BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1362_g1_i1 len=1711 path=[1689:0-71 1761:72-1710]

Length=1711
                                                                      Score     E

ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...    311   2e-92   
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...    311   4e-92   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...    311   1e-90   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             301   8e-87   
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884    300   8e-86   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             295   2e-85   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098    284   1e-84   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...    289   4e-84   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    289   2e-81   
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    286   2e-80   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297    269   5e-80   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048    283   9e-80   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    285   1e-79   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         282   3e-79   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    283   3e-79   Oryza sativa Japonica Group [Japonica rice]
gb|ADK92871.1|  retrotransposon protein                                 271   9e-79   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    283   2e-78   
emb|CCA66044.1|  hypothetical protein                                   280   2e-78   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    277   3e-78   
ref|XP_004292002.1|  PREDICTED: uncharacterized protein LOC101312896    282   3e-78   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    278   4e-78   
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    275   6e-78   
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    275   7e-78   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    277   1e-77   
ref|XP_002518871.1|  conserved hypothetical protein                     270   1e-77   Ricinus communis
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...    268   1e-77   
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431    276   1e-77   
gb|EEC83100.1|  hypothetical protein OsI_28249                          277   2e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_009139371.1|  PREDICTED: putative ribonuclease H protein A...    268   2e-77   
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    277   2e-77   
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    274   7e-77   
ref|XP_010686872.1|  PREDICTED: uncharacterized protein LOC104901027    274   1e-76   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase               269   2e-76   Oryza sativa [red rice]
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    275   3e-76   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    273   3e-76   
emb|CAH66131.1|  OSIGBa0135L04.5                                        265   4e-76   Oryza sativa [red rice]
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...    266   7e-76   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         274   9e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    274   1e-75   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    273   1e-75   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                          263   1e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    269   7e-75   
ref|NP_001066197.2|  Os12g0156200                                       271   7e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ19327.1|  bZIP-like protein                                       271   1e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    269   1e-74   
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...    261   1e-74   
emb|CCA66050.1|  hypothetical protein                                   269   2e-74   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    267   2e-74   
ref|XP_008387750.1|  PREDICTED: putative ribonuclease H protein A...    260   4e-74   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    264   4e-74   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     269   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    265   5e-74   
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    266   6e-74   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...    263   7e-74   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764    266   8e-74   
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...    262   9e-74   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     266   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    261   2e-72   
gb|ABD32189.2|  Polynucleotidyl transferase, Ribonuclease H fold        254   3e-72   Medicago truncatula
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    261   3e-72   
ref|XP_009149643.1|  PREDICTED: putative ribonuclease H protein A...    255   4e-72   
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             261   6e-72   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    261   6e-72   
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...    259   7e-72   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    262   8e-72   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    262   8e-72   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             262   1e-71   
ref|XP_007210987.1|  hypothetical protein PRUPE_ppa021345mg             255   2e-71   
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...    256   2e-71   
ref|XP_009114067.1|  PREDICTED: putative ribonuclease H protein A...    249   2e-71   
ref|NP_001175214.1|  Os07g0501200                                       251   3e-71   
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764    259   4e-71   
ref|XP_009138597.1|  PREDICTED: putative ribonuclease H protein A...    251   4e-71   
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    258   6e-71   
emb|CCA66040.1|  hypothetical protein                                   259   6e-71   
gb|EPS61425.1|  hypothetical protein M569_13371                         258   7e-71   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588    258   8e-71   
emb|CCA66054.1|  hypothetical protein                                   258   1e-70   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    259   1e-70   
gb|EPS73861.1|  hypothetical protein M569_00896                         258   2e-70   
ref|XP_009124085.1|  PREDICTED: putative ribonuclease H protein A...    248   2e-70   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              258   4e-70   
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    256   4e-70   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             254   6e-70   
ref|XP_010468701.1|  PREDICTED: uncharacterized protein LOC104748809    249   6e-70   
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312    254   6e-70   
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    256   9e-70   
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    252   9e-70   
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    255   1e-69   
gb|EAZ40645.1|  hypothetical protein OsJ_25114                          246   1e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83784.1|  hypothetical protein OsI_29682                          248   1e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_010667928.1|  PREDICTED: uncharacterized protein LOC104884923    251   1e-69   
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg             250   1e-69   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    255   2e-69   
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888    253   2e-69   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    252   2e-69   
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    251   3e-69   
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    251   3e-69   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    254   4e-69   
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             251   4e-69   
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    252   5e-69   
emb|CCA66036.1|  hypothetical protein                                   253   9e-69   
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    252   1e-68   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    252   2e-68   
ref|XP_009139523.1|  PREDICTED: putative ribonuclease H protein A...    246   2e-68   
ref|XP_006482369.1|  PREDICTED: putative ribonuclease H protein A...    241   2e-68   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    251   3e-68   
gb|EEE59920.1|  hypothetical protein OsJ_12548                          249   4e-68   Oryza sativa Japonica Group [Japonica rice]
emb|CAB75484.1|  putative protein                                       247   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...    247   5e-68   
ref|XP_008378657.1|  PREDICTED: putative ribonuclease H protein A...    243   5e-68   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    250   6e-68
ref|XP_009120142.1|  PREDICTED: putative ribonuclease H protein A...    242   6e-68   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509    249   7e-68   
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...    241   8e-68   
gb|EPS72636.1|  hypothetical protein M569_02121                         250   8e-68   
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    250   1e-67   
ref|XP_010446251.1|  PREDICTED: uncharacterized protein LOC104729051    245   1e-67   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    247   1e-67   
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    245   2e-67   
ref|XP_009150027.1|  PREDICTED: putative ribonuclease H protein A...    240   2e-67   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    246   3e-67   
gb|EEE50824.1|  hypothetical protein OsJ_31232                          249   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664    243   3e-67   
ref|XP_007214195.1|  hypothetical protein PRUPE_ppa020989mg             237   4e-67   
gb|EEE53388.1|  hypothetical protein OsJ_36435                          243   5e-67   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76892.1|  hypothetical protein VITISV_005356                     248   5e-67   Vitis vinifera
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    247   5e-67   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768    248   5e-67   
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    246   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356    246   6e-67   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         248   7e-67   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76169.1|  hypothetical protein OsI_13484                          248   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    245   1e-66   
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890    247   1e-66   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    244   1e-66   
ref|XP_010468816.1|  PREDICTED: uncharacterized protein LOC104748941    244   1e-66   
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...    243   2e-66   
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...    234   2e-66   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...    243   3e-66   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     245   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ABF97084.1|  retrotransposon protein, putative, unclassified         244   3e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             243   3e-66   
ref|XP_004305156.1|  PREDICTED: putative ribonuclease H protein A...    241   4e-66   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    245   4e-66   
gb|EEC69465.1|  hypothetical protein OsI_38661                          240   4e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001060259.1|  Os07g0613900                                       245   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    244   4e-66   
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    244   5e-66   
ref|XP_009138123.1|  PREDICTED: putative ribonuclease H protein A...    240   5e-66   
ref|XP_008353155.1|  PREDICTED: putative ribonuclease H protein A...    238   5e-66   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714    244   5e-66   
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    242   6e-66   
ref|XP_010418809.1|  PREDICTED: uncharacterized protein LOC104704411    240   6e-66   
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794    245   7e-66   
ref|XP_010039376.1|  PREDICTED: uncharacterized protein LOC104428079    244   7e-66   
gb|EEC68711.1|  hypothetical protein OsI_37193                          244   8e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_009105552.1|  PREDICTED: putative ribonuclease H protein A...    236   1e-65   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743    243   1e-65   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187    244   1e-65   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160    244   1e-65   
ref|XP_009121250.1|  PREDICTED: uncharacterized protein LOC103846083    239   1e-65   
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219    242   1e-65   
ref|XP_008372910.1|  PREDICTED: putative ribonuclease H protein A...    235   2e-65   
ref|XP_010424493.1|  PREDICTED: uncharacterized protein LOC104709611    239   2e-65   
ref|XP_010506904.1|  PREDICTED: uncharacterized protein LOC104783445    240   2e-65   
gb|EEE52627.1|  hypothetical protein OsJ_34967                          243   2e-65   Oryza sativa Japonica Group [Japonica rice]
emb|CDX68427.1|  BnaC01g25050D                                          237   2e-65   
gb|ABA96203.1|  retrotransposon protein, putative, unclassified, ...    243   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107571.1|  PREDICTED: putative ribonuclease H protein A...    237   3e-65   
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    240   4e-65   
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515    241   5e-65   
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    239   6e-65   
ref|XP_008232502.1|  PREDICTED: putative ribonuclease H protein A...    233   7e-65   
ref|NP_194638.1|  ribonuclease H-like protein                           233   7e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EEE55133.1|  hypothetical protein OsJ_02920                          239   8e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298    241   1e-64   
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148    239   1e-64   
ref|XP_008245249.1|  PREDICTED: putative ribonuclease H protein A...    233   1e-64   
ref|XP_008225175.1|  PREDICTED: putative ribonuclease H protein A...    233   1e-64   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...    241   2e-64   
ref|XP_009116203.1|  PREDICTED: putative ribonuclease H protein A...    236   2e-64   
ref|XP_009108257.1|  PREDICTED: putative ribonuclease H protein A...    234   2e-64   
ref|XP_008345114.1|  PREDICTED: putative ribonuclease H protein A...    238   2e-64   
ref|XP_007204004.1|  hypothetical protein PRUPE_ppa025711mg             231   2e-64   
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    237   2e-64   
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             240   3e-64   
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    236   3e-64   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    239   3e-64   
ref|XP_009140406.1|  PREDICTED: putative ribonuclease H protein A...    234   4e-64   
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622    238   4e-64   
ref|XP_010446022.1|  PREDICTED: uncharacterized protein LOC104728786    236   5e-64   
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    236   7e-64   
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    237   8e-64   
ref|XP_009113011.1|  PREDICTED: putative ribonuclease H protein A...    233   9e-64   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191    239   1e-63   
gb|ABN07997.1|  contains similarity to reverse trancriptase , rel...    225   1e-63   Medicago truncatula
gb|EEC74955.1|  hypothetical protein OsI_10942                          235   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_007219602.1|  hypothetical protein PRUPE_ppa023113mg             234   2e-63   
ref|XP_010480950.1|  PREDICTED: uncharacterized protein LOC104759762    238   2e-63   
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339    234   2e-63   
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159    238   2e-63   
gb|EEC84753.1|  hypothetical protein OsI_31756                          237   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_002522452.1|  nucleic acid binding protein, putative             227   2e-63   Ricinus communis
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...    233   3e-63   
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795    234   3e-63   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    235   4e-63   
ref|XP_008352230.1|  PREDICTED: putative ribonuclease H protein A...    232   4e-63   
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    233   4e-63   
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    234   5e-63   
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845    233   5e-63   
ref|XP_009142123.1|  PREDICTED: putative ribonuclease H protein A...    231   7e-63   
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         236   8e-63   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               236   9e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CDP09717.1|  unnamed protein product                                228   9e-63   
ref|XP_010451741.1|  PREDICTED: uncharacterized protein LOC104733916    232   1e-62   
ref|XP_009126322.1|  PREDICTED: putative ribonuclease H protein A...    228   1e-62   
ref|XP_009118884.1|  PREDICTED: putative ribonuclease H protein A...    227   1e-62   
ref|XP_009114817.1|  PREDICTED: putative ribonuclease H protein A...    224   2e-62   
gb|EEE62189.1|  hypothetical protein OsJ_16976                          228   2e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81552.1|  hypothetical protein OsI_24974                          232   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...    231   2e-62   
ref|XP_010513536.1|  PREDICTED: uncharacterized protein LOC104789557    230   2e-62   
emb|CDX80327.1|  BnaC09g34150D                                          226   2e-62   
ref|XP_009115737.1|  PREDICTED: uncharacterized protein LOC103840975    231   2e-62   
ref|XP_006492749.1|  PREDICTED: uncharacterized protein LOC102612946    226   3e-62   
ref|XP_007220081.1|  hypothetical protein PRUPE_ppa024663mg             228   3e-62   
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882    233   3e-62   
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    231   5e-62   
gb|EAZ03196.1|  hypothetical protein OsI_25347                          230   5e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725    233   5e-62   
ref|XP_009141426.1|  PREDICTED: putative ribonuclease H protein A...    228   5e-62   
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg             231   7e-62   
ref|XP_010468497.1|  PREDICTED: uncharacterized protein LOC104748579    230   7e-62   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    230   8e-62   
gb|EAY96391.1|  hypothetical protein OsI_18290                          226   8e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009115971.1|  PREDICTED: putative ribonuclease H protein A...    226   9e-62   
gb|EEC68887.1|  hypothetical protein OsI_37529                          233   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_009114092.1|  PREDICTED: uncharacterized protein LOC103839337    228   1e-61   
ref|XP_004301010.1|  PREDICTED: putative ribonuclease H protein A...    227   2e-61   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase     231   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAX94970.1|  retrotransposon protein, putative, unclassified         228   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010445303.1|  PREDICTED: uncharacterized protein LOC104727950    228   2e-61   
ref|XP_009110781.1|  PREDICTED: putative ribonuclease H protein A...    225   2e-61   
dbj|BAB08714.1|  non-LTR retroelement reverse transcriptase-like ...    230   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374008.1|  PREDICTED: putative ribonuclease H protein A...    224   3e-61   
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579    228   3e-61   
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg             228   3e-61   
ref|XP_009138589.1|  PREDICTED: putative ribonuclease H protein A...    226   3e-61   
ref|XP_009115748.1|  PREDICTED: uncharacterized protein LOC103840987    227   4e-61   
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    229   4e-61   
ref|XP_009107553.1|  PREDICTED: uncharacterized protein LOC103833206    227   5e-61   
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    227   5e-61   
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   5e-61   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...    226   7e-61   
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...    227   8e-61   
ref|XP_010424608.1|  PREDICTED: uncharacterized protein LOC104709742    226   9e-61   
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...    227   1e-60   
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             226   1e-60   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    229   1e-60   
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    226   1e-60   
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    228   2e-60   
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362    226   2e-60   
ref|XP_008393342.1|  PREDICTED: putative ribonuclease H protein A...    224   3e-60   
ref|XP_009146521.1|  PREDICTED: putative ribonuclease H protein A...    222   3e-60   
gb|AAF18538.1|AC006551_24  Very similar to retrotransposon revers...    227   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463143.1|  PREDICTED: uncharacterized protein LOC104743796    223   5e-60   
emb|CDX84367.1|  BnaC03g51330D                                          221   5e-60   
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    226   6e-60   
ref|XP_009103788.1|  PREDICTED: uncharacterized protein LOC103829849    227   7e-60   
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468    223   8e-60   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    227   9e-60   
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...    224   1e-59   
ref|XP_009136063.1|  PREDICTED: putative ribonuclease H protein A...    221   1e-59   
ref|XP_009145592.1|  PREDICTED: putative ribonuclease H protein A...    220   1e-59   
ref|XP_004306191.1|  PREDICTED: putative ribonuclease H protein A...    222   1e-59   
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    226   1e-59   
ref|XP_008347064.1|  PREDICTED: putative ribonuclease H protein A...    223   1e-59   
emb|CDP14470.1|  unnamed protein product                                220   1e-59   
ref|XP_007013204.1|  Ribonuclease H-like superfamily protein            218   2e-59   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254    224   2e-59   
ref|XP_008338205.1|  PREDICTED: putative ribonuclease H protein A...    223   2e-59   
gb|EPS63383.1|  hypothetical protein M569_11401                         226   2e-59   
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg             225   2e-59   
ref|XP_009120002.1|  PREDICTED: putative ribonuclease H protein A...    219   2e-59   
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    226   2e-59   
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282    225   3e-59   
emb|CAE04866.2|  OSJNBa0086O06.14                                       224   3e-59   
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    224   3e-59   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    224   3e-59   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    224   3e-59   
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    222   4e-59   
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222    221   4e-59   
gb|AAK52166.1|AC084831_20  putative reverse transcriptase               223   5e-59   
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...    216   5e-59   
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg             221   6e-59   
ref|XP_009130450.1|  PREDICTED: putative ribonuclease H protein A...    218   6e-59   
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    224   6e-59   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964    224   7e-59   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    223   8e-59   
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    223   8e-59   
ref|XP_008338514.1|  PREDICTED: uncharacterized protein LOC103401576    221   9e-59   
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         224   1e-58   
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         224   1e-58   
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758    224   1e-58   
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           223   1e-58   
ref|XP_004305133.1|  PREDICTED: putative ribonuclease H protein A...    215   1e-58   
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955    222   2e-58   
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase     223   2e-58   
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    222   2e-58   
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852    223   2e-58   
ref|XP_010424753.1|  PREDICTED: uncharacterized protein LOC104709909    218   2e-58   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    219   2e-58   
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    222   2e-58   
gb|EPS65500.1|  hypothetical protein M569_09277                         206   2e-58   
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...    216   3e-58   
gb|AAD32950.1|  putative non-LTR retroelement reverse transcriptase     218   3e-58   
ref|XP_008231382.1|  PREDICTED: putative ribonuclease H protein A...    216   3e-58   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  223   3e-58   
gb|EMT20940.1|  ABC transporter C family member 10                      223   4e-58   
gb|EAZ04413.1|  hypothetical protein OsI_26557                          209   4e-58   
ref|XP_009108245.1|  PREDICTED: putative ribonuclease H protein A...    212   5e-58   
ref|XP_008340321.1|  PREDICTED: putative ribonuclease H protein A...    214   5e-58   
gb|EEC83406.1|  hypothetical protein OsI_28856                          220   7e-58   
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816    218   9e-58   
ref|XP_010468192.1|  PREDICTED: uncharacterized protein LOC104748214    217   1e-57   
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249    219   1e-57   
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    221   1e-57   
ref|XP_009102306.1|  PREDICTED: putative ribonuclease H protein A...    216   1e-57   
gb|EEE69154.1|  hypothetical protein OsJ_28290                          214   2e-57   
ref|XP_008359109.1|  PREDICTED: putative ribonuclease H protein A...    209   2e-57   
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285    218   4e-57   
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    216   4e-57   
gb|EEE61581.1|  hypothetical protein OsJ_15963                          219   5e-57   
ref|XP_010462630.1|  PREDICTED: uncharacterized protein LOC104743220    214   5e-57   
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961    218   5e-57   
gb|ACK44480.1|  hypothetical protein 2                                  207   5e-57   
gb|EEC81662.1|  hypothetical protein OsI_25211                          211   8e-57   
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687    215   8e-57   
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164    216   9e-57   
ref|XP_010451493.1|  PREDICTED: uncharacterized protein LOC104733622    216   9e-57   
ref|XP_008364703.1|  PREDICTED: putative ribonuclease H protein A...    214   1e-56   
ref|XP_009108635.1|  PREDICTED: putative ribonuclease H protein A...    214   1e-56   
gb|EEE54600.1|  hypothetical protein OsJ_01823                          212   1e-56   
ref|XP_010696021.1|  PREDICTED: uncharacterized protein LOC104908596    213   1e-56   
gb|ABD33126.2|  RNA-directed DNA polymerase (Reverse transcriptase)     212   1e-56   
gb|EEC72938.1|  hypothetical protein OsI_06800                          210   1e-56   
ref|XP_009141427.1|  PREDICTED: putative ribonuclease H protein A...    210   2e-56   
ref|XP_008377038.1|  PREDICTED: putative ribonuclease H protein A...    206   2e-56   
ref|XP_009113857.1|  PREDICTED: putative ribonuclease H protein A...    211   2e-56   
gb|AAK71569.2|AC087852_29  putative reverse transcriptase               217   2e-56   
emb|CDY00591.1|  BnaC04g23340D                                          209   2e-56   
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase     214   4e-56   
ref|XP_004301407.1|  PREDICTED: putative ribonuclease H protein A...    210   4e-56   
ref|XP_009105634.1|  PREDICTED: putative ribonuclease H protein A...    209   4e-56   
ref|XP_009150006.1|  PREDICTED: uncharacterized protein LOC103873342    212   5e-56   
ref|XP_009140188.1|  PREDICTED: uncharacterized protein LOC103864181    212   5e-56   
gb|ABD28498.2|  Polynucleotidyl transferase, Ribonuclease H fold        205   5e-56   
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    215   5e-56   
ref|XP_009113844.1|  PREDICTED: putative ribonuclease H protein A...    205   5e-56   
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937    214   7e-56   
ref|XP_009122881.1|  PREDICTED: putative ribonuclease H protein A...    211   7e-56   
ref|XP_007036869.1|  Ribonuclease H-like superfamily protein            209   7e-56   
ref|XP_009137131.1|  PREDICTED: putative ribonuclease H protein A...    207   7e-56   
ref|XP_008365211.1|  PREDICTED: putative ribonuclease H protein A...    206   8e-56   
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    214   8e-56   
ref|XP_006478212.1|  PREDICTED: putative ribonuclease H protein A...    204   8e-56   
ref|XP_009151523.1|  PREDICTED: uncharacterized protein LOC103874848    214   8e-56   
ref|XP_010419203.1|  PREDICTED: uncharacterized protein LOC104704888    212   8e-56   
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    214   1e-55   
ref|XP_004293049.1|  PREDICTED: putative ribonuclease H protein A...    209   2e-55   
ref|XP_009110782.1|  PREDICTED: uncharacterized protein LOC103836292    210   2e-55   
gb|EPS61668.1|  hypothetical protein M569_13125                         201   2e-55   
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    212   3e-55   
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...    211   3e-55   
gb|EMS67416.1|  Protein argonaute 1D                                    213   3e-55   
ref|XP_007219414.1|  hypothetical protein PRUPE_ppa021915mg             205   3e-55   
ref|XP_006478211.1|  PREDICTED: putative ribonuclease H protein A...    204   3e-55   
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275    212   4e-55   
ref|XP_009135931.1|  PREDICTED: putative ribonuclease H protein A...    206   4e-55   
ref|XP_009139334.1|  PREDICTED: putative ribonuclease H protein A...    207   4e-55   
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296    212   4e-55   
ref|XP_009113183.1|  PREDICTED: putative ribonuclease H protein A...    206   4e-55   
ref|XP_004295829.1|  PREDICTED: uncharacterized protein LOC101302635    210   5e-55   
ref|XP_009127063.1|  PREDICTED: uncharacterized protein LOC103851935    209   5e-55   
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    211   5e-55   
ref|XP_009137704.1|  PREDICTED: putative ribonuclease H protein A...    204   6e-55   
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977    212   6e-55   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    212   6e-55   
ref|XP_010480989.1|  PREDICTED: uncharacterized protein LOC104759803    209   7e-55   
ref|XP_004297906.1|  PREDICTED: putative ribonuclease H protein A...    200   9e-55   
gb|AAD17395.1|  putative non-LTR retroelement reverse transcriptase     211   1e-54   
ref|XP_010030447.1|  PREDICTED: uncharacterized protein LOC104420277    210   1e-54   
emb|CDX95988.1|  BnaA07g27430D                                          204   1e-54   
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359    209   4e-54   
ref|XP_010463404.1|  PREDICTED: uncharacterized protein LOC104744076    206   4e-54   
ref|XP_009126876.1|  PREDICTED: putative ribonuclease H protein A...    203   4e-54   
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514    206   5e-54   
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896    209   6e-54   
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719    209   6e-54   
ref|XP_008355518.1|  PREDICTED: putative ribonuclease H protein A...    207   7e-54   
dbj|BAE79382.1|  unnamed protein product                                209   7e-54   
ref|XP_008386420.1|  PREDICTED: putative ribonuclease H protein A...    199   8e-54   
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein               208   1e-53   
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890    207   2e-53   
dbj|BAM28750.1|  reverse transcriptase-like protein                     193   2e-53   
emb|CAE02147.1|  OSJNBa0081G05.2                                        208   2e-53   
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360    207   2e-53   
ref|XP_009124128.1|  PREDICTED: uncharacterized protein LOC103849058    206   3e-53   
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500    205   3e-53   
gb|EAZ09713.1|  hypothetical protein OsI_32001                          196   3e-53   
dbj|BAE79385.1|  unnamed protein product                                207   3e-53   
ref|XP_009124577.1|  PREDICTED: uncharacterized protein LOC103849567    206   4e-53   
emb|CAN63032.1|  hypothetical protein VITISV_024672                     207   4e-53   
ref|XP_008345261.1|  PREDICTED: putative ribonuclease H protein A...    199   5e-53   
ref|XP_010686132.1|  PREDICTED: uncharacterized protein LOC104900412    206   5e-53   
ref|XP_010695081.1|  PREDICTED: uncharacterized protein LOC104907789    199   5e-53   
dbj|BAM28751.1|  reverse transcriptase-like protein                     192   6e-53   
ref|XP_009113015.1|  PREDICTED: putative ribonuclease H protein A...    202   6e-53   
gb|EEC78920.1|  hypothetical protein OsI_19335                          201   8e-53   
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...    203   1e-52   
ref|XP_009119498.1|  PREDICTED: putative ribonuclease H protein A...    200   1e-52   
ref|XP_008391021.1|  PREDICTED: putative ribonuclease H protein A...    201   1e-52   
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    206   2e-52   
ref|XP_009129017.1|  PREDICTED: uncharacterized protein LOC103853864    204   2e-52   
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...    205   2e-52   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050    198   3e-52   
ref|XP_009117698.1|  PREDICTED: putative ribonuclease H protein A...    197   3e-52   
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075    204   3e-52   
ref|XP_009148205.1|  PREDICTED: putative ribonuclease H protein A...    197   4e-52   
ref|XP_009114468.1|  PREDICTED: putative ribonuclease H protein A...    198   4e-52   
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    202   5e-52   
ref|XP_010445461.1|  PREDICTED: uncharacterized protein LOC104728130    200   6e-52   
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321    201   6e-52   
ref|XP_009103825.1|  PREDICTED: putative ribonuclease H protein A...    197   9e-52   
ref|XP_004305827.1|  PREDICTED: putative ribonuclease H protein A...    200   1e-51   
ref|XP_008348723.1|  PREDICTED: uncharacterized protein LOC103411886    199   1e-51   
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)     197   1e-51   
dbj|BAE79384.1|  unnamed protein product                                203   1e-51   
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135    201   1e-51   
ref|XP_009107743.1|  PREDICTED: uncharacterized protein LOC103833410    201   1e-51   
emb|CDY43469.1|  BnaC08g10840D                                          201   2e-51   
ref|XP_009117147.1|  PREDICTED: putative ribonuclease H protein A...    190   2e-51   
ref|XP_010480831.1|  PREDICTED: uncharacterized protein LOC104759619    198   2e-51   
ref|XP_010481146.1|  PREDICTED: uncharacterized protein LOC104759984    197   3e-51   
ref|XP_009139680.1|  PREDICTED: putative ribonuclease H protein A...    194   3e-51   
ref|XP_008808644.1|  PREDICTED: putative ribonuclease H protein A...    199   3e-51   
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885    201   3e-51   
gb|EPS60183.1|  hypothetical protein M569_14621                         189   4e-51   
ref|XP_006478726.1|  PREDICTED: putative ribonuclease H protein A...    193   4e-51   
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    199   4e-51   
ref|XP_010430686.1|  PREDICTED: uncharacterized protein LOC104714917    193   4e-51   
ref|XP_009123796.1|  PREDICTED: putative ribonuclease H protein A...    195   5e-51   
ref|XP_009119473.1|  PREDICTED: putative ribonuclease H protein A...    189   5e-51   
ref|XP_010495331.1|  PREDICTED: uncharacterized protein LOC104772408    198   6e-51   
ref|XP_010495271.1|  PREDICTED: uncharacterized protein LOC104772340    198   6e-51   
ref|XP_009123205.1|  PREDICTED: putative ribonuclease H protein A...    194   7e-51   
ref|XP_010481092.1|  PREDICTED: uncharacterized protein LOC104759918    196   9e-51   
gb|AAS55787.1|  hypothetical protein                                    200   9e-51   
ref|XP_006655090.1|  PREDICTED: uncharacterized protein LOC102699406    199   1e-50   
ref|XP_009123721.1|  PREDICTED: putative ribonuclease H protein A...    195   1e-50   
gb|AAF69169.1|AC007915_21  F27F5.21                                     198   1e-50   
ref|XP_009113510.1|  PREDICTED: putative ribonuclease H protein A...    191   1e-50   
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    199   1e-50   
ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255    191   1e-50   
ref|XP_010684764.1|  PREDICTED: uncharacterized protein LOC104899297    197   1e-50   
ref|XP_002468588.1|  hypothetical protein SORBIDRAFT_01g048580          192   2e-50   
ref|XP_008369650.1|  PREDICTED: putative ribonuclease H protein A...    194   2e-50   
ref|XP_010501979.1|  PREDICTED: uncharacterized protein LOC104779321    196   2e-50   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    196   3e-50   
ref|XP_009138585.1|  PREDICTED: putative ribonuclease H protein A...    192   3e-50   
ref|XP_004308707.1|  PREDICTED: putative ribonuclease H protein A...    191   3e-50   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    197   3e-50   
ref|XP_010696345.1|  PREDICTED: uncharacterized protein LOC104908875    194   4e-50   
ref|XP_009150812.1|  PREDICTED: putative ribonuclease H protein A...    192   4e-50   
ref|XP_009130307.1|  PREDICTED: putative ribonuclease H protein A...    192   5e-50   
gb|EEC73664.1|  hypothetical protein OsI_08202                          194   5e-50   
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...    194   6e-50   
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     197   7e-50   
ref|XP_009144097.1|  PREDICTED: putative ribonuclease H protein A...    192   7e-50   
gb|EEC75230.1|  hypothetical protein OsI_11503                          193   9e-50   
ref|XP_007021872.1|  Uncharacterized protein TCM_031959                 196   1e-49   
ref|XP_009121253.1|  PREDICTED: uncharacterized protein LOC103846086    192   1e-49   
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949    194   1e-49   
ref|XP_009121334.1|  PREDICTED: putative ribonuclease H protein A...    190   2e-49   
ref|XP_010463319.1|  PREDICTED: uncharacterized protein LOC104743986    192   2e-49   
gb|EEE50691.1|  hypothetical protein OsJ_30951                          192   3e-49   
gb|ABF95850.1|  retrotransposon protein, putative, unclassified         193   4e-49   
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    194   4e-49   
ref|XP_008388177.1|  PREDICTED: putative ribonuclease H protein A...    190   4e-49   
ref|XP_010512944.1|  PREDICTED: uncharacterized protein LOC104788863    192   4e-49   
ref|XP_009119741.1|  PREDICTED: putative ribonuclease H protein A...    189   4e-49   
gb|EEC75227.1|  hypothetical protein OsI_11496                          194   5e-49   
ref|XP_010513530.1|  PREDICTED: uncharacterized protein LOC104789549    192   7e-49   
ref|XP_008390254.1|  PREDICTED: putative ribonuclease H protein A...    191   7e-49   
ref|XP_008237121.1|  PREDICTED: putative ribonuclease H protein A...    188   8e-49   
ref|XP_010468796.1|  PREDICTED: uncharacterized protein LOC104748915    192   8e-49   
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891    194   8e-49   
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832    193   9e-49   
ref|XP_008355160.1|  PREDICTED: putative ribonuclease H protein A...    188   1e-48   



