BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13636_g2_i1 len=420 path=[444:0-230 675:231-419]

Length=420
                                                                      Score     E

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        112   4e-28   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  111   7e-28   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    110   2e-27   
dbj|BAA14024.1|  ipomoelin                                            84.3    1e-17   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  84.3    2e-17   
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  64.7    4e-09   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  63.2    1e-08   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  63.2    1e-08   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  63.2    1e-08   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  60.5    1e-07   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  60.5    1e-07   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  60.5    1e-07   
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  59.7    2e-07   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  59.7    2e-07   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  59.3    2e-07   
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  58.9    3e-07   
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       57.8    3e-07   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  57.4    9e-07   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  57.4    9e-07   
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  57.4    9e-07   
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  57.0    1e-06   
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           56.6    2e-06   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  55.8    3e-06   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  55.8    3e-06   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.7    7e-06   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  54.3    1e-05   
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         52.4    1e-05   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  52.8    1e-05   
gb|EYU45162.1|  hypothetical protein MIMGU_mgv1a025414mg              52.0    3e-05   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  52.0    4e-05   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  52.0    4e-05   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  52.0    5e-05   
ref|XP_004291831.1|  PREDICTED: uncharacterized protein LOC101310192  51.6    6e-05   
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        47.8    1e-04   
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           50.1    2e-04   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  50.1    2e-04   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  50.1    2e-04   
gb|KHN46147.1|  Agglutinin                                            49.7    2e-04   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              49.7    2e-04   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  50.1    2e-04   
ref|NP_001066367.1|  Os12g0198700                                     48.9    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       47.8    4e-04   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  48.9    4e-04   
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          47.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  48.9    4e-04   
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          47.0    5e-04   
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        48.5    5e-04   
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        47.4    6e-04   Sorghum bicolor [broomcorn]
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          48.1    6e-04   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  48.1    6e-04   
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           47.8    7e-04   Hordeum vulgare [barley]
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  48.1    8e-04   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  47.8    8e-04   
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           46.6    9e-04   
gb|AAR20919.1|  jasmonate-induced protein                             47.4    9e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  47.8    0.001   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = -3

Query  379  LSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDT  200
            ++  ID++ GP G NGG F+SFRP  KI++IVI+   S   NPI +TF +   DGS  DT
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVITY--SAGNNPIALTFSATKADGS-KDT  57

Query  199  LTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPY  20
            +T+GG G D  +T  D V + G  EY+ GISGTFG ++D+  NVLRSIK  TN + YGPY
Sbjct  58   ITVGGAGPD-SITGTDTVDI-GADEYVTGISGTFGIYLDN--NVLRSIKFITNLKAYGPY  113

Query  19   GPNVGT  2
            GPNVGT
Sbjct  114  GPNVGT  119



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = -3

Query  379  LSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDT  200
            ++  +D++ GP G NGG F+SFRP  KI++IVIS GG  N NPI +TF S   DGS  DT
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGN-NPIALTFSSTKADGS-KDT  58

Query  199  LTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPY  20
            +T+GGGG D  +T  +MV + G  EYL GISGTFG ++D+  NVLRSI   TN + +GPY
Sbjct  59   ITVGGGGPD-SITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPY  114

Query  19   GPNVGT  2
            G  VGT
Sbjct  115  GQKVGT  120



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 85/122 (70%), Gaps = 6/122 (5%)
 Frame = -3

Query  367  IDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            +D++ GP G NGG F+SFRP  KI++IVIS GG  N NPI +TF S   DGS  DT+T+G
Sbjct  4    MDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGN-NPIALTFSSTKADGS-KDTITVG  61

Query  187  GGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNV  8
            GGG D  +T  +MV + G  EYL GISGTFG ++D+  NVLRSI   TN + +GPYG  V
Sbjct  62   GGGPD-SITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPYGQKV  117

Query  7    GT  2
            GT
Sbjct  118  GT  119



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -3

Query  382  MLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSD  203
             L+A  D+  GP G+NGG F+SFRP + ++KIV+S  GS ++    +   S+    + +D
Sbjct  4    QLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQT---LNLISITFSSNPTD  60

Query  202  TLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGP  23
             +T+GG G +  +T  + V +DG+   ++G+   +      GYNV+RSIK  TN++EYGP
Sbjct  61   IITVGGVGPE-PLTYTETVNIDGDIIEISGMIANY-----KGYNVIRSIKFTTNKKEYGP  114

Query  22   YGPNVGT  2
            YG N GT
Sbjct  115  YGANAGT  121



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -3

Query  382  MLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSD  203
             L+A  D+  GP G+NGG F+SFRP + ++KIV+S  GS ++    +   S+    + +D
Sbjct  10   QLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQT---LNLISITFSSNPTD  66

