQ  131

Query  793  VERLSEDCRMVITTYEGRHNHSPCD  867
            V+RLS+D  +V+TTYEG HNH PC+
Sbjct  132  VQRLSKDTSIVVTTYEGVHNH-PCE  155



>gb|KHG15425.1| putative WRKY transcription factor 75 -like protein [Gossypium 
arboreum]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            R+K+R+PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+++RL
Sbjct  51   RKKIRKPRYAFQTRSKVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRL  110

Query  805  SEDCRMVITTYEGRHNHSPCDDSN  876
            ++D  MV+TTYEG H+H P  +SN
Sbjct  111  TKDEGMVVTTYEGMHSH-PIQNSN  133



>gb|AIE43870.1| WRKY transcription factor 49 [Gossypium hirsutum]
Length=189

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +1

Query  601  VDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCR  780
            +DK K    +K   PRF FQTRS+ D+LDDGY+WRKYGQK VKNS+HPRSYYRCTH  C 
Sbjct  83   MDKRKGSRIKKTSRPRFAFQTRSEDDILDDGYRWRKYGQKAVKNSIHPRSYYRCTHHTCN  142

Query  781  VKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            VKK+V+RLS D  +V+TTYEG HNH PC+
Sbjct  143  VKKQVQRLSNDTSIVVTTYEGIHNH-PCE  170



>ref|XP_008233664.1| PREDICTED: probable WRKY transcription factor 24 [Prunus mume]
Length=209

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +1

Query  484  SWNNNDQVGTMDPKGAND-ENCSGNAAEGNNSWWRSSSSLVDKG-KVKVRRKLREPRFCF  657
            S +++ Q+ T +P    +  N   N  E       S+     +G K+ V +K   PRF F
Sbjct  62   SGHHDHQINTNEPAAMVEVNNKENNVIEAAQEEKGSNKRKGGEGRKISVMKKASRPRFAF  121

Query  658  QTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTY  837
            QTRS  D+LDDGY+WRKYGQK VKNSL+PRSYYRCTH  C VKK+V+RLS+D  +V+TTY
Sbjct  122  QTRSADDILDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCSVKKQVQRLSKDTSIVVTTY  181

Query  838  EGRHNHSPCD  867
            EG HNH PC+
Sbjct  182  EGVHNH-PCE  190



>gb|AGV75929.1| WRKY transcription factor 3 [Gossypium hirsutum]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            R+K+R+PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+++RL
Sbjct  51   RKKIRKPRYAFQTRSKVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRL  110

Query  805  SEDCRMVITTYEGRHNHSPCDDSN  876
            ++D  MV+TTYEG H+H P  +SN
Sbjct  111  TKDEGMVVTTYEGMHSH-PIQNSN  133



>gb|EMS53211.1| putative WRKY transcription factor 24 [Triticum urartu]
Length=222

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = +1

Query  487  WNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKVKV------RRKLREPR  648
            W++  Q G + P    +E    + + G N      S   +K K K       ++K  +PR
Sbjct  73   WSSLFQTGPVAPPEQEEEAVQADQS-GENDGEAGGSGSGNKEKAKGSAGRSGKKKASKPR  131

Query  649  FCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVI  828
            F FQTRS+ D+LDDGY+WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RL++D  +V+
Sbjct  132  FAFQTRSENDILDDGYRWRKYGQKAVKNSSNPRSYYRCTHPTCNVKKQVQRLAKDTAIVV  191

Query  829  TTYEGRHNHSPCD  867
            TTYEG HNH PC+
Sbjct  192  TTYEGVHNH-PCE  203



>gb|AIE43890.1| WRKY transcription factor 15 [Gossypium hirsutum]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            R+K+R+PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+++RL
Sbjct  51   RKKIRKPRYAFQTRSKVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRL  110

Query  805  SEDCRMVITTYEGRHNHSPCDDSN  876
            ++D  MV+TTYEG H+H P  +SN
Sbjct  111  TKDEGMVVTTYEGMHSH-PIQNSN  133



>ref|XP_002320160.2| hypothetical protein POPTR_0014s08640g [Populus trichocarpa]
 gb|EEE98475.2| hypothetical protein POPTR_0014s08640g [Populus trichocarpa]
Length=189

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 79/116 (68%), Gaps = 10/116 (9%)
 Frame = +1