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score =   311 bits (798),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/521 (35%), Positives = 292/521 (56%), Gaps = 17/521 (3%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
               ++I +W   F S  G+E+L+K+V QA+P+YAM++F LP GL  D+++ + GFWWG   
Sbjct  183   IINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGK-K  241

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W  W++LC  KK GG+GFR +  FN AL++KQ+WR+   PESL A++MK KY+
Sbjct  242   REKRSIHWSKWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYF  301

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              +S F +A+ G NPS++W S+L  + +I+   RWRIG+G  V+++   WLP     +  +
Sbjct  302   RHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPIS  361

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
             P  P L   +  S+L +    W D+V+R  F+  DA  IL IP+P+    D+++W  D+K
Sbjct  362   P--PSLPLDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHYDKK  419

Query  990   GVFTVKSCYK-AISLDLDSVPIA------SWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             G ++VKS Y+ A+ +   + P +      SW++IW + +P + K F+W+  +  LPT++ 
Sbjct  420   GNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSEN  479

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKC  658
             L  RRI  +P C  C +  E+ FH L +C  + + W+L  FE      + +     +   
Sbjct  480   LWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLAL  539

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
              +        L V +CW+IW +RN  +++N     +  V  ++A+ + +K       Q  
Sbjct  540   ADRRSKTEMELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAF  599

Query  477   RSQHQYITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC--NSWIGV  307
               Q     K W  P  GWFK+NVDAA+ + ++++GLG V+RN  G F +AA   + WI  
Sbjct  600   SDQDLVSHKHWKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDR  659

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
             +   EAE  A R  L   +      + VE+DS  V   +S+
Sbjct  660   VDYAEAE--ATRFGLEVAESAGCLPLIVETDSKEVTDLVSA  698



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score =   311 bits (796),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 179/521 (34%), Positives = 293/521 (56%), Gaps = 17/521 (3%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
               ++I +W   F S  G+E+L+K+V QA+P+YAM++F LP GL  D+++ + GFWWG   
Sbjct  183   IINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGK-K  241

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W  W++LC  KK GG+GFR +  FN AL++KQ+WR+   PESL A++MK KY+
Sbjct  242   REKRSIHWSKWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYF  301

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              +S F +A+ G NPS++W S+L  + +I+   RWRIG+G  V+++   WLP     +  +
Sbjct  302   RHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPIS  361

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
             P  P L   +  S+L +    W D+V+R  F+  DA  IL IP+P+    D+++W  D+K
Sbjct  362   P--PSLPLDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHYDKK  419

Query  990   GVFTVKSCYK-AISLDLDSVPIA------SWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             G ++VKS Y+ A+ +   + P +      SW++IW + +P + K F+W+  +  LPT++ 
Sbjct  420   GNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSEN  479

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKC  658
             L  RRI  +P C  C +  E+ FH L +C  + + W+L  FE      + +     +   
Sbjct  480   LWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLAL  539

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
              +        L V +CW+IW +RN  +++N     +  V  ++A+ + +K       Q  
Sbjct  540   ADRRSKTEMELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAF  599

Query  477   RSQHQYITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC--NSWIGV  307
              +Q     K W  P  GWFK+NVDAA+ + ++++GLG V+RN  G F +AA   + W+  
Sbjct  600   SNQDLVSHKHWKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWLDR  659

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
             +   EAE  A R  L   +      + VE+DS  V   +S+
Sbjct  660   VDYAEAE--ATRFGLEVAESAGCLPLIVETDSKEVTDLVSA  698



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score =   311 bits (796),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 179/522 (34%), Positives = 295/522 (57%), Gaps = 19/522 (4%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
               ++I +W   F S  G+E+L+K+V QA+P+YAM++F LP GL  D+++ + GFWWG   
Sbjct  386   IINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGK-K  444

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W  W++LC  KK GG+GFR +  FN AL++KQ+WR+   PESL A++MK KY+
Sbjct  445   REKRSIHWSKWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYF  504

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              +S F +A+ G NPS++W S+L  + +I+   RWRIG+G  V+++   WLP     +  +
Sbjct  505   RHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPIS  564

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
             P  P L   +  S+L +    W D+V+R  F+  DA  IL IP+P+    D+++W  D+K
Sbjct  565   P--PSLPLDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHYDKK  622

Query  990   GVFTVKSCYK-AISLDLDSVPIA------SWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             G ++VKS Y+ A+ +   + P +      SW++IW + +P + K F+W+  +  LPT++ 
Sbjct  623   GNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSEN  682

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKC  658
             L  RRI  +P C  C +  E+ FH L +C  + + W+L  FE      + +     +   
Sbjct  683   LWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLAL  742

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
              +        L V +CW+IW +RN  +++N     +  V  ++A+ + +K   ++   Q 
Sbjct  743   ADRRSKTEMELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKR-IQMPQLQA  801

Query  477   RSQHQYIT--KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC--NSWIG  310
              S    ++   W  P  GWFK+NVDAA+ + ++++GLG V+RN  G F +AA   + WI 
Sbjct  802   FSDQDLVSHKHWKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWID  861

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
              +   EAE  A R  L   +      + VE+DS  V   +S+
Sbjct  862   RVDYAEAE--ATRFGLEVAESAGCLPLIVETDSKEVTDLVSA  901



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score =   301 bits (770),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 180/537 (34%), Positives = 279/537 (52%), Gaps = 28/537 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++++W  + LS AG+E+L+K V QA+P Y M+ FLLP+ +  D+ + +  FWW N  T+ 
Sbjct  420   KLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSCFLLPKYVCEDLNKLVAQFWW-NSSTEN  478

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWD+LC PK+ GG+GFR +  FNLALL+KQ WRL  +P+SL  K++KAKY+P  
Sbjct  479   KKIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLVTKVLKAKYFPTR  538

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +       S VW SL + + +I    RW++G+G ++ IW D WLP  N+ +I +P  
Sbjct  539   SFLETTVSPYASVVWKSLCDARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFQIFSPRP  598

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              + A   V+ L++     W+  +++++F   +  LI SIP+      D ++W  D+KG+F
Sbjct  599   EHSAITKVSDLIHGDSREWNAPLLQNVFFPEEVMLIRSIPLSLRLTPDMLVWHYDKKGMF  658

Query  981   TVKSCY-----------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             TVKS Y           +A S + D+V   +WS +W   +P R KTF W+V SG LPT  
Sbjct  659   TVKSAYHVARSLHSSTGRASSSNSDAVA-RNWSLLWKAIVPARVKTFWWRVISGILPTKA  717

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              L  +++     C LC    +S  HIL +C             P  + A S  +W+ +C 
Sbjct  718   NLARKKVSLDEECMLCEGPVKSLIHILRDC-------------PWNNGAHSPKDWVCRCA  764

Query  654   ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRR  475
             E L     + F+++ W IW ARN  +W N     + V  ++     D+   +     Q R
Sbjct  765   EQLSSQDFATFLMVGWAIWEARNGLLWNNKKSRHEQVSLHASLRLHDFLRVSNCLGSQSR  824

Query  474   SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPK  295
              Q Q    W  P +   K+NVD A    + + G+G V+R+  G F +        V S  
Sbjct  825   -QGQIKQMWQPPHENSLKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKLTNVFSAP  883

Query  294   EAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADIKDLLS  127
             + EALA R        +    +  ESD+L +V  L + +   S    ++ D K LL+
Sbjct  884   QVEALAARTNTILAMERGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTKSLLT  940



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score =   300 bits (768),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 271/514 (53%), Gaps = 15/514 (3%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
              ++I SW H+F S  G+EVL+K+ +QA+P++AM++F +P G+  DI+R +  FWWG+   
Sbjct  543   LNKISSWQHKFFSCGGKEVLIKAAVQAIPAFAMSVFKIPLGICEDIQRIVGNFWWGSSRE  602

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
             + + + W  W+K+   K  GGMGFR    FN ALL+KQ WR+   P+SL A++++A+Y+ 
Sbjct  603   R-RSIHWSKWEKMSQAKCKGGMGFRDFASFNQALLAKQGWRIQQCPDSLVARVLQARYFH  661

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
             +S F +AK G NPS++W S+L  + II G  RWRIGNG  V I   NW+P    P    P
Sbjct  662   SSNFLNAKIGSNPSYIWRSILWGRQIICGGSRWRIGNGQDVHIHKANWIP---KPFTFKP  718

Query  1167  PFPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                    +        +G   WD+E++   F+  DA +I  IP+P+  RED++IW   + 
Sbjct  719   VIKPTMPSEALVSELINGENCWDEELIYKHFDKMDADVITQIPLPRRLREDELIWHFGKS  778

Query  990   GVFTVKSCY-KAISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             G +TVKS Y +A+ +   ++P +S      W+ IW++ LP + + F+W+     LP+A+ 
Sbjct  779   GQYTVKSGYQRALKIRFPAMPSSSESSKNEWNIIWSLALPKKIRIFVWRAAKNLLPSAEN  838

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITKC  658
             L  R+I   P C LC    E+ FH L +C  A + WR  LF      +  Q     +   
Sbjct  839   LWKRKIVQEPTCQLCKMGIENVFHALVDCKAAKKVWRLSLFYIDIQAAPGQDILSLLHGV  898

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
                       LF ++ W  W ARN+ ++K      ++VV  ++A+   +K      D   
Sbjct  899   KRMRSNADVDLFAVMLWAKWNARNQWLFKGKRENPQSVVAKAEAVMEAYKRVQPSADVSH  958

Query  477   RSQHQYIT-KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
               Q +     W  P +G+ K+N DAA +      GLG V+R+ +G   + A        S
Sbjct  959   GKQQKVAQLGWNPPQEGFVKINTDAATNSEKNLAGLGAVIRDENGQVTATAIKVSKFHGS  1018