Query  202  TLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGP  23
             +T+GG G +  +T  + V +DG+   ++G+   +      GYNV+RSIK  TN++EYGP
Sbjct  67   IITVGGVGPE-PLTYTETVNIDGDIIEISGMIANY-----KGYNVIRSIKFTTNKKEYGP  120

Query  22   YGPNVGT  2
            YG N GT
Sbjct  121  YGANAGT  127



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 11/121 (9%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS+ + P G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   G
Sbjct  11   DSILVEPWGGTGGSEWNYKLKSPIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFG  66

Query  187  GGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNV  8
            G G  +    N +VF +   E+L GI GT G F   GY+V++S+   TN + YGP+G   
Sbjct  67   GNGGRI----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEG  120

Query  7    G  5
            G
Sbjct  121  G  121


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  220  LVGPWGGTGGSEWNYKLKSYIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNG  275

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG +  +G+ V++S+   TN   YGP+G + G
Sbjct  276  GRI----NKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAG  327



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G   G  ++++    I +I+I+ G   +     + F ++ E G+ +D+   GG G
Sbjct  172  LVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDS----IMFRTITEQGTTTDSQKFGGNG  227

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG + D  + V++S+   TN   YGP+G N G
Sbjct  228  GRI----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAG  279


 Score = 48.1 bits (113),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -3

Query  238  FFSVNEDGSNSDTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRS  59
            F ++ E G+  ++   GG G  +    N +VF +   E L GI GT G F  +G+ V++S
Sbjct  2    FRTITEQGTTINSQKFGGNGGQI----NKVVFEETPLERLTGIKGTLGRF--NGHLVVKS  55

Query  58   IKIKTNQREYGPYGPNVG  5
            +   TN + YGP+G   G
Sbjct  56   LCFTTNVKNYGPFGSEGG  73



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G   G  ++++    I +I+I+ G   +     + F ++ E G+ +D+   GG G
Sbjct  224  LVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDS----IMFRTITEQGTTTDSQKFGGNG  279

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG + D  + V++S+   TN   YGP+G N G
Sbjct  280  GRI----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAG  331


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/122 (33%), Positives = 67/122 (55%), Gaps = 12/122 (10%)
 Frame = -3

Query  364  DSV-IGPEG-TNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
            DS+ +GP G T+GG  ++++    I +I+I+ G + N     + F ++ E G+  ++   
Sbjct  14   DSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINS----IMFRTITEQGTTINSQKF  69

Query  190  GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            GG G  +    N +VF +   E L GI GT G F  +G+ V++S+   TN + YGP+G  
Sbjct  70   GGNGGQI----NKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSE  123

Query  10   VG  5
             G
Sbjct  124  GG  125



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G   G  ++++    I +I+I+ G   +     + F ++ E G+ +D+   GG G
Sbjct  224  LVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDS----IMFRTITEQGTTTDSQKFGGNG  279

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG + D  + V++S+   TN   YGP+G N G
Sbjct  280  GRI----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAG  331


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/122 (33%), Positives = 67/122 (55%), Gaps = 12/122 (10%)
 Frame = -3

Query  364  DSV-IGPEG-TNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
            DS+ +GP G T+GG  ++++    I +I+I+ G + N     + F ++ E G+  ++   
Sbjct  14   DSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINS----IMFRTITEQGTTINSQKF  69

Query  190  GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            GG G  +    N +VF +   E L GI GT G F  +G+ V++S+   TN + YGP+G  
Sbjct  70   GGNGGQI----NKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSE  123

Query  10   VG  5
             G
Sbjct  124  GG  125



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I  I+I+ G   +     + F S+ E G+  D+   G
Sbjct  30   DSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            G G      R D V ++    EYL GI GTFG F   G++V++S+   TN + YGP+G  
Sbjct  86   GDGG-----RRDKVVIEATPLEYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCE  138

Query  10   VG  5
             G
Sbjct  139  AG  140



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I  I+I+ G   +     + F S+ E G+  D+   G
Sbjct  30   DSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            G G      R D V ++    EYL GI GTFG F   G++V++S+   TN + YGP+G  
Sbjct  86   GDGG-----RRDKVVIEATPLEYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCE  138

Query  10   VG  5
             G
Sbjct  139  AG  140



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I  I+I+ G   +     + F S+ E G+  D+   G
Sbjct  30   DSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            G G      R D V ++    EYL GI GTFG F   G++V++S+   TN + YGP+G  
Sbjct  86   GDGG-----RRDKVVIEATPLEYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCE  138

Query  10   VG  5
             G
Sbjct  139  AG  140



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++ P G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  150  LVEPWGGTGGSEWNYKLKSPIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  205