Query  547  SGNAAEGNNSWWRSSSSLV---------DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYK  699
            SG +  G N  +  S+S+V         DK K    +K   PRF FQTRS  DVLDDGY+
Sbjct  56   SGQSGLGENRPFMDSASMVAENGAEEEKDKKKGGRMKKTTRPRFAFQTRSADDVLDDGYR  115

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  116  WRKYGQKAVKNSKYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNH-PCE  170



>ref|XP_006646294.1| PREDICTED: probable WRKY transcription factor 56-like [Oryza 
brachyantha]
Length=261

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = +1

Query  526  GANDENCSGNAAEGNNSWWRSSSSLVDKGKV--KVRRKLREPRFCFQTRSDVDVLDDGYK  699
            G ND      AAE       +    + KG      ++K   PRF FQTRSD D+LDDGY+
Sbjct  128  GENDHGDQQLAAESGGGACSNKEKQLAKGGAGRSGKKKASRPRFAFQTRSDNDILDDGYR  187

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            WRKYGQK VKNS HPRSYYRCTH  C VKK+V+RL++D  +V+TTYEG HNH PC+
Sbjct  188  WRKYGQKAVKNSKHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNH-PCE  242



>gb|KHN18821.1| Putative WRKY transcription factor 56 [Glycine soja]
Length=125

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +1

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RK   PRF FQTRS+ D+LDDGY+WRKYGQK VKN++HPRSYYRCTH  C VKK+V+RLS
Sbjct  16   RKTTRPRFAFQTRSEDDILDDGYRWRKYGQKAVKNNIHPRSYYRCTHHTCNVKKQVQRLS  75

Query  808  EDCRMVITTYEGRHNHSPCD  867
            +D  +V+TTYEG HNH PC+
Sbjct  76   KDTSIVVTTYEGIHNH-PCE  94



>ref|XP_008232972.1| PREDICTED: probable WRKY transcription factor 56 [Prunus mume]
Length=221

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +1

Query  526  GANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWR  705
            GA+ EN +    EG  +  +       KG  ++R+    PRF FQTRS  D+LDDGY+WR
Sbjct  96   GASAENINEADREGKGANSKR------KGGGRMRKPASRPRFAFQTRSADDILDDGYRWR  149

Query  706  KYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            KYGQK VKN+L+PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  150  KYGQKAVKNNLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGTHNH-PCE  202



>ref|XP_007219115.1| hypothetical protein PRUPE_ppa015755mg [Prunus persica]
 gb|EMJ20314.1| hypothetical protein PRUPE_ppa015755mg [Prunus persica]
Length=221

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +1

Query  526  GANDENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWR  705
            GA+ EN +    EG  +  +       KG  ++R+    PRF FQTRS  D+LDDGY+WR
Sbjct  96   GASAENINEADREGKGANSKR------KGGGRMRKPASRPRFAFQTRSADDILDDGYRWR  149

Query  706  KYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            KYGQK VKN+L+PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  150  KYGQKAVKNNLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGTHNH-PCE  202



>ref|XP_010917544.1| PREDICTED: probable WRKY transcription factor 75 isoform X1 [Elaeis 
guineensis]
Length=186

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  601  VDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCR  780
            V  G+ K  +K+R PRF FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C 
Sbjct  78   VKTGRKKGEKKVRRPRFAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCN  137

Query  781  VKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            VKK+V+RLS+D  +V+TTYEG H H+    +++ EH
Sbjct  138  VKKQVQRLSKDEGIVVTTYEGMHTHAIEKSNDNFEH  173



>ref|XP_002275528.3| PREDICTED: probable WRKY transcription factor 24 [Vitis vinifera]
 emb|CBI40411.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 4/106 (4%)
 Frame = +1

Query  559  AEGNNSWW--RSSSSLVDKGK-VKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVK  729
            AEG +S        S+ D+ K V+  RK   PRF FQTRS  D+LDDGY+WRKYGQK VK
Sbjct  78   AEGTSSVMAEEEKGSIKDRRKGVRTTRKATRPRFAFQTRSVDDILDDGYRWRKYGQKAVK  137

Query  730  NSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            NS++PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  138  NSIYPRSYYRCTHHTCDVKKQVQRLSKDTSVVVTTYEGIHNH-PCE  182