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
                AEA A+   L   K  H+  + +ESDS  VV
Sbjct  1019  VAYAEAEAMEWGLQVAKDAHVKDVIMESDSQEVV  1052



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score =   295 bits (756),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 173/531 (33%), Positives = 264/531 (50%), Gaps = 53/531 (10%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                R+  W  + LS AG+E+LLK+V+QA+P Y+M+ FLLP+G   D+ + M GFWW N +
Sbjct  353   IMKRLHGWKGKLLSGAGKEILLKAVVQAIPLYSMSYFLLPRGFYDDLNKLMAGFWWNNSN  412

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                K + W +W+KLC PK  GGMGFR +  FNLA+L+KQ WR+   P S+A+K+++AKY+
Sbjct  413   GDRK-IHWISWEKLCKPKDEGGMGFRHLYAFNLAMLAKQGWRILTMPTSMASKLLQAKYF  471

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             P S F +A    + S VW SL   + +++G  RW++ +G ++ IWHD W+P     +I +
Sbjct  472   PTSSFLNASVSSHDSAVWKSLCAARKVLEGGTRWQVSDGNNIDIWHDRWIPQPRQFKIYS  531

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
             P  P                                +LI SIP+      D++IW  D K
Sbjct  532   PAPP-------------------------------VELIHSIPLSIQHPLDQLIWHYDRK  560

Query  990   GVFTVKSCYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRID  811
             G F+V+S Y +I           W T+W  ++  + K F W VC   LPT D L  +++ 
Sbjct  561   GQFSVRSAYHSI----------LWRTLWKANILAKVKVFWWCVCLNILPTHDNLAQKKVP  610

Query  810   CSPLCPLCLNVEESAFHILAEC---SFATQCWRLFEPLPATSQAQSCSEWITKCFESLQP  640
              +  C  C  + E+  H+L +C   S +  C R  E +P      S  +W++ CF SL P
Sbjct  611   INDGCVHCGLMPETTLHVLRDCNWLSSSLGCLRDLEGMP------SVKDWVSHCFRSLTP  664

Query  639   PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQY  460
                  F ++ W++W  RN   W N       V   +     ++            +Q Q 
Sbjct  665   TDLGFFFMMGWSLWEQRNGLPWNNKSSCPSLVGHIAHNRLLEYLQVNRPGGTPCSNQDQ-  723

Query  459   ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEAL  280
             + +W +P     K+NVD A +  ++  G+G V+R+  G F +     +  V S  + EAL
Sbjct  724   VQRWTKPPMRHLKINVDGAWNAITKSGGVGVVIRDSAGAFIAGRARKFDNVFSALQIEAL  783

Query  279   AIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF-DLLLADIKDLL  130
             A RE +     + +  I  ESDSL +V  L   +   SF   +L D K LL
Sbjct  784   AAREGVVLAVERGLTNICFESDSLQIVTALGCSSLDRSFIGPILEDSKFLL  834



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score =   284 bits (727),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/471 (34%), Positives = 249/471 (53%), Gaps = 6/471 (1%)
 Frame = -2

Query  1500  WDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKK  1321
             W+KLC PK +GG+GF+++  +N+ +L KQ WRL ++P+SL A I+KA+Y+P S F     
Sbjct  3     WEKLCKPKVYGGIGFKQLHYYNIVMLGKQGWRLLSNPDSLVAHILKARYHPLSSFGKTTV  62

Query  1320  GGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanas  1141
             G NP++ W S++    +I    R +IGNG    I    WLPD+++  +TTP    + +A 
Sbjct  63    GSNPNYAWWSIMAAHTVIIQGSRIQIGNGHQTTIGGSLWLPDLDHGYVTTPLPDVIVDAP  122

Query  1140  vnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYK  961
             VN+L+      WD +++ DIFN RD  LI  IP+     +D   W  + +G+FTV+SCYK
Sbjct  123   VNNLMTPGQRNWDLDMLVDIFNDRDQALITQIPLSSRRDDDAWYWSANSRGLFTVRSCYK  182

Query  960   AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLN  781
              ++   +      W  +W + +P + K FIW      LPTAD LR  +++   +CP+C  
Sbjct  183   ILAYLSEPPSSNVWQKVWKLKVPAKVKHFIWCAVVNVLPTADNLRRCQVEVPSVCPICNA  242

Query  780   VEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQPPRASLFVIICWNI  601
              +E   H L  CSFA  CW L  P+      ++  +W+   F         L  + CW++
Sbjct  243   YDEIVAHCLVNCSFAKSCW-LLSPIGYVGGCENFMDWLEGIFSRYSSDDCDLAAMTCWSL  301

Query  600   WRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV---DDQQRRSQHQYITKWIRPMQG  430
             W  +N KVWKN      +V+  +  +   WK+  ++   D+    S H  +  W RP   
Sbjct  302   WENKNAKVWKNRKGRLSSVLNLAGQVLFQWKSVRKLQVFDNNSVSSSHGAVC-WQRPCVW  360

Query  429   WFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCK  250
             WFK NVDA   ++S  +  G V++N  G F +A  N  I     +EAEA+ +RE LSW K
Sbjct  361   WFKCNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVREILSWLK  420

Query  249   RQHIDYIHVESDSLVVVHGLSSPAFV-TSFDLLLADIKDLLSTFCSLLYLF  100
                  ++ +E DSL V   L+  +F    F LL+ D + L  +   + + F
Sbjct  421   GLPFLHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSF  471



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score =   289 bits (740),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 182/555 (33%), Positives = 282/555 (51%), Gaps = 22/555 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S+I SW+H+  S  G+E+L+K+V QA+P+YAM++F LP+GL  DI++ +  FWWG    +
Sbjct  181   SKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWWGTKKDK  240

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W  WD +   K+ GG+GFR +  FN AL++KQ WRL  +P SL A++MKA+YY N
Sbjct  241   -HGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKARYYKN  299

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F++AK G NPSF+W S+L    +I+   RWRIG+G  V ++ D W+P    P    P 
Sbjct  300   STFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIP---RPATFQPI  356

Query  1164  FPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P                  W  + +   F   D + IL I +P G  ED+++W  D+KG
Sbjct  357   SPKTLPHETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLPSGKEEDEVLWHFDKKG  416

Query  987   VFTVKSCYK-AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
              ++VKS Y+ A++ +  + P +S      W   W + LP + K F+W+     LPTA+ L
Sbjct  417   EYSVKSGYQLALNQNFPNEPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPTAENL  476

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPL---PATSQAQSCSEWITKC  658
               RR    P+C  C    E+  H+L EC  A + W L  PL   P+    Q     I + 
Sbjct  477   WKRRSLQEPICQRCKLQVETVSHVLIECKAARKIWDL-APLIVQPSKDHNQDFFSAIQEM  535

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE---VDD  487
             +       A L ++ CW IW ARN+ +++     ++ +   + ++ + ++  ++   V  
Sbjct  536   WSRSSTAEAELMIVYCWVIWSARNKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHG  595

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGV  307
              + R   Q   KW  P Q   KLNVDAA+    +K+GLG ++R+  G   +         
Sbjct  596   AKDRGIDQ--QKWKPPSQNVLKLNVDAAVSTKXQKVGLGAIVRDAEGKILAVGIKQAQFR  653

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIKDLL  130
                  AEA AI   L    +     + VESD   VV  L ++    T    +L+D++   
Sbjct  654   ERVSLAEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRES  713

Query  129   STFCSLLYLFC*TFC  85
               F  + + F    C
Sbjct  714   KDFKQVQFSFIPRTC  728



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score =   289 bits (739),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 182/555 (33%), Positives = 282/555 (51%), Gaps = 22/555 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S+I SW+H+  S  G+E+L+K+V QA+P+YAM++F LP+GL  DI++ +  FWWG    +
Sbjct  868   SKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWWGTKKDK  927

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W  WD +   K+ GG+GFR +  FN AL++KQ WRL  +P SL A++MKA+YY N
Sbjct  928   -HGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKARYYKN  986

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F++AK G NPSF+W S+L    +I+   RWRIG+G  V ++ D W+P    P    P 
Sbjct  987   STFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIP---RPATFQPI  1043

Query  1164  FPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P                  W  + +   F   D + IL I +P G  ED+++W  D+KG
Sbjct  1044  SPKTLPHETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLPSGKEEDEVLWHFDKKG  1103

Query  987   VFTVKSCYK-AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
              ++VKS Y+ A++ +  + P +S      W   W + LP + K F+W+     LPTA+ L
Sbjct  1104  EYSVKSGYQLALNQNFPNEPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPTAENL  1163

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPL---PATSQAQSCSEWITKC  658
               RR    P+C  C    E+  H+L EC  A + W L  PL   P+    Q     I + 
Sbjct  1164  WKRRSLQEPICQRCKLQVETVSHVLIECKAARKIWDL-APLIVQPSKDHNQDFFSAIQEM  1222

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE---VDD  487
             +       A L ++ CW IW ARN+ +++     ++ +   + ++ + ++  ++   V  
Sbjct  1223  WSRSSTAEAELMIVYCWVIWSARNKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHG  1282

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGV  307
              + R   Q   KW  P Q   KLNVDAA+    +K+GLG ++R+  G   +         
Sbjct  1283  AKDRGIDQ--QKWKPPSQNVLKLNVDAAVSTKDQKVGLGAIVRDAEGKILAVGIKQAQFR  1340

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIKDLL  130
                  AEA AI   L    +     + VESD   VV  L ++    T    +L+D++   
Sbjct  1341  ERVSLAEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRES  1400

Query  129   STFCSLLYLFC*TFC  85
               F  + + F    C
Sbjct  1401  KEFKQVQFSFIPRTC  1415



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   286 bits (731),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 176/548 (32%), Positives = 281/548 (51%), Gaps = 21/548 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSR G+EVL+K+V+QA+P+Y M++F LP GL+ +I   +  FWWG+ + + 
Sbjct  741   KLQGWKEKLLSRPGKEVLIKAVVQAIPTYMMSVFCLPSGLIDEIHSLIARFWWGSKEGER  800

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W  W+ LC+PK  GG+GFR +  FN ALL+KQAWRL N+  SL + ++KA+YY   
Sbjct  801   K-MHWHKWEALCMPKSMGGLGFRDLHCFNQALLAKQAWRLCNNSYSLLSLLLKARYYKKV  859

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F DA++G NPSF W S+  +K ++    +W +G+G S+R+W D WL         TP  
Sbjct  860   EFIDARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWDDAWLMGEGAHLTPTPRL  919

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V++LL+  G GW+ E+VR  F   +  +IL IP+ +   +D + W   + G F
Sbjct  920   DSDMELRVSALLDYEGGGWNVELVRQTFVEEEWDMILKIPLSRFWPDDHLYWWPTQNGYF  979

Query  981   TVKSCY--------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +VKSCY        +A  L         W  +W++  PP+   F+W+ C G L   + L 
Sbjct  980   SVKSCYWLARLGHIRAWQLYHGERDQEIWRRVWSIPGPPKMVHFVWRACKGSLGVQERLF  1039

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR------LFEPLPATSQAQSCSEWIT  664
             HR I  SP+C +C   +E+  H L +C  A   W+      L   +P +S   S    + 
Sbjct  1040  HRHISESPMCSICGEQQETICHALFDCPQAKAIWQVSAYATLIADVPRSSFDVSFEWLVI  1099

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
             KC         S+   + W  W  RN+ ++++  L    V  N   +  ++        +
Sbjct  1100  KC----SKDDLSVVCTLMWAAWFCRNKFIFESQALCGMEVASNFVKMVLEYGEYAGRVFR  1155

Query  483   QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
                      T W  P +GW K+N DA ++ N  ++GLG V+R+  G+   AA        
Sbjct  1156  HVAGGAPSPTNWSFPAEGWLKVNFDAHVNGNG-EIGLGAVMRDSAGVVKFAATKRVEARW  1214

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIKDLLS  127
                 AEA+A + A+    R   D +  E D+L VV  + ++   V     +  DI+ L+S
Sbjct  1215  DATLAEAMAAKFAVEVTLRLGYDNVLFEGDALEVVQAVKNNSEGVAPLFRVFYDIRRLVS  1274

Query  126   TFCSLLYL  103
             +F +  +L
Sbjct  1275  SFVAFSFL  1282



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 152/413 (37%), Positives = 220/413 (53%), Gaps = 6/413 (1%)
 Frame = -2

Query  1428  LLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRW  1249
             +L +Q W+L   P+SL A+I+KA+YYP +    A  G NPS+VW S+L  K ++    R 
Sbjct  1     MLGRQMWKLLTCPDSLMARILKARYYPRTSVVRASLGHNPSYVWRSILAAKEVVVQGSRV  60

Query  1248  RIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSR  1069
             ++G+G S+ I  D WLPD+ +  ++T     +A A V+SL+  H   WD  VV DIFNSR
Sbjct  61    QVGSGHSISIGKDPWLPDLQDGCVSTNLNEEIAAAPVSSLMMPHQRAWDYNVVSDIFNSR  120

Query  1068  DAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLDSVPIASWSTIWNVHLPP  889
             D +LIL IP+     +D   W+ D +G ++V+SCYK ++          W  +WN  +P 
Sbjct  121   DKELILKIPLSSRREDDVWYWMADSRGCYSVRSCYKVLNPITPGSLADVWRKLWNSKVPN  180

Query  888   RAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEP  709
             + K FIW+     LPTA  L  +R+D   +C +C   EE+  H L  CSFA  CW     
Sbjct  181   KVKNFIWRAAHNVLPTALNLISKRVDVPAMCSVCNAYEETVLHSLVACSFAKSCW-TSSS  239

Query  708   LPATSQAQSCSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSK  529
             +       +  +W+   F        +  ++ICW IW  RN KVW N       ++ ++ 
Sbjct  240   VGFVGYCSNFLDWLAHVFTRCSKDECNTAMMICWRIWVNRNNKVWNNTTSSVCQILNSAG  299

Query  528   ALWRDWKACTE----VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
                  W+A  +    V+D   R  H  +  W +P  GW K NVDAA+  +  K+G+G V+
Sbjct  300   QFLYQWQAAKQQVFDVNDDTHRLVHGALC-WEQPKFGWVKCNVDAAVFESQGKIGIGCVI  358

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVV  202
             RN  G F +A C S  G+   +EAEAL IREALSW K   I  + +E D L V
Sbjct  359   RNSQGGFVAARCVSVAGIFGAREAEALGIREALSWMKELQIPCVIIEMDCLQV  411



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score =   283 bits (724),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 183/543 (34%), Positives = 277/543 (51%), Gaps = 23/543 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+E+LLKSVIQA+P+Y M ++ LP  ++  I   M  FWWG+ DT  
Sbjct  683   KLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWWGSSDTHR  742

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK+WD LC  K +GGMGFR ++ FN ALL +QAWRL   P SL A++MKAKYY N 
Sbjct  743   K-IHWKSWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVMKAKYYSNF  801

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G + S+ W+S+  +K +++    WRIGNG +VRIW D WL D     IT+   
Sbjct  802   DFLDAPLGVSTSYTWSSIWSSKALLKEGMVWRIGNGTNVRIWEDPWLLDELGRFITSE--  859

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +     V+ L++     W   ++  +FN RD + ILSIP+   P +D++ W       +
Sbjct  860   KHGDLTMVSELIDFDRMEWKVSLIEALFNDRDIKCILSIPLSSIPMKDELTWAFTNDAHY  919

Query  981   TVKSCY---KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRID  811
             +VK+ Y   K  +LDL      +W  IW + + P+ K F+W++C+  LP   LL+HR + 
Sbjct  920   SVKTAYMLGKGGNLDLFH---KAWVDIWKMEVSPKVKHFLWRLCTNTLPVRSLLKHRHML  976

Query  810   CSPLCPLCLNVEESAFHILAECSFATQCW------RLFEPLPATSQAQSCSEWITKCFES  649
              +  CP      E+  H +  C F    W      R    + ATS  +  +       + 
Sbjct  977   DADECPRGCGEPETQSHAIFGCPFLRDLWVDSGCERFRTLISATSLFEGLAN-----SQG  1031

Query  648   LQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQ  469
             +     +    + W +W  RN  V+  +  P   ++     L  +  + T      R S 
Sbjct  1032  MDEGVRTKGAFLAWVLWSERNALVFNAVTTPPPILLARVARLVEEHGSYTARIYSPRNSL  1091

Query  468   HQYITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKE  292
                  + W  P     KLNVDA+L   +  +GL  V R+  G    AA        + + 
Sbjct  1092  APSSPRVWAAPPTEVIKLNVDASL-ATAGWVGLSVVARDSQGTVLFAAVRRIRSHWTAEI  1150

Query  291   AEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCS  115
             AEA AI  AL   +R  +  I VESD  VVV+ LS  A ++   D++L ++     +F S
Sbjct  1151  AEAKAIEMALRLGRRYGLQAIMVESDCQVVVNRLSKQALYLADLDIILHNVLSACVSFSS  1210

Query  114   LLY  106
             +++
Sbjct  1211  VVW  1213



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   285 bits (730),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 176/537 (33%), Positives = 269/537 (50%), Gaps = 39/537 (7%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +I+ W H  LS+AGREVL+KSV QA+PSY M++FL P G   +I+  +  FWWG   
Sbjct  796   ILGKIQGWKHGLLSQAGREVLIKSVAQAVPSYPMSVFLFPNGFCQEIDSILANFWWGQSQ  855

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                K + W +W  L +PK  GGMGFR +KDFN+ALL+KQ WR+   P++  A+++K+KY+
Sbjct  856   QSNK-IHWISWKDLGMPKNEGGMGFRNLKDFNVALLAKQGWRMVTEPQAFWAQLLKSKYF  914

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN  F  A KG   S+ W+SLL  + II    RW++ +G  V +W D W+P      +  
Sbjct  915   PNCDFLRAGKGAKSSWAWSSLLVGRNIIMNGARWQVLDGSRVHLWTDKWIPGCTEHALQP  974

Query  1170  PPFPYlanasvnsllnN-HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  +   +    + + H   W+ E +  +F+   A++I ++P+  G  +D++IW  ++
Sbjct  975   SHLSQVDLEAKVETIIDCHSREWNLEAIGGMFSPNAAKIIKAMPLGDGWEKDRLIWPLNQ  1034

Query  993   KGVFTVKSCYKAI---SLDLDSVPIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
              G +TVKS Y  I    LD    P +S       W  IW   + P+   F W++  GCLP
Sbjct  1035  TGSYTVKSGYNMIHMAHLDTSVRPSSSRILDKALWKLIWGSQMVPKLMNFWWRLVRGCLP  1094

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC---SE  673
             T D L  R +  SPLCP+C    ES  H+   C++    W    PL      QS    S+
Sbjct  1095  TRDALFRRHLGTSPLCPICGEFPESVEHLFLLCNWVRPVW-FGGPLNYRINRQSITSMSD  1153

Query  672   W---ITKCFESLQPPRASLFVII---CWNIWRARNEKVWKNICLPAKAVVENSKALWRDW  511
             W   I K  + L   R  L   I   CW+IW++R   ++ +I +  +  +  +K L  D+
Sbjct  1154  WLMQILKFSQGLGYDRKWLISQIFYSCWSIWKSRCSAIFDDISVCPRNTLLVAKKLMNDF  1213

Query  510   KAC----------TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
                           ++DD  R      + +W  P    +K+N+DA+    + + GLG V+
Sbjct  1214  NLVGCPHGDAILEEDIDDGHR------VVRWSPPPTSVYKINIDASWVSCTLQAGLGVVV  1267

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             RN  GIF    C   +   S  EAEA A  + +     +    +  ESDS  +V  +
Sbjct  1268  RNSAGIFMGGCCGPRLAS-SAIEAEAHAALKGVKLAVERGFPNVVFESDSKELVQSV  1323



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   282 bits (722),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 180/556 (32%), Positives = 288/556 (52%), Gaps = 26/556 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  R LSRAG E +LK+V QA+P+Y M+ F +P  +   ++  +   WWG  D + 
Sbjct  747   RVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKK  806

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK+W  L  PK  GGMGFR    FN A+L +Q WRL   P+SL ++++K +Y+PNS
Sbjct  807   K-MHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNS  865

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F++A +  +PSF W SLL  + ++    RW +G+G +++I+ DNW+P    P++ T   
Sbjct  866   SFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGF-RPQLVTTLS  924