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYG  17
              +    N +VF +   E+L GI GT G F   GY+V++S+   TN + YGP+G
Sbjct  206  GRI----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFG  253


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  356  LVGPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  411

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG +  +G+ V++S+   TN   YGP+G + G
Sbjct  412  GRI----NKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAG  463



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++ P G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  218  LVEPWGGTGGSEWNYKLKSPIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  273

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYG  17
              +    N +VF +   E+L GI GT G F   GY+V++S+   TN + YGP+G
Sbjct  274  GRI----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFG  321


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  424  LVGPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  479

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG +  +G+ V++S+   TN   YGP+G + G
Sbjct  480  GRI----NKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAG  531


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 10/119 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++ P G  GG  + ++    I +I+I+ G         + F +V E G+  D+   GG G
Sbjct  36   LVEPWGGAGGSEWYYKLKSPIKEILIAHGDCIK----SIMFKTVTEQGTTIDSPKFGGDG  91

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                  R+ +V  +   EYL  I GTFG     GY+V++S+   TN + YGP+G   GT
Sbjct  92   G----RRDKVVMEETPLEYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGT  144



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++ P G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  148  LVEPWGGTGGSEWNYKLKSPIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  203

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYG  17
              +    N +VF +   E+L GI GT G F   GY+V++S+   TN + YGP+G
Sbjct  204  GRI----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFG  251


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++GP G  GG  ++++    I +I+I+ GG  +     + F ++ E G+  D+   GG G
Sbjct  354  LVGPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITEQGTTIDSPKFGGNG  409

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
              +    N +V      EYL GI GTFG +  +G+ V++S+   TN   YGP+G + G
Sbjct  410  GRI----NKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAG  461



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 12/120 (10%)
 Frame = -3

Query  361  SVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGG  182
            +++ P G  GG  +++     I +I+I  G   +     + F ++ E G+  D+   GG 
Sbjct  29   TLLEPWGGVGGSKWNYMLKSPIKEILIVHGDVIDS----IMFRTITEQGTTIDSPKFGGD  84

Query  181  GNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
            G      R D V V+    EYL GI GTFG F   G++V++S+   TN + YGP+G   G
Sbjct  85   GG-----RRDKVVVEATPLEYLTGIKGTFGRFY--GHSVIKSLCFITNAKNYGPFGSEAG  137



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 12/120 (10%)
 Frame = -3

Query  358  VIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGG  179
            ++ P G  GG  + ++    I +I+I+ G         + F +V E G+  D+   GG G
Sbjct  41   LVEPWGGTGGSEWYYKLKSPIKEILITHGDCIES----IMFRTVTEQGTTIDSPKFGGDG  96

Query  178  NDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                  R D V ++    EYL GI GTFG      Y V++S+  +TN R YGP+G  +GT
Sbjct  97   G-----RRDKVVIEAASLEYLTGIKGTFGHC--GSYLVIKSLCFETNARNYGPFGSEIGT  149



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+   G
Sbjct  14   DSILMEPRGGTGGLQWNYMLKSPIKEILITHGDCIDS----IMFRTVTEQGTTIDSPKFG  69

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            G G      R D V ++    EYL GI GTFG  +   ++V++S+   TN + YGP+G  
Sbjct  70   GDGG-----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSE  122

Query  10   VG  5
             G
Sbjct  123  AG  124



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+   G
Sbjct  30   DSILMEPRGGTGGLQWNYMLKSPIKEILITHGDCIDS----IMFRTVTEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            G G      R D V ++    EYL GI GTFG  +   ++V++S+   TN + YGP+G  
Sbjct  86   GDGG-----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSE  138

Query  10   VG  5
             G
Sbjct  139  AG  140



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 11/124 (9%)
 Frame = -3

Query  373  ATIDSV-IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTL  197
            A  DS+ + P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+ 
Sbjct  19   AQADSIFLKPWGGFGGSKWNYMLKSPIKEILIAHGDCIDS----IMFITVTEQGTTIDSP  74

Query  196  TIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYG  17
              GGGG      R  +VF     EYL GI+GTFG      + V++S+   TN + YGP+G
Sbjct  75   KFGGGGG----RRAKVVFEATPLEYLTGINGTFG--YGGSHLVIKSLCFITNAKSYGPFG  128

Query  16   PNVG  5
               G
Sbjct  129  SKDG  132



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 61/118 (52%), Gaps = 13/118 (11%)
 Frame = -3

Query  364  DSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS++  P G  GG  +++     I +I+I+ G   +     + F ++ E G+  D+   G
Sbjct  30   DSILLEPWGGTGGSEWNYMLKSPIKEILIAHGDVIDS----IMFRTITEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYG  17
            G G      R D V ++    EYL GI GTFG F D   ++++S+   TN + YGP+G
Sbjct  86   GDGG-----RRDKVVIEATPLEYLTGIKGTFGRFYDR--SIIKSLCFITNAKNYGPFG  136