>ref|XP_009372253.1| PREDICTED: probable WRKY transcription factor 75 [Pyrus x bretschneideri]
Length=190

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 95/149 (64%), Gaps = 8/149 (5%)
 Frame = +1

Query  484  SWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSL--VDKGKVKV-RRKLREPRFC  654
            S ++N  +G M   GA++     N +    S   S +S   V  G  K  ++K+R+PR+ 
Sbjct  42   SKSSNGFLGLMSEMGASNNMIKNNFSSQGKSVGGSGTSAPTVRLGMKKGDQKKIRKPRYA  101

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+V+RL++D  +V+TT
Sbjct  102  FQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEEVVVTT  161

Query  835  YEGRHNHSPCDDSNSSEH-----DCFTSF  906
            YEG H+H     +++ EH       +TSF
Sbjct  162  YEGMHSHPIEKSTDNFEHILSQMQIYTSF  190



>emb|CAN73363.1| hypothetical protein VITISV_006168 [Vitis vinifera]
Length=168

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 4/106 (4%)
 Frame = +1

Query  559  AEGNNSWW--RSSSSLVDKGK-VKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVK  729
            AEG +S        S+ D+ K V+  RK   PRF FQTRS  D+LDDGY+WRKYGQK VK
Sbjct  45   AEGTSSVMAEEEKGSIKDRRKGVRTTRKATRPRFAFQTRSVDDILDDGYRWRKYGQKAVK  104

Query  730  NSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            NS++PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  105  NSIYPRSYYRCTHHTCDVKKQVQRLSKDTSVVVTTYEGIHNH-PCE  149



>ref|XP_011037139.1| PREDICTED: probable WRKY transcription factor 43 [Populus euphratica]
Length=187

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 78/116 (67%), Gaps = 10/116 (9%)
 Frame = +1

Query  547  SGNAAEGNNSWWRSSSSLV---------DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYK  699
            SG +  G N     S+S+V         DK K    +K   PRF FQTRS  DVLDDGY+
Sbjct  54   SGQSGLGENRSIMDSASMVAENGAEEEKDKKKGGRMKKTTRPRFAFQTRSADDVLDDGYR  113

Query  700  WRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            WRKYGQK VKNS +PRSYYRCTH  C VKK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  114  WRKYGQKAVKNSKYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNH-PCE  168



>gb|AHJ78583.1| WRKY75 [Malus baccata]
Length=190

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = +1

Query  484  SWNNNDQVGTMDPKGANDENCSGNAAEGNNSWWRSSSSL--VDKGKVKV-RRKLREPRFC  654
            S ++N  +G M   GA++   + N +    S   S +S   V  G  K  ++K+R+PR+ 
Sbjct  42   SKSSNGFLGLMSEMGASNNMINNNFSSQGKSVGGSGTSAPTVRLGMKKGDQKKIRKPRYA  101

Query  655  FQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITT  834
            FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+V+RL++D  +V+TT
Sbjct  102  FQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTT  161

Query  835  YEGRHNHSPCDDSNSSEH-----DCFTSF  906
            YEG H+H     +++ EH       +TSF
Sbjct  162  YEGMHSHPIEKSTDNFEHILSQMQIYTSF  190



>ref|XP_007226197.1| hypothetical protein PRUPE_ppa016153mg [Prunus persica]
 gb|EMJ27396.1| hypothetical protein PRUPE_ppa016153mg [Prunus persica]
Length=185

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = +1

Query  535  DENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYG  714
            D   S N     +  +    + V  G  K  +K+R+PR+ FQTRS VD+LDDGY+WRKYG
Sbjct  57   DMEVSNNINSSQSKSFGGPETAVRLGTKKGEKKIRKPRYAFQTRSQVDILDDGYRWRKYG  116

Query  715  QKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            QK VKN+  PRSYYRCTH  C VKK+V+RL++D  +V+TTYEG H+H     +++ EH
Sbjct  117  QKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGMHSHPIEKSTDNFEH  174



>ref|XP_003548440.1| PREDICTED: probable WRKY transcription factor 56-like [Glycine 
max]
Length=195