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P+  +A+V+ L+N     WD +++R +F    A+ IL IPI +    D   W  D+ G++
Sbjct  925   PFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPISRHGDADFASWPHDKLGLY  984

Query  981   TVKSCY-----KAISLDLDSV--PIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             +V+S Y     +A   D  +    +AS        W  +W ++ P + K  +W+    CL
Sbjct  985   SVRSAYNLARSEAFFADQSNSGRGMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECL  1044

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQ----SC  679
              T   LR R I  +  C  C N +++  H+   C FA Q W   +   A    +    + 
Sbjct  1045  ATGFQLRRRHIPSTDGCVFC-NRDDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTM  1103

Query  678   SEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICL-PAKAVVENSKALWRDWKAC  502
              +WI    +       +L  +  W+IW ARN     N  + P + V++    +    K  
Sbjct  1104  RQWIFDFLKRGSSHANTLLAVTFWHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHN  1163

Query  501   TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
             T+  D QR    Q I +W  P    + +N DAA+  +SR MG+G ++R++ G    A   
Sbjct  1164  TKTVDGQRGGNTQAIPRWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSE  1223

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLAD  145
                 V+ P+ AEALAIR AL   K + +++I + SD L V+  + +     S    ++ D
Sbjct  1224  MISDVVLPELAEALAIRRALGLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIED  1283

Query  144   IKDLLSTF--CSLLYL  103
             IK L STF  CS +++
Sbjct  1284  IKKLASTFVLCSFMHV  1299



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   283 bits (723),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 180/556 (32%), Positives = 288/556 (52%), Gaps = 26/556 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  R LSRAG E +LK+V QA+P+Y M+ F +P  +   ++  +   WWG  D + 
Sbjct  790   RVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKK  849

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK+W  L  PK  GGMGFR    FN A+L +Q WRL   P+SL ++++K +Y+PNS
Sbjct  850   K-MHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNS  908

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F++A +  +PSF W SLL  + ++    RW +G+G +++I+ DNW+P    P++ T   
Sbjct  909   SFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGF-RPQLVTTLS  967

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P+  +A+V+ L+N     WD +++R +F    A+ IL IPI +    D   W  D+ G++
Sbjct  968   PFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPISRHGDADFASWPHDKLGLY  1027

Query  981   TVKSCY-----KAISLDLDSV--PIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             +V+S Y     +A   D  +    +AS        W  +W ++ P + K  +W+    CL
Sbjct  1028  SVRSAYNLARSEAFFADQSNSGRGMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECL  1087

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQ----SC  679
              T   LR R I  +  C  C N +++  H+   C FA Q W   +   A    +    + 
Sbjct  1088  ATGFQLRRRHIPSTDGCVFC-NRDDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTM  1146

Query  678   SEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICL-PAKAVVENSKALWRDWKAC  502
              +WI    +       +L  +  W+IW ARN     N  + P + V++    +    K  
Sbjct  1147  RQWIFDFLKRGSSHANTLLAVTFWHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHN  1206

Query  501   TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
             T+  D QR    Q I +W  P    + +N DAA+  +SR MG+G ++R++ G    A   
Sbjct  1207  TKTVDGQRGGNTQAIPRWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSE  1266

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLAD  145
                 V+ P+ AEALAIR AL   K + +++I + SD L V+  + +     S    ++ D
Sbjct  1267  MISDVVLPELAEALAIRRALGLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIED  1326

Query  144   IKDLLSTF--CSLLYL  103
             IK L STF  CS +++
Sbjct  1327  IKKLASTFVLCSFMHV  1342



>gb|ADK92871.1| retrotransposon protein [Hypericum perforatum]
Length=593

 Score =   271 bits (693),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 174/547 (32%), Positives = 260/547 (48%), Gaps = 32/547 (6%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
             + +  SW  R LSRAGRE+++KSV+Q++ +Y M  F LP+G    IE+ M  F+WG GD 
Sbjct  13    YYKFGSWKVRTLSRAGREIMIKSVLQSISTYIMGCFELPEGTCDRIEKMMCNFYWG-GDR  71

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
              G  + W++W+KLC  K+ GG+GFRR+K+FN A+L+KQ WRL   P SLAA I++AKYYP
Sbjct  72    NGSKMHWRSWEKLCRSKRNGGLGFRRLKNFNRAMLAKQGWRLLTLPNSLAATILRAKYYP  131

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLP--DVNNPRIT  1174
                  +       S+ W S+L+   ++Q    WRIG G +VR W D W+P  D   P+  
Sbjct  132   RKSPLEISSSPYSSYTWRSILKGSQLLQKGIEWRIGQGNTVRTWSDPWIPGSDTGLPKYH  191

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
             +P     ++   +        GW++ ++R  F   D   IL I +      D + W   +
Sbjct  192   SP----GSDLYTHVSDFIQNGGWNENLLRLCFEEEDVTRILQIRLSLRRPLDMVRWKFIK  247

Query  993   KGVFTVKSCY---------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              G +TV+S Y         +  +  L       W T W +  PPR KT +W++    L  
Sbjct  248   DGEYTVRSGYYIDFNCWWHENYATPLTHAGEERWKTCWGLRCPPRIKTLLWRLIDNNLSV  307

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITK  661
                L  R I    +CP C    E+A H+   C +    W+          +++    I  
Sbjct  308   RTNLTRRGIQVDEVCPCCAGPSETAAHLFFCCPYTLDIWKEVNVQIQVESSENILLAIDS  367

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKN-----ICLPAKAVVENSKALWRDWKACTE  496
                   P   S      W IWR RN  V++      IC      +E     W+D+   TE
Sbjct  368   LLNIRDPVEQSRRAATLWIIWRVRNSIVFRTGEEIVIC----KELEKGFRFWQDFMD-TE  422

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
              +   R +     +KW  P  G++K+NVDA L    R   +G V+R+  G F  A   S+
Sbjct  423   GNPTVRGAPR--TSKWNAPTAGFYKINVDAGLRA-ERGGQVGIVVRDDTGAFVMATTRSF  479

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL--LLADI  142
               ++ P   E  A+   L +     ++ + +ESD L VV  LS   +    DL  ++ D 
Sbjct  480   PNLVHPTLLEGQAVYTGLEFANALGLERVELESDCLPVVMQLSK-GYTDRSDLSNIIDDC  538

Query  141   KDLLSTF  121
             K LLS F
Sbjct  539   KMLLSNF  545



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score =   283 bits (723),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/541 (31%), Positives = 281/541 (52%), Gaps = 26/541 (5%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
              S+I +W H+  S  G+E+L+K+V QA+P+YAM++F LP+GL  +I+  +  FWWG+   
Sbjct  750   LSKINNWQHKMFSSGGKEILIKAVAQAVPAYAMSVFKLPKGLCEEIQSEIAKFWWGSKKD  809

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
             + +G+ W  WDKL   K  GG+GFR    FN A+++KQ WRL   P SL +K+++A+Y+ 
Sbjct  810   K-RGIHWARWDKLSCAKSRGGLGFRDFISFNQAMVAKQGWRLIQFPNSLVSKVLRARYFK  868

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWL--PDVNNPRIT  1174
             +  F DAK G NPSF+W S+L  + +IQ   RWRIGNG ++ ++ DNW+  PD   P I+
Sbjct  869   SCSFLDAKPGSNPSFIWRSILWGRQVIQKGARWRIGNGSNILVYKDNWIPRPDTFKP-IS  927

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
              P  P               + W+   +   F   D + IL IP+P+  + D+M+W  D+
Sbjct  928   PPTLPIDTTVGELMDDE---NNWNVAKLNQHFMQEDTEAILKIPLPRSQKVDEMMWHYDK  984

Query  993   KGVFTVKSCYK-AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              G ++VKS Y+ A+ L     P  S      W  +W++ LP + K F+W+     LPTA+
Sbjct  985   HGEYSVKSGYQIALKLKAPDEPSNSGSNSKRWKAVWSMELPEKMKIFMWRAARNLLPTAE  1044

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS--EWITK  661
              L  R+    P+C  C    E+  H L +C  A + W         S AQ+    E+I +
Sbjct  1045  NLWKRKCLKDPICQGCNREVETVRHALLDCKAARKIWYHATSSVQISNAQNQDILEFIYE  1104

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ  481
              + +    +A   +  CW IW ARN+++++      +A    +++L   +    + D   
Sbjct  1105  VWSTWGKTKAEQTIAFCWAIWFARNKRIFEGKKSDPRASAAKAESLLEAYHRARKPDASH  1164

Query  480   RRSQHQYIT-KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
               +  + +  KW  P   + K+NVDAA++   +  GLG V+++  G   +A        +
Sbjct  1165  IHNVKRIVQKKWEPPPGNFLKVNVDAAINNRDQVAGLGAVIKDPSGKIVAAGTKQ----V  1220

Query  303   SPKEAEALAIREALSW----CKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIK  139
               +E  + A  EA+ W     +   +  + +E+D   VV  L ++    T    +++DI+
Sbjct  1221  PLREGVSFAEAEAMEWGLQIARELSLSALIMETDCKEVVDLLNNTKGSRTGISWVISDIQ  1280

Query  138   D  136
             +
Sbjct  1281  E  1281



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   280 bits (715),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 185/537 (34%), Positives = 273/537 (51%), Gaps = 11/537 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+E+LLKSVIQA+P+Y M ++ LP  ++  I   M  FWWG+ DTQ 
Sbjct  779   KLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWWGSSDTQR  838

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + WK WD LC  K +GGMGFR ++ FN ALL +QAWRL   P SL A++MKAKYY N 
Sbjct  839   R-IHWKNWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVMKAKYYSNH  897

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G + S+ W S+  +K +++    WRIGNG +VRIW D W+ D     IT+   
Sbjct  898   DFLDAPLGVSTSYSWRSIWSSKALLKEGMVWRIGNGTNVRIWEDPWVLDELGRFITSE--  955

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +     V+ L++     W   ++  +FN RD + ILSIP+   P +D++ W   +   +
Sbjct  956   KHGNLNMVSELIDFDRMEWKVSLIETVFNERDIKCILSIPLSSLPLKDELTWAFTKNAHY  1015

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LDS   A W  IW++ + P+ K F+W++ +  LP   LL+HR +   
Sbjct  1016  SVKTAYMLGKGGNLDSFHQA-WIDIWSMEVSPKVKHFLWRLGTNTLPVRSLLKHRHMLDD  1074

Query  804   PLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWITKCFESLQPPRA  631
              LCP      ES FH +  C F    W     +   A +   + +E +      L     
Sbjct  1075  DLCPRGCGEPESQFHAIFGCPFIRDLWVDSGCDNFRALTTDTAMTEALVNS-HGLDASVR  1133

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITK  451
             +    + W +W  RN  V+     P   ++     L  +    T      R        +
Sbjct  1134  TKGAFMAWVLWSERNSIVFNQSSTPPHILLARVSRLVEEHGTYTARIYPNRNCCAIPSAR  1193

Query  450   -WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAI  274
              W  P     KLNVDA+L  ++  +GL  + R+ HG    AA        S + AEA AI
Sbjct  1194  VWAAPPPEVIKLNVDASL-ASAGWVGLSVIARDSHGTVLFAAVRKVRAQWSAEIAEAKAI  1252

Query  273   REALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSLLY  106
               AL   +R     I VESD  VVV+ LS  A ++   D++L +I      F S+L+
Sbjct  1253  EMALRLGRRYGFAAIIVESDCQVVVNRLSKQALYLADLDIILHNIFSSCINFPSVLW  1309



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score =   277 bits (708),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 173/525 (33%), Positives = 263/525 (50%), Gaps = 27/525 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++  W  + LS+AG+EVL+KSV QA+PSY+M++F LP GL  +IE  +  FWW   D  
Sbjct  374   NKVNGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKND--  431

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             G+G+ WK W  +C  K  GG+GFR +  FN ALL KQ WRL   P SL A+++KA+Y+PN
Sbjct  432   GRGIHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKARYFPN  491

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F  A  G  PSF W SLL  + +++   RWRIG+G  V I+ D W+P   +   T   
Sbjct  492   SDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVP--YDRFFTIQS  549

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P L   S    L     GWD   V   F+  +A+ ILSIP+  G   D+ IW   + G 
Sbjct  550   IPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPL-MGDNLDRRIWNFTKNGR  608

Query  984   FTVKSCY---------KAISLDLDSVP----IASWSTIWNVHLPPRAKTFIWQVCSGCLP  844
             ++VKS Y         + +S    + P    + SW  +W + +P +    +W+V    LP
Sbjct  609   YSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHLWKLKVPQKILHLLWRVAQDILP  668

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-----PLPATSQAQSC  679
             + ++L  RRI    +C  C    E+  H L  C    Q W   +      LP  +   + 
Sbjct  669   SKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQVWEALDFPRDFLLPTVADVGT-  727

Query  678   SEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
               W+   +  + P + SLF    W +W  RN  ++ +   P+  +V+ +K    ++K  +
Sbjct  728   --WMDAAWSIIPPDKQSLFAFTVWVLWNERNGVLFGSQPTPSGVLVQRAKDYDAEFKRYS  785

Query  498   EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
               + +   S  + I KW  P    FKLNVD A D+ +   G G ++R+ HG    A    
Sbjct  786   AANHRSLSSLVRDI-KWRPPTGNCFKLNVDGATDMETGARGAGAIVRDSHGNLVGALAMR  844

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
                 +S    E  A++  +S+     +  + +ESDSL  V  ++S
Sbjct  845   APSRISVLATELYALKVGISFALDVSLLPLEIESDSLQAVSMVNS  889



>ref|XP_004292002.1| PREDICTED: uncharacterized protein LOC101312896 [Fragaria vesca 
subsp. vesca]
Length=2277

 Score =   282 bits (721),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 179/537 (33%), Positives = 272/537 (51%), Gaps = 20/537 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W  + LS AGRE+L+K V QA+P Y M+ +LLPQG++ ++ +    FWWG  D + 
Sbjct  854   KLTGWRTKLLSVAGREILIKVVAQAVPLYTMSNYLLPQGMIQELHQLCAKFWWGGTDEK-  912

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W+AWD LC PK  GGMGF  +  FNLA+L+KQ  RL  +P SL  +++KA Y+P+ 
Sbjct  913   RGMHWRAWDALCKPKAKGGMGFHHLFAFNLAMLAKQGRRLLQYPSSLPNQLLKAIYFPHC  972

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F+ A+ G  PS+ W S+LE +  ++   +  IG+G+S  +W D WL   N       PF
Sbjct  973   NFWKAELGKAPSYAWRSILEGRDTLRNGIQRLIGDGMSTNVWDDPWLMGEN-----LLPF  1027

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V+ L  + G G D  ++  +F +     I ++PI      DK IW  D KG+F
Sbjct  1028  FSDTVTRVSDLFVSPGVG-DVVLLSHLFPAHIVHKIQALPISSRSNSDKWIWAPDRKGLF  1086

Query  981   TVKSCYKAISLDL--DSV----PIAS-WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRH  823
              VKS Y      +  D V    P A  W+ IWN  +P + K  +W+V S  LP+   L  
Sbjct  1087  MVKSAYHIARTRVLEDHVMALNPSAQLWNKIWNAPVPGKVKICVWKVASNILPSRSRLSQ  1146

Query  822   RRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQ  643
             R ID    CP C    ES  H L +C  A    +L + +P      +  +W+    E+  
Sbjct  1147  RGIDIDTQCPFCDEEVESPIHALRDCPHAAAFIQLVD-VPIQLADTNALDWLVSSLENSP  1205

Query  642   PPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQ  463
                A+L +II W++WR +N+ VW N    A  VV  +   W ++K+      ++R     
Sbjct  1206  STFATLMMII-WSVWRNQNDHVWNNNAKQATEVVPLTLRWWEEFKSAFV---KRRGRNVS  1261

Query  462   YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEA  283
                +WI P  G+ KLNVDAA +  S    LG V R+H G              S   +E 
Sbjct  1262  PRDRWITPSSGYIKLNVDAAYNNASCMASLGGVFRDHTGSCLGVFMQGLFSAHSAHHSEL  1321

Query  282   LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADIKDLLSTFCS  115
             +A+   +      ++  + +E+D LV+V  L+S +   S    L+ D++  LST  +
Sbjct  1322  MALLVGVQVAIHHNLYPLSIETDCLVLVSALTSGSLDDSDLGFLIEDLRASLSTITA  1378



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   278 bits (711),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 179/543 (33%), Positives = 272/543 (50%), Gaps = 29/543 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLKSVIQA+P+Y M ++  P  + S I   M  F+WG     G
Sbjct  582   KLRGWKEKLLSRAGKEVLLKSVIQAIPTYLMGIYKFPVSVTSTISSAMAQFFWGQSGG-G  640

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + WK W  +C  K  GG+GF+ ++ FN ALL +QAWR+ N   +L  K+MKAKYY + 
Sbjct  641   RRIHWKNWKAMCELKCLGGLGFKDLEIFNDALLGRQAWRIMNGEHTLLGKVMKAKYYRHC  700

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G  PS+ W  +  +K +++    WR+GNG  + IW D W+ D     I +   
Sbjct  701   SFLDAPLGYAPSYSWRGIWSSKALVKEGMLWRVGNGQDINIWRDPWIADETGRFIQSDEA  760

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               ++  S     +     W+ E++  +F  RD + IL+IP+ +  + D + W   + G +
Sbjct  761   EEVSKVSELIHSDT--GEWNLELLARLFTERDQECILAIPLSERSQRDIITWAFTKSGEY  818

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W TIWN+   P+ + F+W++C+G LPT  LL +R +   
Sbjct  819   SVKTAYMVGKGFELDNFHNA-WVTIWNIEASPKVRFFLWRLCTGTLPTKALLHYRHLIEE  877

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF----ESLQPP  637
               CP C  VE    H + ECS   + W   E   ++   QS        F    +SL+  
Sbjct  878   EHCPWCGAVETDR-HAIFECSRVAELW---EGSGSSHLIQSVGTTTMLDFVASRKSLEKK  933

Query  636   RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD-------QQR  478
                   ++ W IW  RNEKV+ N   P      N+  L R  +  TE D         +R
Sbjct  934   EQQKLAMLAWCIWSERNEKVFNNTFTP------NTVLLARLHRLTTEHDKYSQRIYGSRR  987

Query  477   RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSP  298
                      W  P  G  KLN DA+L ++  + GLG V R++ G    AAC         
Sbjct  988   EGSRGSAKIWQSPAVGHVKLNCDASLAVDGWR-GLGVVARDNAGRVLFAACRRVRANWPV  1046

Query  297   KEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTFC  118
             + AE  A+  AL   +R  +  + +ESDS V++  LS    +T F  L + + D+L+  C
Sbjct  1047  EIAEGKALLMALRLAERFGLRQVTLESDSQVLITRLSKA--MTYFSDLDSVLDDILAKSC  1104

Query  117   SLL  109
             + L
Sbjct  1105  NFL  1107



>ref|XP_009113843.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=896

 Score =   275 bits (703),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 170/521 (33%), Positives = 266/521 (51%), Gaps = 23/521 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             ++   W+HRFLS  G+EVL KS+  A P Y MN+F +P+ +  DI  T+  FWWG  D  
Sbjct  303   AKTNGWHHRFLSPGGKEVLTKSIASATPVYPMNVFKMPKKVCDDINNTLAQFWWGKSDG-  361

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W AW ++ +PKK GGMGFR  + FN ALL+KQ WR+   P SL A+++K KY+PN
Sbjct  362   SKGMHWFAWQRMSLPKKEGGMGFRDFEKFNDALLAKQVWRILIKPNSLMARVLKGKYFPN  421

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S    A      S++W SLL  + +++   R+ IGNG SV +W D WLP  + PR   P 
Sbjct  422   SNILKAGTKKQSSYIWNSLLHGQALLKRGLRFIIGNGESVSLWADPWLP-TSPPRSPIPK  480

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                     V+ L+  + +GW++E++R      DA+ ILS+ +      D ++W  ++ G 
Sbjct  481   DQSNPMTKVSELMKQNQTGWNEELIRHTIVEADAEEILSMKLCAYADTDPLVWHYNKSGE  540

Query  984   FTVKSCYKAISLDLDSVPIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             ++VKS Y   + D   +PI          + IW +   P+ + F+W++ +  LP    L+
Sbjct  541   YSVKSGYWLATHDPQDLPIEPPPGSIILKNMIWKLPTAPKLQHFLWKMVTSSLPLGSNLQ  600