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 71/138 (51%), Gaps = 15/138 (11%)
 Frame = -3

Query  397  IIQETMLSATIDSV------IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTF  236
            ++++ +  + I+SV      +GP G   G+ +    H  + +I+I+ G S     I    
Sbjct  757  LLKKPLGQSWIESVECKPASVGPWGGQSGHAWDDGMHTTVRQIIIAHGSS-----IDSIQ  811

Query  235  FSVNEDGSNSDTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSI  56
               +++GS+  +   GG G      ++D V +D   EYL  +SGT+G F   G   +RS+
Sbjct  812  VEYDKNGSSVWSERRGGKGG----RKSDKVKLDYPHEYLISVSGTYGSFDAWGNICVRSL  867

Query  55   KIKTNQREYGPYGPNVGT  2
             +++N R+YGP+G   GT
Sbjct  868  TLESNHRKYGPFGVESGT  885



>ref|XP_009588746.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009588747.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1341

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYF-FSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
            DS+ + P G N G   ++++    I +I+I+ G   +     + F +V E G+  D+   
Sbjct  30   DSILVEPWGGNAGESEWNYKLKSPIKEILIAHGDIIDS----IMFRTVTEQGTTIDSTKF  85

Query  190  GGGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGP  14
            GG G      R D V ++    EYL GI GTFG +   G++V++S+   TN + YGP+G 
Sbjct  86   GGDGG-----RIDKVVIEATSLEYLKGIKGTFGYYY--GHSVIKSLCFITNAKNYGPFGC  138

Query  13   NVG  5
              G
Sbjct  139  EAG  141



>ref|XP_009588743.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588744.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588745.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1363

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYF-FSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
            DS+ + P G N G   ++++    I +I+I+ G   +     + F +V E G+  D+   
Sbjct  52   DSILVEPWGGNAGESEWNYKLKSPIKEILIAHGDIIDS----IMFRTVTEQGTTIDSTKF  107

Query  190  GGGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGP  14
            GG G      R D V ++    EYL GI GTFG +   G++V++S+   TN + YGP+G 
Sbjct  108  GGDGG-----RIDKVVIEATSLEYLKGIKGTFGYYY--GHSVIKSLCFITNAKNYGPFGC  160

Query  13   NVG  5
              G
Sbjct  161  EAG  163



>ref|XP_009608047.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102120 
[Nicotiana tomentosiformis]
Length=1799

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 57/107 (53%), Gaps = 12/107 (11%)
 Frame = -3

Query  322  FSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGNDLVVTRNDMVF  143
            ++++    I +I+I+ G   +     + F +V E G+  D+   GG G      R D V 
Sbjct  10   WNYKLKSPIKEILIAHGDIIDS----IMFRTVTEQGTTIDSAKFGGDGG-----RRDKVV  60

Query  142  VDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
            ++    EYL GI+GTFG +   G++V++S+   TN + YGP+G   G
Sbjct  61   IEATSLEYLKGINGTFGCYY--GHSVIKSLCFITNAKNYGPFGCEAG  105



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 8/81 (10%)
 Frame = -3

Query  244  MTFFSVNEDGSNSDTLTIGGGGNDLVVTRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNV  68
            + F S+ E G+  D+   GG G      R D V ++    EYL GI GTFG F   G++V
Sbjct  20   IMFKSITEQGTTIDSPKFGGDGG-----RRDKVVIEATPLEYLTGIKGTFGCFY--GHSV  72

Query  67   LRSIKIKTNQREYGPYGPNVG  5
            ++S+   TN + YGP+G   G
Sbjct  73   IKSLCFITNAKNYGPFGCEAG  93



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 11/121 (9%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS+ + P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+   G
Sbjct  53   DSIFLKPWGGFGGSKWNYMLKSPIKEILIAHGDCIDS----IMFRTVTEQGTTIDSPKFG  108

Query  187  GGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNV  8
            GGG      R  +VF     EYL GI+GTFG   D    V++S+   TN + YGP+G + 
Sbjct  109  GGGG----RRAKVVFEATPLEYLTGINGTFGH--DGSDLVIKSLCFITNAKSYGPFGSSY  162

Query  7    G  5
            G
Sbjct  163  G  163



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 57/114 (50%), Gaps = 11/114 (10%)
 Frame = -3

Query  343  GTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGNDLVV  164
            G +GG  +++RP   + +IV+  G       I    F  +E+    ++ T GG G  L  
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKHG-----LIIDSIMFKSSEENGVMESKTFGGSGGHLTT  215