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +1

Query  628  RKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLS  807
            RK   PRF FQTRS+ D+LDDGY+WRKYGQK VKN++HPRSYYRCTH  C VKK+V+RLS
Sbjct  86   RKTTRPRFAFQTRSEDDILDDGYRWRKYGQKAVKNNMHPRSYYRCTHHTCNVKKQVQRLS  145

Query  808  EDCRMVITTYEGRHNHSPCD  867
            +D  +V+TTYEG HNH PC+
Sbjct  146  KDTSIVVTTYEGIHNH-PCE  164



>ref|XP_002984180.1| hypothetical protein SELMODRAFT_18136, partial [Selaginella moellendorffii]
 gb|EFJ14690.1| hypothetical protein SELMODRAFT_18136, partial [Selaginella moellendorffii]
Length=90

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            K + K ++++REPR+  QTRS+VD++DDGY+WRKYGQK VKNS HPRSYYRCT++ C VK
Sbjct  8    KPRKKGQKRIREPRYAIQTRSEVDIMDDGYRWRKYGQKAVKNSPHPRSYYRCTNTKCPVK  67

Query  787  KRVERLSEDCRMVITTYEGRHNH  855
            KRVER SED  +VITTYEG HNH
Sbjct  68   KRVERSSEDQGLVITTYEGIHNH  90



>gb|AGV75932.1| WRKY transcription factor 8 [Gossypium hirsutum]
Length=180

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 7/131 (5%)
 Frame = +1

Query  535  DENCSGNAAEGNNSWWRSSSSLVDKGKVKV--RRKLREPRFCFQTRSDVDVLDDGYKWRK  708
            D    G   E N+    ++ S V +GK K    +K+R+PR+ FQTRS VD+LDDGY+WRK
Sbjct  46   DIEVGGAKNENNSLVGTTTESEVKRGKTKKGENKKIRKPRYAFQTRSQVDILDDGYRWRK  105

Query  709  YGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            YG K VKNS  PRSYYRCTH  C+VKK+V+RL++D  +V TTYEG H+H     +++ EH
Sbjct  106  YGHKAVKNSKFPRSYYRCTHQGCKVKKQVQRLTKDEGIVETTYEGMHSHPIQKTNDNFEH  165

Query  889  -----DCFTSF  906
                   +TSF
Sbjct  166  ILNQMQIYTSF  176



>ref|XP_008222197.1| PREDICTED: probable WRKY transcription factor 75 [Prunus mume]
Length=185

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +1

Query  535  DENCSGNAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYG  714
            D   S N     +  +      V  G  K  +K+R+PR+ FQTRS VD+LDDGY+WRKYG
Sbjct  57   DMEVSNNINSSQSKSFGGPEGAVRLGTKKGEKKIRKPRYAFQTRSQVDILDDGYRWRKYG  116

Query  715  QKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
            QK VKN+  PRSYYRCTH  C VKK+V+RL++D  +V+TTYEG H+H     +++ EH
Sbjct  117  QKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGMHSHPIEKSTDNFEH  174



>ref|XP_010066855.1| PREDICTED: probable WRKY transcription factor 57 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010066856.1| PREDICTED: probable WRKY transcription factor 57 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64897.1| hypothetical protein EUGRSUZ_G02459 [Eucalyptus grandis]
Length=311

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 82/123 (67%), Gaps = 10/123 (8%)
 Frame = +1

Query  517  DPKGANDENCSGNAAEGNNSWWRSSSSLVDKGKV------KVRRK----LREPRFCFQTR  666
            DP  A  E  + NA++ + S      S    GK       KVRRK    +R+PRF F T+
Sbjct  96   DPSAAGGEASTSNASDSSASEDPPEKSGSSGGKPPPETPNKVRRKGQKRIRQPRFAFMTK  155

Query  667  SDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGR  846
            S+VD L+DGY+WRKYGQK VKNS HPRSYYRCT+S C VKKRVER SED  +VITTYEG+
Sbjct  156  SEVDNLEDGYRWRKYGQKAVKNSPHPRSYYRCTNSRCTVKKRVERSSEDPTIVITTYEGQ  215

Query  847  HNH  855
            H H
Sbjct  216  HCH  218



>emb|CDP00413.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +1

Query  553  NAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKN  732
            + A G +S  R  S    K K K ++++R+PRF F T+S+VD L+DGY+WRKYGQK VKN
Sbjct  97   STASGGSSADRQPSDTASKAKKKGQKRIRQPRFAFMTKSEVDHLEDGYRWRKYGQKAVKN  156