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESL  646
              R +  S  CP C   EE+  H+  EC +A + WR    LP     Q+ S    K    L
Sbjct  601   RRHVTTSVKCPHC-QQEETTEHLFFECFYAQRIWRA-SGLPHNIFYQAQSTLEDKLMALL  658

Query  645   QP-PRASLFVI-----ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVD-  490
             Q  P     +      I W IW+ RN+ +++   +  +  ++++    ++W +A   VD 
Sbjct  659   QKIPNLPDHLRHLPWWILWRIWKCRNKMIFQQTSIHWRTTLQSAYFDTKEWLEAYQSVDK  718

Query  489   --DQQ--RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
               D+Q  RR       KW +P  G+ K N D A +   R+   GW++R+  G F  AA  
Sbjct  719   DEDRQGLRRDMEHQRNKWTKPPTGFVKCNYDGAFNNIQRETKAGWIIRDDMGRFKGAAHA  778

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
             S     +  E E  A+  A+  C  +   ++  E D++ V+
Sbjct  779   SNQQPTTALEGELQALLLAMMNCWSKGYKHVIFEGDNINVM  819



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score =   275 bits (703),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 166/515 (32%), Positives = 264/515 (51%), Gaps = 21/515 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S  +SW  R+LS  G+EVLLK++  A+P ++MN+F LP+ + ++I   +  FWWG GD  
Sbjct  307   SVTQSWKQRYLSTGGKEVLLKAIAVAMPIFSMNIFRLPKEVCAEINAVLAKFWWGAGDK-  365

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KGL W +WD++ VPK+ GG+GF+ ++ FN ALLSKQ WR+  HP  L A+I+KA+Y+P 
Sbjct  366   -KGLHWYSWDRVSVPKREGGLGFKDLEIFNQALLSKQVWRVMQHPHCLMARILKARYFPE  424

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
                 +AK     S+ W S+L  + +I    R+ IG+G  V +W D W+PD + PR     
Sbjct  425   EDILNAKLKKKASYPWKSILHGRDLINKGMRYIIGDGSLVNMWTDPWIPD-HPPRSPRAR  483

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               Y     V    N  G  W+++ +R++    D   IL++ I    ++D + W  +E G+
Sbjct  484   GVYQLEEKVREYFNTTGDQWNEQKLREMIIDEDVDKILALKISPVAQQDLLGWHYNEDGI  543

Query  984   FTVKSCY---KAISLDLDSVPIASWST----IWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +TVKS Y     +  +  ++P    +     +W    P + K F+W+V S  L T + L+
Sbjct  544   YTVKSGYWLGTHLPSNPPTIPTHGPAVLKHKVWKTKAPAKLKHFLWRVLSRSLATGNNLK  603

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFE  652
              R I  +  C  C    E+A HI  EC +A   WR      L   + + +  E I  C +
Sbjct  604   RRHIIQNDQCRRCCLAIETADHIFFECPYAKIIWRASGVSNLIINNSSSTLEEKIEACLQ  663

Query  651   SLQPPRAS----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
                  R S    L   + W IW++RN  +++   +P ++++  ++   ++WK      ++
Sbjct  664   CSLSTRLSHMQDLPFWLLWRIWKSRNTLIFRQKEIPWRSLLRYAREDAKEWKQLDNKGEE  723

Query  483   Q--RRSQHQYITK---WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
                RR Q  ++T+   W +PM GW K N D A +    +   GWV+R+ +GI+  +A   
Sbjct  724   GHLRRRQSHHLTECLHWKKPMIGWIKCNTDGAYNSTQHQTSAGWVIRDENGIYKGSAQAR  783

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESD  214
                     E E  AI  AL  C       I +ESD
Sbjct  784   GRTRNDALECELQAILMALQHCWSLGYRKIIMESD  818



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score =   277 bits (709),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 173/538 (32%), Positives = 285/538 (53%), Gaps = 18/538 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLK+VIQA+P+Y M  + LP  ++  I+  M  FWWG+ DT+ 
Sbjct  693   KLQGWKEKLLSRAGKEVLLKAVIQAIPTYLMGGYKLPTMIIQKIQAAMARFWWGSSDTKR  752

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK W+ +C  K  GGMGF+ +  FN ALL +QAWRL + P+SL ++++KAKYYP+ 
Sbjct  753   K-IHWKNWEAMCTLKCLGGMGFKDLGVFNDALLGRQAWRLIHAPQSLLSRVLKAKYYPSC  811

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F DA  G + S+ W S+   K +++    WR+GNG S+ IW   W+ D N   IT+P  
Sbjct  812   EFLDASLGYSCSYSWRSIWSAKALVKEGLVWRVGNGQSINIWEAPWVVDENGRYITSP--  869

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L++ +   W  +V+  +FN RD + IL+IP+      D + W   + G +
Sbjct  870   RNNDITMVQHLIDPNNIEWRLDVIDAVFNERDKKCILAIPLCSSSPHDMLSWALTKDGHY  929

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +L++   ++W  +W++ + P+ + F+W++C+  LPT  +L HR +   
Sbjct  930   SVKTAYMLGKGCNLENFH-SAWVDLWSMEVSPKVRHFLWKLCTHTLPTRGVLFHRHLIDE  988

Query  804   PLCPLCLNVEESAFHILAECS------FATQCWRLFEPLPATSQAQSCSEWITKCFESLQ  643
              +CP      ES +H +  C         + C R+ +     +     ++W  K  +S  
Sbjct  989   EVCPWGCGEHESTYHAIFFCPRFEELWMDSGCARMRDNSDCDTMCDLVAKW--KQLDSRI  1046

Query  642   PPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQ  463
               +   F+++C  IW  RN KV+ N   P   ++     L  ++        +++    Q
Sbjct  1047  RVKGP-FLMLC--IWGERNNKVFNNKITPNSVLLRRVDRLVEEYGKYAVNIYRRQGVVTQ  1103

Query  462   YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEA  283
              +  W  P  G +K+NVDA+L      +GLG + R+H G    A         SP+ AEA
Sbjct  1104  SLRYWNPPSPGCWKINVDASLATEGW-VGLGIIARDHLGGVRFATTRRTRAFWSPEIAEA  1162

Query  282   LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKDLLSTFCSL  112
              AI   +   KR  +  + +ESD L V++ L   +F ++  D +L++I  + S F SL
Sbjct  1163  KAIEMGVRLGKRFGLVNVVIESDCLTVINRLQKTSFYLSDLDNVLSNIFSMSSNFHSL  1220



>ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43404.1| conserved hypothetical protein [Ricinus communis]
Length=668

 Score =   270 bits (690),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 249/500 (50%), Gaps = 51/500 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R++ W  + LSRAG+EVLLK++ QA+P++ MN+FLLP  L  +IER +N  W+ +   + 
Sbjct  216   RLQGWRRKLLSRAGKEVLLKTLAQAIPNFIMNVFLLPFELCVEIERMLNALWFSSNGREN  275

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+RW +W+ LCV K++GG+GF+R+++ N A+L KQAWRL +    +A ++         
Sbjct  276   QGIRWISWECLCVSKEFGGLGFKRLRNVNFAMLGKQAWRLLDENSLVAREV---------  326

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                                    I +G+ R RIGN                N  +++   
Sbjct  327   -----------------------ICRGS-RMRIGNA---------------NGMVSSEIP  347

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L +A+V  +L  +   WD +++ D+FN RD +LI SIP+     ED   W+ D+KG +
Sbjct  348   EGLEDATVAGILQINERRWDGDILVDLFNGRDKRLIESIPLTNRNVEDSWYWLFDDKGNY  407

Query  981   TVKSCYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSP  802
              VK+CY+ +  DL     + W+  W + +P + +  +W++CS C+ TA  LR R +D  P
Sbjct  408   LVKNCYRLLQGDLGRPETSFWNKFWKLKIPTKVRNLMWKICSNCIRTAMNLRMRYVDLDP  467

Query  801   LCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQPPRASLF  622
             LC  C    E+ FH+L  CS A +CW L     +         WI   F        +  
Sbjct  468   LCKWCNREPETLFHVLFGCSMARECWDLLGFRFSFPTESPICSWIQNFFIDNHEDTCAKM  527

Query  621   VIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ---QRRSQHQYITK  451
              ++C ++W  RN  VW         V+  +  L          D++             K
Sbjct  528   ALVCGSLWNQRNHWVWNKQSNTTYGVISPANQLLEQRTRAQSADEEIAPPLGHNTDVTRK  587

Query  450   WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIR  271
             W +P  GW K+N D AL +   ++GLG V+R+ +G    A     +G  + +EAEAL+++
Sbjct  588   WTKPELGWLKINTDTALFLKQGRIGLGCVVRDSNGRMIMARSERRVGRFTAREAEALSMK  647

Query  270   EALSWCKRQHIDYIHVESDS  211
             EALS+ K   +D    E D+
Sbjct  648   EALSYMKDYQMDKCFFELDA  667



>ref|XP_008391252.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=623

 Score =   268 bits (686),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 184/572 (32%), Positives = 281/572 (49%), Gaps = 48/572 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W+ +FLS AG+EVL+K+V  ALP+YAM+ F LP G+  D+ER +  +WW  G+ Q
Sbjct  16    ARLAGWSEQFLSHAGKEVLVKAVAMALPNYAMSCFKLPIGVCRDVERAIRNYWW-RGNDQ  74

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W +WD+L   KK GG+GF+ I+ FNLA L+K  WR+  +P SL A +++ KY+P+
Sbjct  75    KMGVHWISWDRLMRNKKLGGLGFKDIQCFNLAFLAKIGWRILQNPSSLLACVLREKYFPD  134

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A KG N S+ W  + E + ++Q   RWR+G+G  + I +D W P          P
Sbjct  135   KTFREAGKGKNTSWGWKGIFEARRVLQHGIRWRVGDGNQINIRNDPWFPKPTT--FLVKP  192

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V+ L+  +   W  EV+   F+S D + ILSIP+ +    D+++W     G 
Sbjct  193   RECLQETLVSELIEPNSRSWKREVILHGFSSEDTKHILSIPLSKFGCCDRLVWHHTVDGS  252

Query  984   FTVKSCYKAISLDLDSVPIAS---------------WSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VK+ Y+     L++  +                 W  IWN+ +P + K FIW+ C+  
Sbjct  253   YSVKTGYRVAVSLLENGALGKKGRGAPSTHHTSNQVWKGIWNLQVPNKIKFFIWRCCNKA  312

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS----QAQS  682
             L     L+ R +    +C +C  V+ES  H+   C  + + W    PL   S     A  
Sbjct  313   LAVRHNLKRRHMRIDNVCGVCNLVDESENHLFFRCDLSQRLW-FCSPLHLYSIELIGADF  371

Query  681   CSEWITKC--FESLQPPRASL--FVIICWNIWRARNEKVWKNI-CLPAKAVVENSKALWR  517
                W   C   +  +   A L  F    W IW+ RN+ V+K   C P + +      +WR
Sbjct  372   LESWNNFCTSIKDREDAEAILQEFAFGLWRIWKNRNDVVFKGSHCQPNEILT-----VWR  426

Query  516   DWKACTEVDDQQRRSQ--------HQYITK----WIRPMQGWFKLNVDAALDINSRKMGL  373
               K   E  +   R          HQ   K    W +P  G FKLN DAA    S + G 
Sbjct  427   --KNIGEYREAMNRGSLEECAVRPHQPPPKMPMLWEKPKFGSFKLNTDAAWCCTSYRAGA  484

Query  372   GWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHG  193
             GWV+R+  GI H+A  +          AEA AIR  L +C     + + VE+D+  V+  
Sbjct  485   GWVIRDFAGILHAAGGSGTSTFHCAAAAEAHAIRTGLQFCTDYGFENVFVEADAKTVILM  544

Query  192   LSSP-AFVTSFDLLLADIKDLLSTFCSLLYLF  100
             ++   A   SF+ +L DI+ L     S+ + F
Sbjct  545   INKGIAPNCSFECILGDIEVLAQRLTSVTFGF  576



>ref|XP_010667378.1| PREDICTED: uncharacterized protein LOC104884431 [Beta vulgaris 
subsp. vulgaris]
Length=1243

 Score =   276 bits (707),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 169/515 (33%), Positives = 269/515 (52%), Gaps = 9/515 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLK+VIQA+P+Y M ++ +P  ++  I+  M  FWWG+ D + 
Sbjct  668   KLQGWKEKLLSRAGKEVLLKAVIQAVPTYLMGVYKIPATIIQKIQAAMARFWWGSSDAKR  727

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK W+ +C  K  GGMGF+ +  FN ALL +QAWRL N P SL  ++MKAKYYP+ 
Sbjct  728   K-IHWKNWEAMCTLKCLGGMGFKDLTVFNDALLGRQAWRLINAPHSLLGRVMKAKYYPSC  786

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G + S+ W S+   K +++    WR+G+G ++ IW   WL D N+  IT+P  
Sbjct  787   DFIDASLGYSNSYSWRSIWSAKALVKEGLVWRVGDGENINIWEAPWLADENSRHITSP--  844

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V+ L++ H   W  +V+ + FN RD + IL+IP+      D++ W   + G +
Sbjct  845   RRNDLMVVSQLIDPHTKEWRYDVIDEYFNERDRKCILAIPLNPDFPNDELTWALTKDGRY  904

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W  +W + + P+ + F+W++C+  LPT  LL HR +  +
Sbjct  905   SVKTAYMLGKGCNLDNFHTA-WVELWKLEVSPKVRHFLWKLCTNTLPTRALLAHRHLIAA  963

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLF--EPLPATSQAQSCSEWITKCFESLQPPRA  631
               CP      E+A H +  CS   + W     E L   S   S  + + K ++ L     
Sbjct  964   ADCPWGCGENETAAHAIFHCSRFDEIWTDSGCESLRDNSGCDSMCDLVEK-WKQLDSKVR  1022

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITK  451
                  + W IW  RN K++     P + ++  ++ L  +    +    Q++    +    
Sbjct  1023  VKGAFLMWCIWGDRNNKIFNGKSTPNRVLLNRTERLVEEASKYSMAIYQRQPLVSRSSRI  1082

Query  450   WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIR  271
             W  P    +K+NVDA+L++    +GLG + RN  G    AA        +P+ AEA AI 
Sbjct  1083  WRPPPPDCWKINVDASLEVEGW-VGLGVIARNQLGEVRFAASRRVRAFWTPEIAEAKAIE  1141

Query  270   EALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS  166
               +   +R  +  + VESD L V+  L   +F  S
Sbjct  1142  MGVRMGRRFGLANVVVESDCLHVITRLQKTSFYLS  1176



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score =   277 bits (708),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 184/562 (33%), Positives = 274/562 (49%), Gaps = 47/562 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W   FLS  G+EVL+KSV+QALP Y M +F LP  +  D+ + +  FWWG GD + 
Sbjct  697   RIIQWGENFLSSGGKEVLIKSVMQALPVYVMGIFKLPDSVCEDLSKAVRNFWWGAGDGKR  756

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W+AWD L  PK+ GGMGFR  + FN ALL++Q+WR+   PESL A+++KAKY+PN 
Sbjct  757   R-THWRAWDSLTKPKQCGGMGFRDFRLFNQALLARQSWRILEFPESLCARVLKAKYFPNG  815

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D    GN S  W  +     +++    WR+GNG ++RIW D W+P   + R    P 
Sbjct  816   SLIDTSFSGNASPGWRGIEYGLELLKQGIIWRVGNGRTIRIWRDPWIPRDFSRR----PI  871

Query  1161  PYlanasvn--sllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              +   + V   S L +    WD   ++ IF   D + ILSI   +    D + W  D+ G
Sbjct  872   THKGTSRVKWVSELLDQNGEWDSHKIQQIFLPIDVEKILSIHTSRFHENDFVAWHSDKLG  931

Query  987   VFTVKSCYKAISLDLDSVPIA----------SWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
              F+V+S Y  ++L L +V  +          +W+ +W+ H+P + + FIW+  S  L T 
Sbjct  932   RFSVRSAYH-LALSLSNVVASSSSSGQELSKAWNQLWSCHVPQKVRIFIWRAASNSLATM  990

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPA-TSQAQ---SCSEW  670
                + +R++   +C +C   EE   H L  C  A   W +     A T QA    + ++W
Sbjct  991   VNKKKKRLEHCSMCSICGTEEEDVAHALCRCPHAKYLWEVMRRAKAITVQADRNWTGADW  1050

Query  669   ITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAK--------------------  550
             I    E +        +++ W IW  RNE       +PA+                    
Sbjct  1051  IFDISERISKEERPTLLMMLWRIWYVRNEITHGKAAVPAEVSQRFISSYITSLLEIRQFP  1110

Query  549   -AVVENSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGL  373
              A +   K + R   A  +V+  +  S      +W+RP  GW KLNVD + D      G+
Sbjct  1111  DANLCKGKHVIRCAAAGAQVNHPRVNS---VPVRWVRPQAGWMKLNVDGSYDPRDGSGGI  1167

Query  372   GWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHG  193
             G VLRN  G    AAC S    +S  EAE +A +E +    +     I VE+D L +V  
Sbjct  1168  GAVLRNSEGKLIFAACGSMCRPVSALEAELVACKEGIILALQWTFLPIIVETDCLELVKL  1227

Query  192   LSSPAFVTS-FDLLLADIKDLL  130
             ++    V S    L+ +IKDL+
Sbjct  1228  VAEQGKVMSDLGFLIREIKDLV  1249



>ref|XP_009139371.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=608

 Score =   268 bits (684),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 169/554 (31%), Positives = 271/554 (49%), Gaps = 44/554 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
             F  R+ +W+ R LS+ G+EV +KSV QA+P++ M+ +L+PQG+   +  T + FWW +  
Sbjct  20    FNGRVNTWSSRLLSKGGKEVQVKSVAQAVPTFVMSCYLIPQGITVKLRSTTSNFWWSS-K  78

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                +GL W AWD++C PK  GG+GF+ + DFN+ALL+KQ WRL ++P SL A+++K +YY
Sbjct  79    QNSRGLHWIAWDEICTPKDSGGLGFQDLHDFNIALLAKQLWRLIHYPSSLLARVLKGRYY  138

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              ++   + ++  +PS+ W S++  K ++    R  IG G   R+W + W+PDV    +  
Sbjct  139   NHTSPLEDRRTYSPSYGWRSIMAAKPLLISGLRKIIGTGQDTRVWSEPWVPDV----MAR  194

Query  1170  PPFPYlanasvnsllnNHG------SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMI  1009
             PP P      +   L  H         WD +++RD F+  D  LIL +   +    D  +
Sbjct  195   PPRPADHIVYMLPQLLVHSFIRNDTKEWDIQLLRDFFHQDDIPLILGLKPSRSHAPDGYV  254

Query  1008  WVKDEKGVFTVKSCYKAISLDLDSVP---------IASWSTIWNVHLPPRAKTFIWQVCS  856
             W   + G+++VK+ Y  +     S+           +  S +W +  P + K F+WQ  S
Sbjct  255   WNHTKSGIYSVKTGYDLLRSTKSSLSQRVAVEPSITSLQSHVWKIKAPSKMKHFLWQAIS  314

Query  855   GCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS  676
             GC+ TA+ L +R +     CP C    ES  H+L EC  A Q W       A S   S  
Sbjct  315   GCVATAERLMYRHLGTDRSCPRCAGPVESINHLLFECPPALQVW-------ALSDYPSIP  367

Query  675   EWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
              +  K   +   P+   F  ICW IW+ARN+K++    +     ++ +      W+   E
Sbjct  368   GYFPKKEVAPLRPQFDTFPWICWYIWKARNDKLFNGKDVFPIDTLQLASLEAECWRKANE  427

Query  495   VDDQQRRSQHQYITKWIRPMQGWF----KLNVDAALDINSRKMGLGWVLRNHHGI--FHS  334
              +++    Q    T  I     W        +DA+   N    GLGW L++H G+  F  
Sbjct  428   -NEEANEDQDDPSTTEIETTPPWIPRIPTCQIDASWINNGSVSGLGWSLKDHMGLEYFGL  486

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS----PAFVTS  166
              ACN  +  L    AE   +  A S  + + I  +  E+D + +V   ++    PAF T 
Sbjct  487   RACNRNLSAL---HAEMEGLLWAASCMRDKGITAVRFETDCMDLVDMTTNPMDWPAFATE  543