Query  163  TRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
              N    +D   EYL G+SGT+G +    Y +++SIK+ TN   +GP G  + T
Sbjct  216  EIN----IDSPSEYLTGLSGTYGLY--GPYLIIKSIKLHTNLSHHGPMGSVIET  263



>gb|EYU45162.1| hypothetical protein MIMGU_mgv1a025414mg, partial [Erythranthe 
guttata]
Length=333

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 9/118 (8%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGN  176
            IGP G  GG  FS++    I +IV+      ++N +    F  +   ++  + T GG  N
Sbjct  12   IGPFGGPGGTAFSYKAKHAIKQIVVVC----SKNNVESIMFKGDSGSTSEYSKTFGGAFN  67

Query  175  DLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
              +  R D + +D   ++L G+SGT+G     G   ++S+K  T   EYGP+G   GT
Sbjct  68   SGI--RTDKINIDFPLDFLTGVSGTYG---SPGQMYMQSLKFHTKLTEYGPFGNTTGT  120


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 15/104 (14%)
 Frame = -3

Query  307  HQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGNDLVVTRNDMVFVDGEG  128
            H+ IH   IS+          + F  V +DG+   +   G  G D+V  +   + VDG G
Sbjct  210  HECIHTNAISA----------VQFLYVKKDGTTIWSPMHGCLGGDIV--KKIEIDVDG-G  256

Query  127  EYLNGISGTFGPF--IDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            EYL GI G  GP   I  G +V+RSI   TN+ +YGP G  +GT
Sbjct  257  EYLVGIEGFHGPIEGITGGVSVMRSITFHTNKFKYGPSGNEIGT  300



>ref|XP_004490606.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Cicer 
arietinum]
Length=605

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 15/128 (12%)
 Frame = -3

Query  373  ATIDSVI--GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSV--NEDGSNS  206
            A +D V+  GP G  GGY F    +  I +I +S    RN   +G+ +  V  + DG   
Sbjct  244  AKVDGVVTHGPWGGIGGYAFDDGTYNGIRQINLS----RN---VGIVWIRVLYDSDGDAI  296

Query  205  DTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYG  26
                 GG G      +ND +  D   E L  ISG +GP +  G  V+RS+   T +R+YG
Sbjct  297  WGCKQGGKGG----FKNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYG  352

Query  25   PYGPNVGT  2
            P+G   GT
Sbjct  353  PFGEEQGT  360


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 15/136 (11%)
 Frame = -3

Query  400  IIIQETMLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNE  221
            + IQ +  S    + +GP G NGG  +    +  + ++VI  G        G+    +  
Sbjct  3    LCIQSSDDSIKKPASVGPWGGNGGSRWDDGIYSGVRQLVIIHG-------TGIDSIQIEY  55

Query  220  DGSNSDTLTI---GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKI  50
            D   S   +    G GGN     + D V +D   E+L  I G +G     G+N++RS+  
Sbjct  56   DKKGSSIWSEKHGGSGGN-----KTDKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSF  110

Query  49   KTNQREYGPYGPNVGT  2
            ++N++ YGP+G   GT
Sbjct  111  ESNKKTYGPFGVEHGT  126



>ref|XP_004490607.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Cicer 
arietinum]
Length=600

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 15/128 (12%)
 Frame = -3

Query  373  ATIDSVI--GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSV--NEDGSNS  206
            A +D V+  GP G  GGY F    +  I +I +S    RN   +G+ +  V  + DG   
Sbjct  239  AKVDGVVTHGPWGGIGGYAFDDGTYNGIRQINLS----RN---VGIVWIRVLYDSDGDAI  291

Query  205  DTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYG  26
                 GG G      +ND +  D   E L  ISG +GP +  G  V+RS+   T +R+YG
Sbjct  292  WGCKQGGKGG----FKNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYG  347

Query  25   PYGPNVGT  2
            P+G   GT
Sbjct  348  PFGEEQGT  355



>ref|XP_009608041.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608042.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608043.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608044.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1582

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 12/114 (11%)
 Frame = -3

Query  343  GTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGNDLVV  164
            G  GG  ++++    I +I+I  G   +     + F ++ E G+  D+   GG G     
Sbjct  210  GNIGGSEWNYKLKSPIKEILIGHGDFIDS----IIFRTITEQGTTIDSPKFGGNGG----  261

Query  163  TRNDMVFVDGEG-EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
             R D V ++    EYL GI GTFG +    ++V++ +   TN + YGP+G   G
Sbjct  262  -RIDKVVIEATSLEYLTGIKGTFGCY--GSHSVIKILCFITNSKNYGPFGSEAG  312