Query  733  SLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH  855
            S  PRSYYRCT+S C VKKRVER SED  +VITTYEG+H H
Sbjct  157  SPFPRSYYRCTNSKCTVKKRVERSSEDPTIVITTYEGQHCH  197



>ref|XP_008657250.1| PREDICTED: probable WRKY transcription factor 75 [Zea mays]
 gb|AFW85137.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05735.1| WRKY transcription factor, partial [Zea mays]
Length=227

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 3/95 (3%)
 Frame = +1

Query  589  SSSLVDKGKVKVRRKLRE--PRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRC  762
            SSS  +KG     RK +   PRF FQTRS  D+LDDGY+WRKYGQK VKNS HPRSYYRC
Sbjct  115  SSSSKEKGGAAAGRKKKASRPRFAFQTRSVNDILDDGYRWRKYGQKAVKNSEHPRSYYRC  174

Query  763  THSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            TH  C VKK+V+RL++D  +V+TTYEG HNH PC+
Sbjct  175  THHTCNVKKQVQRLAKDTSIVVTTYEGVHNH-PCE  208



>ref|XP_002972266.1| hypothetical protein SELMODRAFT_29247, partial [Selaginella moellendorffii]
 gb|EFJ26352.1| hypothetical protein SELMODRAFT_29247, partial [Selaginella moellendorffii]
Length=80

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  619  KVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVE  798
            K ++++REPR+  QTRS+VD++DDGY+WRKYGQK VKNS HPRSYYRCT++ C VKKRVE
Sbjct  2    KGQKRIREPRYAIQTRSEVDIMDDGYRWRKYGQKAVKNSPHPRSYYRCTNTKCPVKKRVE  61

Query  799  RLSEDCRMVITTYEGRHNH  855
            R SED  +VITTYEG HNH
Sbjct  62   RSSEDQGLVITTYEGIHNH  80



>ref|XP_004306730.1| PREDICTED: probable WRKY transcription factor 24-like [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = +1

Query  520  PKGANDENCSG----NAAEGNNSWWRSSSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLD  687
            P  A+    SG    NA EG++   +  S     G  K+R+  R PRF FQTRS  D+LD
Sbjct  90   PGMADLSTASGSAGENAIEGDDDREQKGSKKRKGGGYKMRKATR-PRFAFQTRSADDILD  148

Query  688  DGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            DGY+WRKYGQK VKNSL+PRSYYRCTH  C VKK+++RLS+D  +V+TTYEG HNH PC+
Sbjct  149  DGYRWRKYGQKAVKNSLYPRSYYRCTHHTCNVKKQIQRLSKDTSIVVTTYEGTHNH-PCE  207



>ref|NP_001044163.1| Os01g0734000 [Oryza sativa Japonica Group]
 dbj|BAB68074.1| putative WRKY DNA binding protein [Oryza sativa Japonica Group]
 dbj|BAB89937.1| putative WRKY DNA binding protein [Oryza sativa Japonica Group]
 gb|AAQ20904.1| WRKY4 [Oryza sativa Japonica Group]
 tpg|DAA05088.1| TPA_inf: WRKY transcription factor 23 [Oryza sativa (japonica 
cultivar-group)]
 gb|AAW63716.1| WRKY23 [Oryza sativa Japonica Group]
 dbj|BAF06077.1| Os01g0734000 [Oryza sativa Japonica Group]
 dbj|BAG98560.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71438.1| hypothetical protein OsI_03639 [Oryza sativa Indica Group]
 gb|EEE55344.1| hypothetical protein OsJ_03362 [Oryza sativa Japonica Group]
Length=254

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 6/115 (5%)
 Frame = +1

Query  538  ENCSGN--AAEGNNSWWRSSSSLVDKGKVK---VRRKLREPRFCFQTRSDVDVLDDGYKW  702
            EN  G+  AAE + +  +    +   G  +    ++K   PRF FQTRSD D+LDDGY+W
Sbjct  122  ENDHGDLQAAESSGAGNKEKQVMAKGGAGRPSGTKKKASRPRFAFQTRSDNDILDDGYRW  181