Query  165   ---FDLLLADIKDL  133
                F  L  D +D+
Sbjct  544   IEVFQRLQEDFEDV  557



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score =   277 bits (709),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 176/567 (31%), Positives = 282/567 (50%), Gaps = 36/567 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W+ +FLS+AG+EV++K+V  ALP+YAM+ F LP G+  D+E+ +  +WW  G+TQ
Sbjct  705   ARLAGWSEQFLSQAGKEVMIKAVAMALPNYAMSCFKLPIGVCRDVEKAVRSYWW-RGNTQ  763

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G  W +WD+L   K  GGMGF+ I+ FNLA L+K  WRL  +P SL A ++K KYYP 
Sbjct  764   KRGCHWTSWDRLMKQKSAGGMGFKDIQCFNLAFLAKIGWRLIQNPTSLLATVLKDKYYPG  823

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F DA KG N S+ W  + E   ++Q   RWR+G+G S+ I  D WLP          P
Sbjct  824   KCFKDAGKGRNTSWGWKGIFEGHMVLQHGVRWRVGDGESINIQKDPWLPTPTT--FLAKP  881

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V  L++     W +EV+   FN  +A+ ILSIP+ +    D+++W     G 
Sbjct  882   LDSLEETKVRDLIDPISKSWKEEVILAGFNRDEARKILSIPLSKSGCIDRLVWHYTVNGD  941

Query  984   FTVKSCYKAISLDLDSVPIA---------------SWSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VK+ Y  +   +++  +                +W  IW +  P + K FIW+ C+  
Sbjct  942   YSVKTGYGVVMNLMENGALGKKGRGAPSEHRKNNLTWKRIWKLQAPNKIKFFIWKCCNKA  1001

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQS----  682
             L     L+ R+I    +C +C   +ES  H+  +C F+ + W    PL   S   +    
Sbjct  1002  LAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCEFSHRFW-FGSPLHINSHELAGVDF  1060

Query  681   CSEWITKCFESLQPPRASLFV----IICWNIWRARNEKVWKNI--------CLPAKAVVE  538
                W   C  +    +A   +       W +W+ RN+ V+  +         L  K + E
Sbjct  1061  LESWDKICTSTKNMEKAEEILQEVAFGLWRLWKNRNDVVFNGVHRQHLEVMMLWRKNISE  1120

Query  537   NSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
               +A+  + K+   +  +  ++  +    W +P  G  K+N DAA   +S + G+GWV R
Sbjct  1121  YREAMPLNLKSDCYLISKTLKTVQRPKLHWTKPKFGIIKVNTDAAWCGSSLRTGVGWVGR  1180

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
             +  G+   A  +      S    EA AIR AL  C     D + ++SD+LV++  LS  +
Sbjct  1181  DFAGLLQFAGGSGTGICHSAAAVEACAIRSALMACIDNGFDKVIIDSDALVIIKMLSKVS  1240

Query  177   -FVTSFDLLLADIKDLLSTFCSLLYLF  100
                 S + +L DI+ L+    S+ + F
Sbjct  1241  PHDYSIECILGDIEVLVQRLMSVTFSF  1267



>ref|XP_010687489.1| PREDICTED: uncharacterized protein LOC104901596 [Beta vulgaris 
subsp. vulgaris]
Length=1102

 Score =   274 bits (701),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 178/548 (32%), Positives = 281/548 (51%), Gaps = 21/548 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS  G+EVL+K+V+QA+P+Y M++F LP GLV +I   +  FWWG+ + + 
Sbjct  497   KLQGWKEKLLSHPGKEVLIKAVVQAIPTYMMSVFCLPSGLVDEIHSLIARFWWGSKEGER  556

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W  W+ LC+PK  GG+GFR +  FN ALL+KQAWRL  +  SL A ++KA+Y+   
Sbjct  557   K-MHWYKWETLCMPKSMGGLGFRDLHCFNQALLAKQAWRLTKNSYSLLALVLKARYHKKV  615

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F DA++G NPSF W S+  +K ++    +W +G+G S+R+W D WL         TP  
Sbjct  616   EFVDARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWEDAWLLGEGAHFTPTPSM  675

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V++LL+    GW+ ++V+  F   +  +IL IP+ +   +D + W   + G+F
Sbjct  676   NSDMELRVSALLDYDEGGWNVDMVQQTFVEEEWDMILKIPLSRYWPDDHLYWWPTKDGLF  735

Query  981   TVKSCY--------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +V+SCY        +   L      +A W  +W++  PP+   FIW+ C GCL   + L 
Sbjct  736   SVRSCYWLARLGHIRTWQLYHGERELAVWRRVWSIKGPPKMVHFIWRACRGCLGVQERLF  795

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPL----PATSQAQSCSEWIT  664
             +R I  SP   LC   +E+  H L +C+ A   W++  F PL    P TS  +S  EW+ 
Sbjct  796   YRHIRDSPSSSLCDEPQETICHALYDCTHAKAIWQVSDFSPLIDDVPRTSFVESF-EWLV  854

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
                  +     S    + W +W  RN  ++++  L    V  +   L  ++        +
Sbjct  855   ---SKVSNTELSKLCALLWAVWYCRNMSIFESQTLRGVEVASSFVKLVEEYDTYAASVFR  911

Query  483   QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
               R      T W  P  G+ K N DA +  N  ++G+G VLR+ HG+    A        
Sbjct  912   SVRCGDPSPTSWNPPATGFVKANFDAHVSANG-EIGMGVVLRDCHGVVKLMATKRVGARW  970

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLS  127
                 AEA+A R A+    R     +  E D+LVVV+ + + A  V     +  DI  LLS
Sbjct  971   DAALAEAMAARFAVEVALRLGFVNVLFEGDALVVVNVVKNRADGVAPIFRVFNDIHRLLS  1030

Query  126   TFCSLLYL  103
             +F S  ++
Sbjct  1031  SFESFSFM  1038



>ref|XP_010686872.1| PREDICTED: uncharacterized protein LOC104901027 [Beta vulgaris 
subsp. vulgaris]
Length=1273

 Score =   274 bits (701),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 174/521 (33%), Positives = 257/521 (49%), Gaps = 18/521 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSR G+EVLLKSV QA+P+Y M++F LP GL+ +I      FWWG+   + 
Sbjct  689   KLQGWKEKLLSRPGKEVLLKSVAQAIPTYMMSVFCLPSGLIDEIHAMFARFWWGSNGVER  748

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K L W  WD LC+PK  GG+GFR +  FN+ALL+KQAWRL     S   +++KA+YY   
Sbjct  749   K-LHWHKWDSLCLPKSMGGLGFRDLHCFNMALLAKQAWRLSQDGHSFLHQVLKARYYKRV  807

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F DA++G  PSF W S+  +K ++    +WR+GNG S+R+  D W+    +  + TP  
Sbjct  808   EFLDARRGYTPSFTWRSIWGSKALLLEGLKWRVGNGESIRVGEDAWIMGEGSHFVPTPQA  867

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V++LL+ H  GW+ E+V  IF   +  LIL+IP+ +    D+  W     G+F
Sbjct  868   NSDMELKVSALLDYHTRGWNTELVHQIFQEAEWPLILNIPLSRFWPNDRRFWWPSRNGLF  927

Query  981   TVKSCY--------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +VKSCY        +   L         W  +W V  PP+ + FIW+ C G L   + L 
Sbjct  928   SVKSCYWLGKLGHLRTWRLQHGDGERQLWHNVWRVEGPPKLQHFIWRACKGSLGVKERLH  987

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCS---EWITK  661
              R I    +CP+C    ES  H L EC+ A + W+   F  L A +  +S      W+  
Sbjct  988   WRHICGEAVCPVCGAPSESICHALFECTMAREVWQGSPFVALIAAAPMESFEGTFSWLI-  1046

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ  481
             C  + +  R      + W +W  RN+ V++   L A +V  N   L  ++    +   Q 
Sbjct  1047  CNSTREEMRN--VCALMWAVWYCRNKMVFEQEHLVAPSVAVNFVKLVEEYCGYAKRVFQP  1104

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
                       W  P    FK N DA +       GLG V+RN  G          +    
Sbjct  1105  CGGLQVSAPSWCAPPAMVFKANFDAHISPRGES-GLGVVIRNDVGEVCVMGVRRVVASWD  1163

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
                AEA+A+  A+    R     I  E DSL+VV+ L + +
Sbjct  1164  AATAEAMALLYAVELATRLGYGNIIFEGDSLLVVNALKNQS  1204



>gb|AAK39575.1|AC025296_10 putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|AAP54636.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=791

 Score =   269 bits (688),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 255/536 (48%), Gaps = 36/536 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W    LS  G+EVL+K+VIQA+P Y M +F LP+ ++ D+ +    FWW + + Q 
Sbjct  185   RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQR  244

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K   WKAWD L  PK  GG+GFR    FN ALL++QAWRL  +P+SL A+++KAKY+P+ 
Sbjct  245   K-THWKAWDSLTKPKSLGGLGFRDYWLFNQALLARQAWRLITYPDSLCARVLKAKYFPHG  303

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   G N S  W S+     +++    WR+GNG S+RIW D WLP  ++ R  T   
Sbjct  304   SLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDPWLPRDHSRRPITG--  361

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L      WD   +   F++ DA++IL+I I     ED + W  D+ G+F
Sbjct  362   KANCRLKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDFIAWHPDKNGMF  421

Query  981   TVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +V+S Y+ ++  L ++  +S          W  IW   +P + K F W+V S CL T   
Sbjct  422   SVRSAYR-LAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMVN  480

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE----WIT  664
              + R+++ S +C +C    E   H L  C  A+Q W       + S     S     W+ 
Sbjct  481   KKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLGRFWLF  540

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKA---VVENSKALWRDWKACTEV  493
              C E +     ++F++  W  W  RNE +      P +     +++   L    +   + 
Sbjct  541   DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRFIQSYVDLLFQIRQAPQA  600

Query  492   D---------------DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
             D                 + R  + +   W RP  GW KLNVD + D +S K GLG +LR
Sbjct  601   DLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFDASSGKGGLGMILR  660

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             N  G     +C       +P E+E  A  E L       +  I VE+D   VV  L
Sbjct  661   NSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLPIQVETDCASVVQLL  716



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score =   275 bits (704),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 175/539 (32%), Positives = 277/539 (51%), Gaps = 19/539 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGN-GDTQ  1525
             +++ W  + LSRAG+EVLLK+VIQA+P+Y M ++  P  +V  I   M  FWWG+ GD  
Sbjct  1136  KLQGWKEKLLSRAGKEVLLKTVIQAIPTYVMGVYRFPVAIVKSIHSAMAKFWWGSKGDR-  1194

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + WK+W+ +C PK  GGMGFR +  FN ALL +QAWRL    +SL +K++KAKYYP+
Sbjct  1195  -RPMYWKSWESMCNPKCLGGMGFRDLSVFNEALLGRQAWRLIQCEDSLLSKVLKAKYYPS  1253

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F DA  G   S+ W S+  +K +++    WR+GNG ++ IW D W+ +  +  I++  
Sbjct  1254  SSFLDASLGPVGSYSWRSIWGSKSLVKEGILWRVGNGATINIWDDPWVLNGESRFISSGR  1313

Query  1164  FPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                         L + GS  WD  VV ++FN +D Q IL++P+ +    D++ W   + G
Sbjct  1314  VE---RLKYVCDLIDFGSMEWDANVVNELFNEQDIQAILAVPLSERLPHDRVAWAFTKDG  1370

Query  987   VFTVKSCY---KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
              ++VK+ Y   K+ +LDL      +W TIW + + P+ + F+W++CS  LP   +L+HR 
Sbjct  1371  RYSVKTAYMVGKSRNLDLFH---RAWVTIWGLQVSPKVRHFLWKICSNSLPVRAILKHRH  1427

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQPP  637
             I     CPLCL   E+  H L  CS   + W +             S W+    E  +  
Sbjct  1428  ITSDDTCPLCLEGPETISHALLHCSKVREVWEMAGLTSKLPNGDGAS-WLDSWDEWQEVE  1486

Query  636   RASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQ  463
             + SL  +  + + +W  RN+ V+++ C P + V   +     D+   ++        Q+ 
Sbjct  1487  KDSLVALSYVAYYVWHRRNKVVFEDWCRPNEQVAALAMRAAADYNEYSQHIYGSVAGQNA  1546

Query  462   YITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAE  286
               +K W  P  G  KLN DA++  +   +G+G V RN  G    AA          + AE
Sbjct  1547  RSSKVWQPPPAGCVKLNADASIG-DDGWVGMGVVARNEVGEVLFAASRRVKAWWPVEVAE  1605

Query  285   ALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSL  112
               A+  A+   +   +  +  E+D L + + LS  A F +  D +L D       F S+
Sbjct  1606  GKALCLAIKLARSHDLQNVIFETDCLTITNRLSRGALFFSDLDAVLEDALFFSRDFVSV  1664



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   273 bits (698),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 178/554 (32%), Positives = 272/554 (49%), Gaps = 41/554 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W  + LSR G+EVLLK+V+QA+ +Y M++F +P+GL+++I   M  FWWG+ DTQ 
Sbjct  741   KIQGWKEKSLSRPGKEVLLKAVVQAILTYMMSVFKIPEGLINEIHTLMARFWWGSTDTQR  800

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W +LC PK  GGMGF  +  FN ALL+K+ WRL  +P SL  K++KA+Y+ + 
Sbjct  801   K-MHWSSWAELCKPKAMGGMGFCNLHVFNQALLAKKIWRLHTNPTSLLHKLLKARYFKHD  859

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  +A++G +PS+ W SL   K ++    +WR+G+G+++  W + W+P      I     
Sbjct  860   EVLNARRGFDPSYSWRSLWGAKSLLLEGLQWRVGDGVNISAWENAWVPGCRAAPIPRSME  919

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                   +V   +  +GS W   +V   F+  D Q IL  P+   P  D   W   + GV+
Sbjct  920   SKELIVNVADCIEPNGSTWKQHLVSQCFSDEDGQRILKTPLSIFPTNDIRYWGCTKDGVY  979

Query  981   TVKSCYKAISLDLDSVPIA---SWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRID  811
             TVKS Y    L    +P      W  +W +  PP+   F+WQVC G +   ++L  R I 
Sbjct  980   TVKSGYWFGLLGEGVLPQTLNEVWKIVWKLGGPPKLSHFVWQVCKGNMAVKEVLFRRHIA  1039

Query  810   CSPLCPLCLNVEESAFHILAECSFATQCWR------LFEPLPATSQAQSCSEWITKCFES  649
                +C  C    ES  H+L EC      W       +    P+ S A     W+ +   S
Sbjct  1040  QDEICMSCGIEVESINHVLFECEAIGDVWANCKHGDIVRAAPSGSFASKLLWWVNEV--S  1097

Query  648   LQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQ  469
             L+  R      I W +W  RN+ ++ +  L  + +           K    VD+ +  SQ
Sbjct  1098  LEEVRE--ITTIAWAVWFCRNKLIYAHEVLHPQVMAT---------KFLRMVDEYRSYSQ  1146

Query  468   HQY------------ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
             H +            ++ WIRP     K+NVDA + +  R + LG V+R+  G     A 
Sbjct  1147  HVFSPTSINSGNGGLVSTWIRPSLDVIKINVDAHI-LEGRYVSLGVVIRDSSGAVLLMAT  1205

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFD---LL  154
                +G      AEA A R  L   +R   D + +ESD+L +V  L+S   V  F    LL
Sbjct  1206  KRIVGSEESSMAEAEAARYGLQMARRFGYDKVWLESDALALV--LASHHNVVGFSPLYLL  1263

Query  153   LADIKDLLSTFCSL  112
               DI+ L  +F S 
Sbjct  1264  YDDIRVLSMSFISF  1277



>emb|CAH66131.1| OSIGBa0135L04.5 [Oryza sativa Indica Group]
Length=611

 Score =   265 bits (676),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 179/561 (32%), Positives = 280/561 (50%), Gaps = 56/561 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W   FLS  G+E++LK+VIQA+P Y M LF LP  +  D+ +    FWWG  D   
Sbjct  16    RIIMWGENFLSSGGKEIMLKAVIQAIPVYVMGLFKLPDSVCEDLNKISRSFWWG-ADRGK  74

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W++WDKL  PK+ GG+GFR  + FN ALL++QAWRL + P+SL A++++AKYYP+ 
Sbjct  75    RKTYWRSWDKLVKPKQNGGLGFRDFRLFNQALLARQAWRLIDRPKSLCARVLRAKYYPSG  134

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   GGN S  W ++     +++    WR+GNG S+RIW D WLP  ++ R    P 
Sbjct  135   SLIDTAFGGNASPGWRAIEYGLELLKKGIIWRVGNGHSIRIWRDPWLPRNHSRR----PI  190

Query  1161  PYlanasvnsllnNHG--SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                 N     + +  G    WD++VV+ IF   DA+LIL+I +     ED + W  D+ G
Sbjct  191   TVRGNCRTKWVADLMGVDGTWDEQVVKRIFWPMDAELILTIRLSARAEEDFLAWHPDKWG  250

Query  987   VFTVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             VF+V+S YK ++L L ++   S          W+ +W  ++P + K F W+  +  L T 
Sbjct  251   VFSVRSAYK-LALQLAAIDNGSGSSEAETSKAWNLVWKCNVPQKVKVFTWRAATNSLATM  309

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ--AQSCS--EW  670
             +    R+++ +  C +C    E   H L  C  A + W   +     ++    +C+  +W
Sbjct  310   ENKNKRKLEATGTCGICGVEAEDVAHALCRCPQAKKMWDAMQVAGKGAKDIVGNCTRADW  369

Query  669   ITKCFESLQPPRASLFVIICW-------------------NIWRARNEKVWKNICLPAKA  547
             I    + +   + ++F++I                     ++   R  +  KN+ +  K 
Sbjct  370   ILYQLKIMPREQHAMFLMITHGKSPPPVEVSKRFLESYISSLLEVRQCQS-KNL-IKGKH  427

Query  546   VVENSKA-LWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLG  370
             +V+ S+    +D  A T V           + +W +P QGW KLNVD + D +S K G+G
Sbjct  428   IVQYSRMPKIKDTSASTPV-----------LLRWEKPNQGWMKLNVDGSFDASSGKGGIG  476

Query  369   WVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
              VLRN  G    +AC        P E E LA +E ++   +  +  I VE D    V  +
Sbjct  477   AVLRNSQGEVIFSACGFLDRCSGPLEVELLACKEGINMALQWTLLPIVVEMDCSEAVKLI  536

Query  189   SSPAFVTS-FDLLLADIKDLL  130
             SS +   S    ++ DIK L+
Sbjct  537   SSVSKGRSEVAFIVNDIKQLM  557



>ref|XP_009102110.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=712

 Score =   266 bits (680),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 163/532 (31%), Positives = 267/532 (50%), Gaps = 25/532 (5%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             +  W  + L+  G+EVLLKS+  A+P ++MN+F LP+ +  +I   +  FWWG G++  K
Sbjct  118   VHGWKQKHLTHGGKEVLLKSIALAMPIFSMNIFRLPKEVCEEINAILARFWWGTGES--K  175

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             GL W AW ++C+PK+ GG+GFR ++ FN ALL KQ WR+  +P  L A++++A+Y+P   
Sbjct  176   GLHWYAWKRVCIPKREGGLGFRDLESFNQALLGKQVWRIMQNPNCLMARVLRARYFPEGD  235

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFP  1159
                A      S+ W S+L  K +I    R+ IGNG S ++W D+WL  ++ PR       
Sbjct  236   ILKATLKKKSSYAWKSILHGKDLIVKGMRYIIGNGESTKMWTDSWL-SLHPPRPPRSRGE  294

Query  1158  YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFT  979
                N+ V+  + N+G GW+ + +R+     D + IL + I    R+D M W   + G++T
Sbjct  295   VNTNSKVSDYVLNNGRGWNLDKLREDVIQEDIEKILELKISSKARQDLMGWHYTDNGLYT  354

Query  978   VKSCYKAISL--DLDSVP-----IASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHR  820
             VKS Y  ++   D + +P     +A    +W V +P + K F+W++ S  + T + L+ R
Sbjct  355   VKSGYWLVTHLPDNNYIPPTYGSVALKQKLWKVKVPAKLKHFLWRISSRSIATGNNLKRR  414