>ref|XP_004291831.1| PREDICTED: uncharacterized protein LOC101310192 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 11/128 (9%)
 Frame = -3

Query  379  LSATIDSVI--GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNS  206
            L + ++ V+  GP G +GG+ F    +  I +I +S    RN   IG+ +  V  D    
Sbjct  241  LPSKVEGVVTYGPWGGSGGFMFDDGVYSGIRQIKLS----RN---IGVVYIKVEYDCDGE  293

Query  205  DTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYG  26
                           ++D +  D   E L  I+GTFGP +  G NV++S+   T ++++G
Sbjct  294  AVWGGRH--GGTGGYKSDRIIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHG  351

Query  25   PYGPNVGT  2
            PYG   GT
Sbjct  352  PYGEEQGT  359



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            E++ G+SG + P + SG  V+RS+K  TN++ YGPYG   GT
Sbjct  23   EFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGT  64



>ref|XP_006416472.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
 gb|ESQ34825.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
Length=594

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 60/118 (51%), Gaps = 9/118 (8%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGN  176
            +GP G   G+ +       + +IV++ G S     I       +++GS+  +   GG G 
Sbjct  10   VGPWGGQSGHAWDDGMFTTVRQIVVAHGSS-----IDSIQVEYDKNGSSVWSEKRGGKGG  64

Query  175  DLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                T+ D V +D   EYL  + GT+G F   G+  +RS+  ++N+++YGP+G   GT
Sbjct  65   ----TKFDKVKLDYPHEYLTSVRGTYGSFDVWGHLCVRSLTFESNRKKYGPFGVESGT  118



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 12/121 (10%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS+ + P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+   G
Sbjct  14   DSILVEPWGGTGGSEWNYMLKCPIKEILIAHGDCIDS----IMFRTVTEQGTTIDSPKFG  69

Query  187  GGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNV  8
              G      R+ +V      EYL GI GTFG      + V++S+   TN + YGP+G   
Sbjct  70   ADG-----CRDKVVIEANPLEYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEA  122

Query  7    G  5
            G
Sbjct  123  G  123



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 12/121 (10%)
 Frame = -3

Query  364  DSV-IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIG  188
            DS+ + P G  GG  +++     I +I+I+ G   +     + F +V E G+  D+   G
Sbjct  30   DSILVEPWGGTGGSEWNYMLKCPIKEILIAHGDCIDS----IMFRTVTEQGTTIDSPKFG  85

Query  187  GGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNV  8
              G      R+ +V      EYL GI GTFG      + V++S+   TN + YGP+G   
Sbjct  86   ADG-----CRDKVVIEANPLEYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEA  138

Query  7    G  5
            G
Sbjct  139  G  139



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 9/117 (8%)
 Frame = -3

Query  352  GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGND  173
            GP G  GGY F    +  I +I +S    RN   +G+ +  V  D           GG  
Sbjct  245  GPWGGIGGYVFDDGTYTGIRQINLS----RN---VGIVWIRVFYDYHGETIWGSKQGGTG  297

Query  172  LVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                +ND +  D   E L  ISG +GP +  G +V+RS+   T +R+YGPYG   GT
Sbjct  298  GY--KNDKIVFDFPYEALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGT  352



>ref|XP_011074623.1| PREDICTED: jacalin-related lectin 3 [Sesamum indicum]
Length=670

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 59/120 (49%), Gaps = 9/120 (8%)
 Frame = -3

Query  361  SVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGG  182
            +++GP G   GY++    H  I ++ I  G        G+    +  D +     +   G
Sbjct  11   TLVGPWGGQSGYYWDDGVHSTIRQLEIGHG-------TGVDSIRIEYDSTGRSVWSERHG  63

Query  181  GNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            G+    T+ D V ++   E+L  + G +G   + G+ ++RS+  ++N+R+YGP+G   GT
Sbjct  64   GSG--GTKTDKVRLEYPDEFLISVHGYYGSLQERGHVIIRSLTFESNKRKYGPFGVEKGT  121



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/126 (29%), Positives = 62/126 (49%), Gaps = 11/126 (9%)
 Frame = -3

Query  379  LSATIDSVI-GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSD  203
            +   +DS++  P G  GG  ++++    I +I+I+ G   +     + F +V + G    
Sbjct  1    MHVKMDSILLEPWGGTGGSKWNYKLKNPIKEILIAHGDIIDS----IMFRTVTKKGITIG  56

Query  202  TLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGP  23
            +   GG G  +    + +V      EYL GI GTFG +   G +V++S+   TN + YGP
Sbjct  57   SPKFGGNGGQI----SKVVIEATPLEYLTGIKGTFGHY--CGLSVIKSLCFITNVKNYGP  110