Query  703  RKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCD  867
            RKYGQK VKNS HPRSYYRCTH  C VKK+V+RL++D  +V+TTYEG HNH PC+
Sbjct  182  RKYGQKAVKNSKHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNH-PCE  235



>ref|XP_009386115.1| PREDICTED: probable WRKY transcription factor 43 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=143

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +1

Query  607  KGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVK  786
            +G     +K+  PRF FQTRS  D+LDDGY+WRKYGQK VKNS+HPRSYYRCTH  C VK
Sbjct  39   RGAAGRNKKVIRPRFAFQTRSPNDILDDGYRWRKYGQKAVKNSVHPRSYYRCTHHTCNVK  98

Query  787  KRVERLSEDCRMVITTYEGRHNHSPCD  867
            K+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  99   KQVQRLSKDTSIVVTTYEGIHNH-PCE  124



>ref|XP_011036106.1| PREDICTED: probable WRKY transcription factor 75 [Populus euphratica]
Length=159

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +1

Query  568  NNSWWRSSSSLVDKGKVKVRR---KLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSL  738
            N S  R+    V +G+V+ +R   K+R+P++ FQTRS VD+LDDGY+WRKYGQK VKN+ 
Sbjct  41   NISQNRAFVGSVSEGRVEKKRGEKKIRKPKYAFQTRSQVDILDDGYRWRKYGQKAVKNNK  100

Query  739  HPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH  888
             PRSYYRCTH  C VKK+V+RL++D  +V+TTYEG H+H     +++ EH
Sbjct  101  FPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGTHSHQIEKSTDNFEH  150



>ref|XP_004310100.1| PREDICTED: probable WRKY transcription factor 12-like [Fragaria 
vesca subsp. vesca]
Length=190

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  589  SSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH  768
            S++ V  G  K  +K+R+PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH
Sbjct  80   SNTAVRLGMKKGDKKIRKPRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTH  139

Query  769  SNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH-----DCFTSF  906
              C VKK+V+RL+ D  +V+TTYEG H+H     +++ EH       +TSF
Sbjct  140  QGCNVKKQVQRLTRDEGVVVTTYEGMHSHPIEKSTDNFEHILTQMQIYTSF  190



>gb|ACH88751.1| WRKY DNA binding protein [Fragaria x ananassa]
Length=190

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  589  SSSLVDKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTH  768
            S++ V  G  K  +K+R+PR+ FQTRS VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH
Sbjct  80   SNTAVRLGMKKGDKKIRKPRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTH  139

Query  769  SNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEH-----DCFTSF  906
              C VKK+V+RL+ D  +V+TTYEG H+H     +++ EH       +TSF
Sbjct  140  QGCNVKKQVQRLTRDEGVVVTTYEGMHSHPIEKSTDNFEHILTQMQIYTSF  190



>ref|XP_007135144.1| hypothetical protein PHAVU_010G104700g [Phaseolus vulgaris]
 gb|ESW07138.1| hypothetical protein PHAVU_010G104700g [Phaseolus vulgaris]
Length=202

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +1

Query  604  DKGKVKVRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRV  783
            DK K    +K   PRF FQTRS  D+LDDGY+WRKYGQK VKN++HPRSYYRCTH  C V
Sbjct  85   DKRKGGRMKKTTRPRFAFQTRSADDILDDGYRWRKYGQKAVKNNMHPRSYYRCTHHTCNV  144

Query  784  KKRVERLSEDCRMVITTYEGRHNHSPCD  867
            KK+V+RLS+D  +V+TTYEG HNH PC+
Sbjct  145  KKQVQRLSKDTSIVVTTYEGIHNH-PCE  171



>ref|XP_004969857.1| PREDICTED: probable WRKY transcription factor 56-like [Setaria 
italica]
Length=237

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  625  RRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERL  804
            ++K   PRF FQTRS  D+LDDGY+WRKYGQK VKNS HPRSYYRCTH  C VKK+V+RL
Sbjct  139  KKKASRPRFAFQTRSANDILDDGYRWRKYGQKAVKNSAHPRSYYRCTHHTCNVKKQVQRL  198

Query  805  SEDCRMVITTYEGRHNHSPCD  867
            ++D  +V+TTYEG HNH PC+
Sbjct  199  AKDTSIVVTTYEGVHNH-PCE  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2875161397914