Query  819   RIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFESL  646
              +    +C  C   EE+  H+   C +A + WR      L   S   +  E +  C +  
Sbjct  415   HVTPDAICKRCWLEEETEEHLFFTCPYAKKVWRASGINNLVLDSTMSTYEEKLEACLQVS  474

Query  645   QPPRASLF----VIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
                  S +    + I W +W++RN  V++      K ++  +++  R+W+   E  D   
Sbjct  475   TAISLSHYQDLPIWILWRLWKSRNVLVFQQRDFHWKNILSAARSDAREWRNI-ETQDNNA  533

Query  477   RSQH------QYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
                H      +   +W  P   W K NVDA+          GWV+R+ HGI+  A     
Sbjct  534   SDGHSISPTSRSSQRWKAPPNRWLKCNVDASFIDTREPSSAGWVIRDEHGIYKGAVQVQG  593

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFD  160
               V SP E+E  AI  A+ +C  +  + I +ESD    +  L+    V  FD
Sbjct  594   NMVCSPLESELQAILMAVQFCWTKGYNRIIIESDCRKAIDILND--LVLHFD  643



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score =   274 bits (701),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 183/557 (33%), Positives = 269/557 (48%), Gaps = 37/557 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W   +LS  G+E++LK VIQA+P Y M++F LP+ +  D+ +    FWWG  D   
Sbjct  1350  RIILWGENYLSSGGKEIMLKVVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWG-ADKGK  1408

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W+AW  L  PK  GG+ FR  + FN ALL++QAWRL + P+SL A++MKAKYYPN 
Sbjct  1409  RKTHWRAWSCLTKPKHNGGLAFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKYYPNG  1468

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPR-ITTPP  1165
                D   GGN S  W ++     +++    WRIGNG SVRIW D W+P  ++ R ITT  
Sbjct  1469  SLVDTAFGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWIPRDHSCRPITT--  1526

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                       S L      WD + V  +F   DA  IL I       ED + W  D  G 
Sbjct  1527  -KRNCRVKWVSDLLGQDGSWDVQKVSRVFLPIDADEILKIRTSVRLEEDFLSWHPDRLGQ  1585

Query  984   FTVKSCYK-AISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             F+V+S YK AISLD      +S        W  IW  ++P + K F W+  + CL   + 
Sbjct  1586  FSVRSAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKVKVFCWRAANNCLANQEN  1645

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS----QAQSCSEWIT  664
              + R ++ S +C +C N  E   H L+ C  A   W   +   + S       +   W  
Sbjct  1646  KKKRNLERSEICCICGNETEDVSHALSRCPHAVHLWEAMKAAGSLSLNVAGNATGGSWFF  1705

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLP---AKAVVENSKALWRDWKACTEV  493
                E+       +  ++ W IW  RNE     +  P   +K  +E+  +   + K     
Sbjct  1706  DQIENTPAEERMMLCMMLWRIWFVRNELYHGKVPPPIAVSKRFLESYCSSLLEIKQHPHA  1765

Query  492   D----------DQQRRSQHQYI-----TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
             D            + RS+  ++      +W +P  GW KLNVD + D NS K G+G VLR
Sbjct  1766  DVVRGKHVVQQPTRMRSEANHLRRVVPARWEKPQMGWMKLNVDGSYDSNSSKGGIGVVLR  1825

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS-P  181
             +  G    +AC       SP E+E LA +E ++   +  +  I +ESD L+ V+ + S  
Sbjct  1826  DSVGTVIFSACGFLERCSSPLESELLACKEGINLALQWTLLPIILESDCLIAVNMIQSVK  1885

Query  180   AFVTSFDLLLADIKDLL  130
               ++    L+ DI++L+
Sbjct  1886  KEMSQLAYLVRDIRELM  1902



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   274 bits (700),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 172/525 (33%), Positives = 262/525 (50%), Gaps = 27/525 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++  W  + LS+AG+EVL+KSV QA+PSY+M++F LP GL  +IE  +  FWW   D  
Sbjct  1174  NKVNGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKND--  1231

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             G+G+ WK W  +C  K  GG+GFR +  FN ALL KQ WRL   P SL A+++KA+Y+PN
Sbjct  1232  GRGIHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKARYFPN  1291

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F  A  G  PSF W SLL  + +++   RWRIG+G  V I+ D W+P   +   T   
Sbjct  1292  SDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVP--YDRFFTIQS  1349

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P L   S    L     GWD   V   F+  +A+ ILSIP+  G   D+ IW   + G 
Sbjct  1350  IPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPL-MGDNLDRRIWNFTKNGR  1408

Query  984   FTVKSCY---------KAISLDLDSVP----IASWSTIWNVHLPPRAKTFIWQVCSGCLP  844
             ++VKS Y         + +S    + P    + SW  +W + +P +    +W+V    LP
Sbjct  1409  YSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHLWKLKVPQKILHLLWRVAQDILP  1468

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-----PLPATSQAQSC  679
             + ++L  RRI    +C  C    E+  H L  C    Q W   +      LP  +   + 
Sbjct  1469  SKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQVWEALDFPRDFLLPTVADVGT-  1527

Query  678   SEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
               W+   +  + P + SLF    W +W  RN  ++ +   P+  +V+ +K    ++K  +
Sbjct  1528  --WMDAAWSIIPPDKQSLFAFTVWVLWNERNGVLFGSQPTPSGVLVQRAKDYDAEFKRYS  1585

Query  498   EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
               + +   S  + I KW  P    FKLNVD A D+ +   G G ++R+ HG    A    
Sbjct  1586  AANHRSLSSLVRDI-KWRPPTGNCFKLNVDGATDMETGARGAGAIVRDSHGNLVGALAMR  1644

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
                 +S    E  A++  +S+     +  + +E DSL  V  ++S
Sbjct  1645  APSRISVLATELYALKVGISFALDVSLLPLEIEYDSLQAVSMVNS  1689



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score =   273 bits (698),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 163/541 (30%), Positives = 279/541 (52%), Gaps = 16/541 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQALP+Y M ++ +P  ++ +I   M  FWWG G  + 
Sbjct  956   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKIPATVIQEIHSAMARFWWGGGKGEE  1015

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+KLC PK  GG+GF+ ++ FN ALL KQ W L ++  SL +++M AKYYP+ 
Sbjct  1016  RKMHWLSWEKLCKPKCMGGLGFKDLRVFNDALLGKQVWCLLHYKNSLLSRVMSAKYYPHG  1075

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F A  G + S+ W S+   K +++    WR+G+G  + +W + W+ DV+   I +   
Sbjct  1076  DIFQAHLGHSNSYSWRSIWSAKSLVKEGMIWRVGDGKLIDLWSEPWVGDVDGRFIRSSRV  1135

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L+++    W  +++   F+ RD + IL+IP+      DK+ W   + G++
Sbjct  1136  A--GLEVVGDLIDDDSMEWRTDMIETHFDERDQRCILAIPLSSRRISDKLTWAYSKDGLY  1193

Query  981   TVKSCY---KAISL-DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRI  814
             +VK+ Y   K  +L D   V    W  IW++ + P+ + F+W+VC+  LP    L+ R +
Sbjct  1194  SVKTAYMLGKGGNLEDFHRV----WGLIWSLEVSPKVRHFLWRVCTNSLPVRAALKRRHL  1249

Query  813   DCSPLCPLCLNVEESAFHILAECSFATQCWRLF--EPLPATSQAQSCSEWITKCFESLQP  640
                  CP C   EESA H+  +C+ A+Q W L   + +      +   + I + +  L  
Sbjct  1250  TDDDSCPRCACGEESAQHVFFDCTHASQLWDLVGCKEMTRHDVGEEMVDLIIR-WNDLDK  1308

Query  639   PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVDDQQRRSQHQ  463
                     + WN+W  +N+ V++N   P   V +       ++ +  T +    ++    
Sbjct  1309  KLVQKGSYLMWNLWTEKNKIVFENCSHPPVVVAQRVGRQVEEFNEHITRIYGGGQQRVMA  1368

Query  462   YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEA  283
               ++W  P  G+ KLN DA++  +   +GLG V R+  G    +A         P+ AE 
Sbjct  1369  SSSRWTTPPDGFVKLNSDASIG-DDGWIGLGVVARDSQGKILFSAVRRTKAYWPPEVAEC  1427

Query  282   LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSLLY  106
              A+  A+   K   +  + +ESDS +V   LS  A F +  D +L D+  L  +F S+ +
Sbjct  1428  KAVHFAIRLAKSHGLQSVVIESDSQIVTTRLSRAALFYSDLDSILGDVLALCRSFNSVNF  1487

Query  105   L  103
             +
Sbjct  1488  M  1488



>gb|EAZ40370.1| hypothetical protein OsJ_24816 [Oryza sativa Japonica Group]
Length=613

 Score =   263 bits (672),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 165/540 (31%), Positives = 267/540 (49%), Gaps = 45/540 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W  + LSRAG+++L+K+V QA+P++AM+ F L + L  +I   ++ F+W   D + 
Sbjct  19    KIQGWKEKLLSRAGKDILIKAVAQAIPAFAMSCFDLTKTLYDEISSLISRFFWAQHDREN  78

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWDKLC   + GG+G+R +  FNLA+L+ QAWRL ++ +SL A+++KAKY+P+ 
Sbjct  79    K-MHWIAWDKLCSRTEKGGLGYRDLHLFNLAMLAHQAWRLLSNLDSLCARVLKAKYFPDG  137

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  + ++    S+ W S++    +++    WR+G+G  + +W+D W+P     R  TP  
Sbjct  138   KLMEVRESPGISYSWRSIVRGVQVLKVGLIWRVGDGTDIDMWNDPWIPLGTTKRPITPRR  197

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               + N   + +    G  WD E+++DIF   D + IL+IP+  G   D   W  D +G+F
Sbjct  198   GIVLNKVADLINPITGE-WDRELIQDIFWEEDVKNILAIPVHNG-YSDVAAWHFDPRGIF  255

Query  981   TVKSCYKAISLDLDSVPI---------------ASWSTIWNVHLPPRAKTFIWQVCSGCL  847
             +VKS Y  +    D   I                 W  +W ++  P+ K F+W++    L
Sbjct  256   SVKSAYHTLEYQRDRQAIRQTGESSSGKTSSAALQWEKLWRLNHLPKVKHFLWRLAHNSL  315

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSE  673
             P    +  R ++    CP+CL ++E+  H   +C F   CWR+  FE +      Q+ + 
Sbjct  316   PLRQNISKRGMEIDTRCPVCLRLDENGGHCFFKCKFVKPCWRMLNFEHIRQELSLQTSTL  375

Query  672   WITKCFESLQPPRASLFVIICWNIWRARN-----------EKVWKNICLPAKAVVENSKA  526
              + K   +L+       VI+ WN W ARN           E+V+  +    + V ENS  
Sbjct  376   DVCKHILNLREDIMLTTVILLWNWWDARNKVNAGEDRRTHEEVYSRVI---RMVSENS-L  431

Query  525   LWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
             L+RD          + R      + W  P Q   KLN+D A    +   G G++LR+H G
Sbjct  432   LFRD----------KARGNPSSQSTWCPPPQCVLKLNIDGAFQAANLSGGWGFILRDHEG  481

Query  345   IFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS  166
                 A       V     AEA+A   AL         Y  VE+DS ++V  L S  +  S
Sbjct  482   NGVLARAGRIELVHDALSAEAVACLHALRAVLNHGFSYFSVETDSSILVSALDSACYDQS  541



>ref|XP_010666820.1| PREDICTED: uncharacterized protein LOC104883940 [Beta vulgaris 
subsp. vulgaris]
Length=1288

 Score =   269 bits (688),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 273/538 (51%), Gaps = 11/538 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQALP+Y M ++ +P  ++ +I   M  FWWG    + 
Sbjct  712   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKIPMAIIKEIHTAMARFWWGGKGAER  771

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+K+C PK  GGMGF+ +  FN ALL +Q WRL ++  SL +++M AKYYP+ 
Sbjct  772   K-MHWLSWEKMCKPKCMGGMGFKDLGVFNDALLGRQVWRLLHYKNSLLSRVMSAKYYPHG  830

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F A+ G + S+ W+S+   K +++    W++G+G S+ +W D WL D +   + +   
Sbjct  831   DIFQARLGYSNSYSWSSIWSAKSLVKEGLIWKVGDGQSINLWQDPWLCDEDGRFVLSNRV  890

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L+++    W  +V+  +F  RD + IL+IP+     +D++ W   + G +
Sbjct  891   E--GLELVGDLIDDDRKEWKTDVIETLFEERDQKCILAIPLSSRCVQDELTWAYSKDGTY  948

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +L+ V  A W  +W++ + P+ + F+W+VC+  LP   +LR R +   
Sbjct  949   SVKTAYMLGKGGNLEDVHKA-WGILWSLEVSPKVRHFLWRVCTNSLPVRAVLRARHLVEQ  1007

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLF--EPLPATSQAQSCSEWITKCFESLQPPRA  631
               CP CLN  E+  H L  C      W     + + A  + ++  E + + +  L     
Sbjct  1008  DECPWCLNGVETIHHSLFTCVRWRPVWGELGCQAMVAGVEGETMCETVVR-WSELDAKMV  1066

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA-CTEVDDQQRRSQHQYIT  454
                  + WN+W  RN+ V++    P   +V+       ++ +  T +    +R      T
Sbjct  1067  QRGSFLAWNVWTERNKLVFEGQGQPVPVIVQRVSRQCDEFNSYTTRIYGGPKRGGSVSST  1126

Query  453   KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAI  274
             KW  P +G  KLN DA L      +GLG V R+  G    +A            AE  AI
Sbjct  1127  KWCTPPRGMIKLNTDAYLG-EEGWIGLGIVARDCQGKVCFSAVRRTRACWPAAIAECKAI  1185

Query  273   REALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSLLYL  103
               A    K   +  I +ESDS VV + L++   +    D +L D+  L + F S+ +L
Sbjct  1186  YMAARMAKAHGLANIIIESDSQVVTNRLTNETLYFADLDNILGDVLSLCNVFESVKFL  1243



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score =   271 bits (694),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 257/536 (48%), Gaps = 36/536 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W    LS  G+EVL+K+VIQA+P Y M +F LP+ ++ D+ +    FWW + + Q 
Sbjct  906   RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQR  965

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K   WKAWD L  PK  GG+GFR  + FN ALL++QAWRL  +P+SL A+++KAKY+P+ 
Sbjct  966   K-THWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKYFPHG  1024

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   G N S  W S+     +++    WR+GNG S+RIW D+WLP  ++ R  T   
Sbjct  1025  SLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPRDHSRRPITG--  1082

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L      WD   +   F++ DA++IL+I I     ED + W  D+ G+F
Sbjct  1083  KANCRLKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDFIAWHPDKNGMF  1142

Query  981   TVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +V+S Y+ ++  L ++  +S          W  IW   +P + K F W+V S CL T   
Sbjct  1143  SVRSAYR-LAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMVN  1201

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE----WIT  664
              + R+++ S +C +C    E   H L  C  A+Q W       + S     S     W+ 
Sbjct  1202  KKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLGRFWLF  1261

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKA---VVENSKALWRDWKACTEV  493
              C E +     ++F++  W  W  RNE +      P +     +++   L    +   + 
Sbjct  1262  DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRFIQSYVDLLFQIRQAPQA  1321

Query  492   D---------------DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
             D                 + R  + +   W RP  GW KLNVD + D +S K GLG +LR
Sbjct  1322  DLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFDASSGKGGLGMILR  1381

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             N  G     +C       +P E+E  A  E L       +  I VE+D   VV  L
Sbjct  1382  NSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLPIQVETDCASVVQLL  1437



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score =   271 bits (694),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 257/536 (48%), Gaps = 36/536 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W    LS  G+EVL+K+VIQA+P Y M +F LP+ ++ D+ +    FWW + + Q 
Sbjct  1509  RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQR  1568

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K   WKAWD L  PK  GG+GFR  + FN ALL++QAWRL  +P+SL A+++KAKY+P+ 
Sbjct  1569  K-THWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKYFPHG  1627

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   G N S  W S+     +++    WR+GNG S+RIW D+WLP  ++ R  T   
Sbjct  1628  SLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPRDHSRRPITG--  1685

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L      WD   +   F++ DA++IL+I I     ED + W  D+ G+F
Sbjct  1686  KANCRLKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDFIAWHPDKNGMF  1745

Query  981   TVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +V+S Y+ ++  L ++  +S          W  IW   +P + K F W+V S CL T   
Sbjct  1746  SVRSAYR-LAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMVN  1804

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE----WIT  664
              + R+++ S +C +C    E   H L  C  A+Q W       + S     S     W+ 
Sbjct  1805  KKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLGRFWLF  1864

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKA---VVENSKALWRDWKACTEV  493
              C E +     ++F++  W  W  RNE +      P +     +++   L    +   + 
Sbjct  1865  DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRFIQSYVDLLFQIRQAPQA  1924

Query  492   D---------------DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
             D                 + R  + +   W RP  GW KLNVD + D +S K GLG +LR
Sbjct  1925  DLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFDASSGKGGLGMILR  1984

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             N  G     +C       +P E+E  A  E L       +  I VE+D   VV  L
Sbjct  1985  NSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLPIQVETDCASVVQLL  2040



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   269 bits (688),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 170/544 (31%), Positives = 270/544 (50%), Gaps = 24/544 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLK+VIQ++P+Y M+LF +P  ++S+I      FWWG+  T+ 
Sbjct  741   KLQGWKEKLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSEINAMCARFWWGSRGTER  800

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K+C+PK +GGMGFR +K FN ALL+KQ WRL  H  S+A  +  A+YYP S
Sbjct  801   R-MHWLSWEKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHNGSMAHAVFNARYYPRS  859

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A++G +PS+VW S+   K ++    +WR+G+G S+ +W ++WLP  +   + TP  
Sbjct  860   NFLNARRGFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGESAAVVPTPNM  919

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                A+  V+ LL+  G  WD+ V+R+ F   D  LI  IP+      D   W     G F
Sbjct  920   ESPADLRVSDLLDASGR-WDELVLRNHFTEEDILLIREIPLSSRKPPDLQYWWPSTDGFF  978

Query  981   TVKSCYKAISLD--------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             T KS Y    L                 W  IW +  PP+ K F+W+ C G L T   L+
Sbjct  979   TTKSAYWLGRLGHLRGWLGHFGGANGEVWKVIWGLEGPPKLKHFLWRACMGALATRGRLK  1038

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITKCFE  652
              R I     C  C   +ES  H +  CS  +  W    F          S  ++      
Sbjct  1039  ERHIVEDGCCTHCNREDESIVHAIFRCSLVSPIWENSPFTYYVRDGPTSSFMDFFVWLIS  1098

Query  651   SLQPPRASLFVIICWNIWRARN----EKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
              ++      F+ + W  W  RN    E+ W N+ +     ++    L  D+K+   +  +
Sbjct  1099  RMERTDLLSFMAMAWAAWSYRNSVTFEEPWSNVTVSVVGFMK----LVSDYKSYAALVFR  1154

Query  483   QRRSQHQYITK--WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
                    + ++  W+ P +G F+LN DAA+ +    +G+G V+R+  G     A   +  
Sbjct  1155  AGPVTTGFPSRSSWVAPDEGRFRLNTDAAM-LAEGLVGVGAVVRDSRGSVLLVAVRRYRV  1213

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADIKDL  133
               +   AEA+  R  +   K+   + + +E D+  +   L   AF  S  DL+L D+  L
Sbjct  1214  RWTVTLAEAMGARFGVEMAKQFGYEALELECDASNITKALCRKAFGRSPTDLVLEDVSML  1273

Query  132   LSTF  121
               +F
Sbjct  1274  GDSF  1277



>ref|XP_008228453.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=658

 Score =   261 bits (668),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 164/535 (31%), Positives = 256/535 (48%), Gaps = 54/535 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W  + LS AG+E+L+K+V QA+P Y+M+++LLP+    D+ R +  FWW NG+   
Sbjct  145   KLYGWKGKLLSGAGKEILIKTVAQAIPLYSMSVYLLPKYFCDDLNRLIADFWW-NGNNGD  203

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W AWDKLC PK  GG+GFR +  FNLA+L+KQ WRL  +P+SL A++++AKY+P+ 
Sbjct  204   RKIHWLAWDKLCQPKDVGGLGFRDLYAFNLAMLAKQGWRLIQYPDSLIARVLRAKYFPDK  263