Query  22   YGPNVG  5
            +G   G
Sbjct  111  FGCEAG  116



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = -3

Query  136  GEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            G  E+L  +SGTFGP+   G+ V+RSIK  TN++ YGP+G   GT
Sbjct  232  GSSEFLKEVSGTFGPY--EGWKVIRSIKFVTNKKTYGPFGRQEGT  274



>ref|XP_004961357.1| PREDICTED: agglutinin-like [Setaria italica]
Length=208

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = -3

Query  391  QETMLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGS  212
            Q  M+ +     +GP G  GG+ +    H  I  I +S    R  + I + +   + DG 
Sbjct  5    QRKMVVSKKLMKVGPWGGTGGHPWDDGGHSGIRSITVSY--DRFIDSISVEY---DHDGL  59

Query  211  NSDTLTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQRE  32
                   GG G +   T+  + F D   E+L G+SG + P    G  V+RS+  ++NQR 
Sbjct  60   AVPGERHGGAGGNHT-TQIRLGFPD---EHLTGVSGHYSPIAAGGSPVIRSLAFRSNQRA  115

Query  31   YGPYG  17
            YGP+G
Sbjct  116  YGPFG  120



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (10%)
 Frame = -3

Query  367  IDSVIGPEGTNGGYFFSFR-PHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
            +++ IGP G NGG     +   +++  + I SG   +     + F   ++DG    T   
Sbjct  816  LENKIGPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLW  871

Query  190  GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
            GG G  + +   D      E EYL  + GT GPF +     + S+ + TN R YGP+G  
Sbjct  872  GGLGGSVQLINLD------EREYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQP  924

Query  10   VGT  2
             GT
Sbjct  925  QGT  927



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            EYL G+SG + P ++SG  V+RS+  K+N++ YGPYG   GT
Sbjct  82   EYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGT  123



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (10%)
 Frame = -3

Query  367   IDSVIGPEGTNGGYFFSFR-PHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTI  191
             +++ IGP G NGG     +   +++  + I SG   +     + F   ++DG    T   
Sbjct  933   LENKIGPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLW  988

Query  190   GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPN  11
             GG G  + +   D      E EYL  + GT GPF +     + S+ + TN R YGP+G  
Sbjct  989   GGLGGSVQLINLD------EREYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQP  1041

Query  10    VGT  2
              GT
Sbjct  1042  QGT  1044



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 11/118 (9%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGN  176
            IGP G  GG  +S+  +Q I++IVI+ G     N   ++F     D ++ D+ T GG   
Sbjct  32   IGPWGGQGGNPWSYMTNQGINQIVINVG----SNIKSISF----RDTTDLDSATFGGNNP  83

Query  175  DLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            + +  R   V ++   E+L  ISGT+G F  S    + S+   TN+  YGP+G   GT
Sbjct  84   NDIGER-KTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGT  138



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 56/118 (47%), Gaps = 9/118 (8%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGN  176
            +GP G  GG  +    H  + +IVI  GG+     I    F  ++ G +  +   GG G 
Sbjct  14   VGPWGGQGGSPWDDGVHTGVKQIVIVHGGA-----IDSLRFEYDKKGQSVWSEKHGGNGG  68

Query  175  DLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                 + D V ++   E L  +SG +GP       ++RS+  +TN ++YGP+G   GT
Sbjct  69   ----CKTDKVKLEYPEEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQQGT  122



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 55/131 (42%), Gaps = 10/131 (8%)
 Frame = -3

Query  391  QETMLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGS  212
            Q  M+ +     +GP G  GG+ +    H  I  I IS       +   M   SV  D  
Sbjct  4    QRKMVVSKKLMKVGPWGGTGGHPWDDGGHSGIRSITISY------DHRCMESISVEYD--  55

Query  211  NSDTLTIGGGGND-LVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQR  35
              D L + G  +     +    + +    EYL  +SG + P    G  V+RS+  +TN R
Sbjct  56   -RDGLAVPGERHGGAAASHTTQIKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLR  114

Query  34   EYGPYGPNVGT  2
             YGP+G   GT
Sbjct  115  AYGPFGAAEGT  125



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 65/140 (46%), Gaps = 19/140 (14%)
 Frame = -3

Query  412  FCFTIIIQETMLSATIDSVIGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFF  233
            FC    +Q ++ S    + +GP G NGG  +    +  + ++V+  G        G+   
Sbjct  3    FC----MQSSVDSIKKPASVGPWGGNGGSRWDDGIYSGVRQLVVVHG-------TGIDSI  51

Query  232  SVNEDGSNSDTLTI---GGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLR  62
             +  D   S   +    G GGN     + D V +D   E+L  + G +G     G+N++R
Sbjct  52   QIEYDKKGSSIWSEKHGGTGGN-----KTDKVKLDYPDEFLTSVHGYYGSLNQWGHNLVR  106

Query  61   SIKIKTNQREYGPYGPNVGT  2
            S+  ++N++ YGP+G   GT
Sbjct  107  SLSFESNKKTYGPFGVEQGT  126



>ref|XP_009336846.1| PREDICTED: uncharacterized protein LOC103929382 [Pyrus x bretschneideri]
Length=558

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 55/118 (47%), Gaps = 9/118 (8%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGN  176
            +GP G + G  +  R    + ++VI+ G +     I       +E GS+  +   GG G 
Sbjct  13   VGPWGGHNGLIWDDRVRSTVKQLVIAHGAA-----IDSIQIEYDERGSSVWSDKHGGNGG  67

Query  175  DLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                 + D V +    E+L  I G +G   + G   +RS+  K+N+R YGP+G   GT
Sbjct  68   ----WKTDKVKLASPEEFLTSIEGYYGKISEWGPITVRSLTFKSNKRTYGPFGVEQGT  121



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 50/101 (50%), Gaps = 10/101 (10%)
 Frame = -3

Query  304  QKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDTLTIGGGGNDLVVTRNDMVFVDGEGE  125
            +++  I +SSG   +     + F  V++ G   +    GG G       N   FV G  E
Sbjct  181  RRLESITVSSGSIVDS----IKFSYVDQTGQKHNAGPWGGSGG------NQNTFVLGASE  230

Query  124  YLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            ++  +SGTFG +    +N++ S+K  TN + YGP+G   GT
Sbjct  231  FMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGT  271



>ref|XP_007017648.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY14873.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=624

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 13/118 (11%)
 Frame = -3

Query  352  GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSV--NEDGSNSDTLTIGGGG  179
            GP G NGG  F    +  I +I +S    RN   +G+ +     + DG        GG G
Sbjct  272  GPWGGNGGAKFDDGTYTGIRQITLS----RN---VGIVWIKACYDRDGQAVWGSKHGGTG  324

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
                  + D +  D   E L  I+GTFGP +  G NV++S+   TN+ ++GPYG   G
Sbjct  325  G----FKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQG  378



>ref|XP_007017646.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017647.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14871.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14872.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=598

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 13/118 (11%)
 Frame = -3

Query  352  GPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSV--NEDGSNSDTLTIGGGG  179
            GP G NGG  F    +  I +I +S    RN   +G+ +     + DG        GG G
Sbjct  246  GPWGGNGGAKFDDGTYTGIRQITLS----RN---VGIVWIKACYDRDGQAVWGSKHGGTG  298

Query  178  NDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVG  5
                  + D +  D   E L  I+GTFGP +  G NV++S+   TN+ ++GPYG   G
Sbjct  299  G----FKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQG  352



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  EYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
            EYL G+SG + P + SG  V+RSI  K+N++ YGPYG   GT
Sbjct  82   EYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVEQGT  123



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (47%), Gaps = 11/126 (9%)
 Frame = -3

Query  376  SATIDSVIGPEGTNGGYFFSF-RPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSNSDT  200
            S ++ + +GP G NGG         +++  I +SSG   +     + F  V++ G     
Sbjct  156  SQSLRTKVGPWGGNGGSDKDIVEAPRRLESITVSSGTIIDS----IKFSYVDQAGQKRTV  211

Query  199  LTIGGGGNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPY  20
               GG G           FV G  E++  +SGTFG +    +N++ S+K  TN + YGP+
Sbjct  212  GPWGGSGG------KQNTFVLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPF  265

Query  19   GPNVGT  2
            G   GT
Sbjct  266  GQAKGT  271



>ref|XP_008388156.1| PREDICTED: uncharacterized protein LOC103450568 [Malus domestica]
Length=615

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 13/120 (11%)
 Frame = -3

Query  355  IGPEGTNGGYFFSFRPHQKIHKIVISSGGSRNENPIGMTFFSVNEDGSN--SDTLTIGGG  182
            +GP G + G  +  R H  + ++VI+ G + +   I       +E GS+  SD     GG
Sbjct  14   VGPWGGHNGLIWDDRVHSTVKQLVIAHGAAIDSIQI-----EYDERGSSVWSDKHGRNGG  68

Query  181  GNDLVVTRNDMVFVDGEGEYLNGISGTFGPFIDSGYNVLRSIKIKTNQREYGPYGPNVGT  2
                   + D V +    E+L  I G +G   + G   +RS+  K+N+R YGP+G   GT
Sbjct  69   ------WKTDKVKLASPEEFLTSIEGYYGKKSEWGPITVRSLTFKSNKRTYGPFGVEQGT  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525793352945