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F D     N S+VW S+   + I+    RW++G+G  + IW + WLP  +  R+  P  
Sbjct  264   SFLDVPVSDNSSYVWKSICAARKILLQGSRWQVGSGAEIDIWKEPWLPRPSTFRVLPPKP  323

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                A   V  L+ +H   W+  ++ ++    D  +I ++P+                G+ 
Sbjct  324   TGCAITKVKELILDHPRRWNINLLSNLLYPPDVDVIRTLPL------------SFHHGIL  371

Query  981   TVKSCYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSP  802
             T K+                        +P + K F W+ C+G LPT D L  R+I    
Sbjct  372   TKKA-----------------------KIPSKIKLFWWKACTGILPTKDNLWKRKIHLDT  408

Query  801   LCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWITKCFESLQPPRAS  628
              C LC    ES  H+L  C FA   W   L      + Q     +W+  C + L      
Sbjct  409   CCDLCGAEMESTLHVLWHCPFARGVWACALIGSGGISQQYHHVHDWVLSCIDHLSYANLD  468

Query  627   LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITK-  451
             LF +I W IW ARN K+W N   P      +S A+         +D  + R Q   + + 
Sbjct  469   LFFVIGWAIWEARNGKLWNNQT-PKPEFTSSSAAV-------RLLDFVRARPQGTALGRG  520

Query  450   ------WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEA  289
                   W +P  G  K+NVD +    +   G+G V+R+ +G F +        V S  + 
Sbjct  521   CYAPQPWTKPCAGSLKINVDGSWTAGNTYGGVGIVVRDSNGKFVAGRALHVDNVFSALQV  580

Query  288   EALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIKDLLS  127
             EA+A RE          +    ESDSL ++  + SS    ++   ++ D K LL+
Sbjct  581   EAMAAREGAILAVEGDFNNAIFESDSLQIMSAIRSSSVDRSNVGPVVEDTKALLT  635



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   269 bits (687),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 263/538 (49%), Gaps = 13/538 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQALP+Y M ++ LP  ++ +I   M  FWWG G    
Sbjct  782   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQEIHSAMARFWWG-GKGDE  840

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K+C PK  GGMGF+ +  FN ALL KQ WRL ++ ESL +++M AKYYP+ 
Sbjct  841   RKMHWLSWEKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNKESLLSRVMSAKYYPHG  900

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A+ G + S+ W S+   K ++     WR+G+G  + IW   W+ D     I +   
Sbjct  901   DVRYARLGYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARV  960

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L++     W+ E++   FN RD Q IL+IP+     +D++ W   + G +
Sbjct  961   E--GLEVVGDLMDVERKEWNVELIERHFNERDQQCILAIPLSTRCLQDELTWAYSKDGTY  1018

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD      W+ +W++++ P+ + F+W+ C+  LP   +L+ R +   
Sbjct  1019  SVKTAYMLGKGGNLDDFHRV-WNILWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDE  1077

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFEP---LPATSQAQSCSEWITKCFESLQPPR  634
               CP C   +E+ FH+   C  + + W        LP       C   +   +  +    
Sbjct  1078  AGCPCCAREDETQFHLFYRCPMSLKLWEELGSYILLPGIEDEAMCDTLVR--WSQMDAKV  1135

Query  633   ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVDDQQRRSQHQYI  457
                   I WN+W  RN +V+++   PA  V +       D+     ++    R S     
Sbjct  1136  VQKGCYILWNVWVERNRRVFEHTSQPATVVGQRIMRQVEDFNNYAVKIYGGMRSSAALSP  1195

Query  456   TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALA  277
             ++W  P  G  KLN DA+L      +GLG + R+  G    AA         P+ AE  A
Sbjct  1196  SRWYAPPVGAIKLNTDASL-AEEGWVGLGVIARDSEGKVCFAATRRVRAYWPPEVAECKA  1254

Query  276   IREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSLLY  106
             I  A    +      +  ESDSLV    L+  A F +  D +L DI  + + F S+ +
Sbjct  1255  IYMATRLAQAHGYGDVIFESDSLVATKRLTKAAIFFSDLDAILGDILSMCNAFSSVSF  1312



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score =   267 bits (683),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/522 (30%), Positives = 258/522 (49%), Gaps = 18/522 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R + W  + LS  G+EVLLK+VIQ++P+Y M+ F LP+ L +++ + M  FWWG    + 
Sbjct  533   RTQGWRDKTLSGVGKEVLLKAVIQSIPTYVMSCFELPRHLCNEMHQLMARFWWGEFGDER  592

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWDKLC  KK GG+GFR +  FN ALL+KQ WR+   P+SL A+++K KY+P S
Sbjct  593   K-IHWIAWDKLCSSKKEGGLGFRDMHVFNKALLAKQGWRMLCRPQSLLAQVLKMKYFPTS  651

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A+ G   S+ W SL+  K ++Q   R+++GNG ++ +W D WLP     +  + P 
Sbjct  652   SLIQAEVGKRISYSWRSLMRGKELLQQGLRFQVGNGENIHLWDDPWLPLPYTFKPFSLPM  711

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L+     GW++ ++ ++F   ++++IL IP+     ED+++W  D KG +
Sbjct  712   HGSEGMRVCELIEEGTGGWNEWLLEELFTPMESEIILKIPLSLNGGEDRLVWHFDNKGCY  771

Query  981   TVKSCY-----------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              VKS Y           KA   D D      W  +W   +PP+ +   W++  G LP+  
Sbjct  772   NVKSGYFVGRLLDGLNRKASGSDSDVQWSRLWCKLWRTQVPPKVRMHAWRLVKGTLPSRA  831

Query  834   LLRHRRIDCSPL-CPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWIT  664
              L  +++    + C  C    E + H+   C      W+  + +  P T  + S   W  
Sbjct  832   ALVKKQVQLPDVNCVFCSTNVEDSLHLFKNCEALQPFWQQGMVQIHPRTHPSISVEVWFW  891

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
                E L   +   F++  W IW  RN  VW+        +++ S +L  ++K C +    
Sbjct  892   DMVEMLSGEKLEGFLMALWVIWVERNNMVWRGQFYNITNMMDWSSSLLLEYKHCHQRSVG  951

Query  483   QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
              R+      +KW  P  G  ++N+D +      + G+G V+R+H G   ++    +    
Sbjct  952   TRKKNK---SKWTCPPSGRLRVNIDGSFAHEEGRGGVGVVIRDHKGACVASLARPFPNAA  1008

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
             S    E  A+R  L  C +Q    + VESD + +V  + +  
Sbjct  1009  SAIHMEVEALRAGLLVCVQQGWRDVEVESDCMNLVQAMQTDG  1050



>ref|XP_008387750.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=670

 Score =   260 bits (665),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 171/537 (32%), Positives = 266/537 (50%), Gaps = 37/537 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  ++LS+AG+E+L+KSV  ALP+YAM+ F LP G+  D+ER +  + W  G+ Q
Sbjct  46    ARMSGWAEQYLSQAGKEILVKSVAMALPNYAMSCFRLPIGVCRDVERAIRNYXW-RGNEQ  104

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W +WD+L   KK GGMGF+ I+  NLALL+K  WR+  +P SL A ++  KY+P 
Sbjct  105   RKGIHWVSWDRLMKQKKAGGMGFKDIQCVNLALLAKIGWRITQNPLSLLASVLXDKYFPG  164

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A KG N S+ W  L E + +++   RWR+GNG S+ I  D WLP  +  +    P
Sbjct  165   KSFGEALKGKNTSWGWKGLFEARKVLKLGLRWRVGNGKSINIRKDPWLPXPSTYKXI--P  222

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P L    V  L++   + W  +++   F   D   ILSIP+     +D+++W      +
Sbjct  223   KPILEGTMVCDLIDPVTNSWXTDLIELGFQREDVLPILSIPLSHAGIDDRLVWHYTTNXI  282

Query  984   FTVKSCYK---------AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGC  850
             F+VK+ Y          A+       P  S      W+ IW++ +P + K FIW  C+  
Sbjct  283   FSVKTGYSLALKLMEEXALGRKGRGAPSESNNLNLVWNNIWSLQVPNKIKCFIWXCCNNA  342

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     L+ R +    +C +C  + E+  H+   C F+   W    PL   S A   S++
Sbjct  343   LAVXXNLKRRHMRIDNVCGVCNAINETENHLFFXCEFSHVFW-FCSPLHLNSHALEGSDF  401

Query  669   I---------TKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVE---NSKA  526
             +          K   +    R   F    W +W+ RN+ ++K I      ++E    S +
Sbjct  402   LXSWSNFXAQVKDXNNADDIRQE-FXFGLWRLWKNRNDVIFKGIYRQPLDILEAWRKSTS  460

Query  525   LWRDWKACTEVDDQQR-----RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
              ++D  A  E D++ R     ++     TKW +P  G  K+N DAA   ++  MGLGW+ 
Sbjct  461   EYKDCLAREEXDNRPRLPKXIKASXSXCTKWQKPRFGTIKINSDAAWCKDTMXMGLGWLG  520

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
                 G+  +A         S   AE  AIR AL  C     + I +ESD+ +V+  L
Sbjct  521   XXFAGLLQAAGGIGSGFCHSAAAAEVSAIRYALLACIEHGFNDIIIESDASLVIKML  577



>ref|XP_008355389.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=883

 Score =   264 bits (675),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 172/567 (30%), Positives = 279/567 (49%), Gaps = 36/567 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W+ +FLS+AG+EVL+K+V   LP++AM+ F LP G+  D+E+ +  +WW  G++Q
Sbjct  274   ARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYWW-RGNSQ  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G  W +WDKL   K  GG+GF+ I+ FNLA L+K  WRL  +P SL A +++ KYYP 
Sbjct  333   KRGCHWASWDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVLRDKYYPG  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F DA KG N S+ W  + E++ ++Q   RWR+G+G S+ I  D WLP          P
Sbjct  393   KCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWLPTPTT--FLAKP  450

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V  L++     W + V+ + FN  +A+ ILSIP+ +    D+++W     G 
Sbjct  451   LDNLEEIKVRDLIDPISKSWKEGVITEGFNREEARTILSIPLSKSGCLDRLVWHYTVNGD  510

Query  984   FTVKSCYKAISLDLDSVPIA---------------SWSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VK+ Y      +++  +                +W  IW + +P + K F+W+ C+  
Sbjct  511   YSVKTGYGVAMNXMENGALGKKGRGASSMLRKNNLTWKRIWKLQVPNKIKFFLWKCCNKA  570

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ----AQS  682
             L     L+ R+I    +C +C   +ES  H+  +C F+ + W    PL   S     A  
Sbjct  571   LAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCDFSHRFW-FGSPLHINSHELAGADF  629

Query  681   CSEWITKCFESLQPPRASLFV----IICWNIWRARNEKVWKNI--------CLPAKAVVE  538
                W   C  +    +A   +       W +W+ RN+ V+  +         L  K + E
Sbjct  630   LENWDKICTSTKNMDKAEEILQEVAFGLWRLWKNRNDVVFNGVHRQHLEVMMLWRKNIYE  689

Query  537   NSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
               +AL    K   ++     +++      W +P  G  K+N DAA   +S + G+GWV R
Sbjct  690   FREALSLSLKCEDQLISNNLKTEQSPRLHWTKPKFGTIKVNTDAAWCSSSLRTGVGWVGR  749

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSP  181
             +  G+   A  +      S   AEA AIR AL        D + +ESD+L ++  L    
Sbjct  750   DFAGLLQFAGGSGTSICHSAAAAEACAIRSALVSSIENGCDKVIIESDALGIIKMLRKES  809

Query  180   AFVTSFDLLLADIKDLLSTFCSLLYLF  100
             +   S + +L DI+ L+    S+ + F
Sbjct  810   SHDYSIECILGDIEILVQRLTSVTFSF  836



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score =   269 bits (687),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 275/555 (50%), Gaps = 24/555 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  +W+ RFLS AG+E++LKSV  A+P YAM+ F LP+G+VS+IE  +  FWW     Q 
Sbjct  1157  RTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWEKASNQ-  1215

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AW +L   KK GG+GFR +  FN ALL+KQAWRL  +P SL A++MKA+Y+ + 
Sbjct  1216  RGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYFKDV  1275

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                DAK     S+ WASLL+   +++   R  IG+G ++RI  DN + D + PR      
Sbjct  1276  SILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN-IVDSHPPRPLNTEE  1334

Query  1161  PYlanasvnsllnNHGSG--WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              Y    ++N+L    GS   WDD  +    +  D   I  I + +  + DK+IW  +  G
Sbjct  1335  TY-KEMTINNLFERKGSYYFWDDSKISQFVDQSDHGFIHRIYLAKSKKPDKIIWNYNTTG  1393

Query  987   VFTVKSCYKAISLDLDS-VP--------IASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TV+S Y  ++ D  + +P        I   + IWN+ + P+ K F+W+  S  L T +
Sbjct  1394  EYTVRSGYWLLTHDPSTNIPAINPPHGSIDLKTRIWNLPIMPKLKHFLWRALSQALATTE  1453

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQS--CSEWITK  661
              L  R +   P CP C    ES  H L  C FAT  WRL +     +Q  S    E I+ 
Sbjct  1454  RLTTRGMRIDPSCPRCHRENESINHALFTCPFATMAWRLSDSSLIRNQLMSNDFEENISN  1513

Query  660   CFESLQPPRASLF-----VIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
                 +Q    S F     V + W IW+ARN  V+          V ++KA   DW   T+
Sbjct  1514  ILNFVQDTTMSDFHKLLPVWLIWRIWKARNNVVFNKFRESPSKTVLSAKAETHDWLNATQ  1573

Query  495   VDDQQ---RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
                +     R   +   +W  P   + K N DA  D+   +   GW++RNH+G   S   
Sbjct  1574  SHKKTPSPTRQIAENKIEWRNPPATYVKCNFDAGFDVQKLEATGGWIIRNHYGTPISWGS  1633

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLAD  145
                    +P EAE  A+  AL     +    + +E D   +++ ++  +F +S    L D
Sbjct  1634  MKLAHTSNPLEAETKALLAALQQTWIRGYTQVFMEGDCQTLINLINGISFHSSLANHLED  1693

Query  144   IKDLLSTFCSLLYLF  100
             I    + F S+ + F
Sbjct  1694  ISFWANKFASIQFGF  1708



>ref|XP_008345353.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=953

 Score =   265 bits (677),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 179/572 (31%), Positives = 280/572 (49%), Gaps = 46/572 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  +FLS+AG+EVL+K+V  ALP+YAM+ F LP G+  DIE+ +  FWW  GD +
Sbjct  344   ARLAGWTEQFLSQAGKEVLIKAVAMALPNYAMSCFKLPXGVCRDIEKAIRKFWW-KGDDK  402

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W +W+++   KK GG+GF+ I+ FNLA L+K   RL  +  SL A +++ KY+P 
Sbjct  403   RKGIHWVSWERISKQKKSGGLGFKDIQCFNLAFLAKIGXRLSLNSSSLLATVLRDKYHPG  462

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A +G N S+ W  + E + ++Q   RWR+GNG  + I  D W P  +  R+   P
Sbjct  463   KSFKEAGRGKNTSWGWKGIFEGRKVLQNGIRWRVGNGECINIREDXWFPKPSTFRVR--P  520

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V  L+++  + W   ++R  F+  DA  ILSIP+     +DK +W     G 
Sbjct  521   XVDLDAIMVCDLIDSGSNSWKSNIIRAGFHREDADTILSIPLSYFGCDDKKVWHYTANGD  580

Query  984   FTVKSCYKAISLDL----------DSVPIAS------WSTIWNVHLPPRAKTFIWQVCSG  853
             ++VKS Y  +++DL             P         W  IW + +  + K FI + CS 
Sbjct  581   YSVKSGY-GVAMDLMENGALGKKGRGAPSEQQQRNNVWVKIWRLRVXNKIKLFIXRCCSN  639

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE  673
              L     L+ R +    +C +C   +E   H+   C+F+   W    P    S   +  +
Sbjct  640   ALAVRRNLQRRHLRVDNVCGVCNAPDEXENHLFFRCNFSHLFW-FCXPXHLNSVELAGVD  698

Query  672   WITK--CFESLQPPRASL------FVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR  517
             ++     F      R +       F    W +W+ RN+ V+K +     AV++    LWR
Sbjct  699   FLDSWAKFHKCVKDRVNADEICQEFAFGLWRLWKNRNDVVFKGLHRQPLAVLD----LWR  754

Query  516   D-----WKACTEVDDQQRRSQHQY-------ITKWIRPMQGWFKLNVDAALDINSRKMGL  373
                    +A   VD   +     +          W RP  G  K+N DAA   +SR+ G+
Sbjct  755   KNINEFREAADRVDGDVKXKAEGFHPATARTTPHWQRPXFGTIKINTDAAWXKDSRRAGV  814

Query  372   GWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHG  193
             GWV R+  G+  +A  +  I   S   AE +AIR ALS C +   +++ VESD+  ++H 
Sbjct  815   GWVGRDFAGVLQAAGGSGTILCQSAAAAEVIAIRTALSACIKHGFNHVIVESDAQKIIHM  874

Query  192   LSSPAFVT-SFDLLLADIKDLLSTFCSLLYLF  100
             +        + D +L DIK L   F S+ + F
Sbjct  875   IRKEVSEDFNLDCILGDIKILARMFTSVTFAF  906



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   266 bits (679),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 178/572 (31%), Positives = 282/572 (49%), Gaps = 46/572 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  +FLS+AG+EVL+KSV  ALP+YAM+ F LP G+  DIE+ +  FWW  G+ Q
Sbjct  497   ARLAGWTEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVCRDIEKAIRKFWW-KGNDQ  555

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W +WD++   K  GG+GF+ I+ FNLALL+K  WRL  +P SL A ++K KY+P 
Sbjct  556   RHGIHWVSWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTCYPTSLLATVLKDKYHPG  615

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A +G   S+ W  + E + ++    RWR+GNG  + I  D W P  +  R+   P
Sbjct  616   CTFKEAGRGKLTSWGWKGIYEARKVLLQGIRWRVGNGQRINIRDDPWFPKPSTFRVC--P  673

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
             +  L    V  L+    + W D  +   F+  DA+ ILSIP+     EDK++W     GV
Sbjct  674   YENLDATMVCELIEPASNSWKDNRIFAGFHREDAETILSIPLSHFGCEDKLMWHYSVNGV  733

Query  984   FTVKSCYKAISLDLDSVPIAS---------------WSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VKS Y      +++  +                 WS IW + +P + K FIW+ C+  
Sbjct  734   YSVKSGYGIAREMMENGALGKKGLGAPSEPTQLKKVWSRIWRLQVPNKIKFFIWRCCNNA  793

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     ++ R +    +C +C  V+E+  H+   C F+   W    PL   S      ++
Sbjct  794   LAVRRNIQKRHMRVDNVCGVCNAVDETENHLFFRCRFSHIFW-FSSPLHLNSHVLEGYDF  852

Query  669   ITK--CFESLQPPRASL------FVIICWNIWRARNEKVWKNICLPAKAVVE---NSKAL  523
             +     F++    + +       F    W IW+ RN+ V+K +      V++    +   
Sbjct  853   LDSWGKFQAGMKGKENAEEICQEFAFGLWRIWKNRNDAVFKGLYRQPNEVMDLWWKNIIE  912

Query  522   WRDWKAC----------TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGL  373
             +R+   C          T +    R S H     W RP  G  K+N DAA    + + G+
Sbjct  913   FREASTCLGDTARSTVVTPLSATARPSLH-----WQRPRYGTIKINTDAAWCKATLRAGV  967

Query  372   GWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHG  193
             GWV R+  G+ H+A     +  LS   AEA+AIR AL  C     +++ +ESD+ +++  
Sbjct  968   GWVGRDLAGVLHAAGGLGTVRCLSAAAAEAIAIRNALKACITHRFNHVVIESDAKLIIQM  1027

Query  192   LSSPAFVT-SFDLLLADIKDLLSTFCSLLYLF  100
             +     V  + D +L DI+ L     S+ + F
Sbjct  1028  IRKEVSVDCNLDCVLGDIEILAQRLMSVTFDF  1059



>ref|XP_008233458.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=811

 Score =   263 bits (671),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 172/529 (33%), Positives = 262/529 (50%), Gaps = 28/529 (5%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             I  W    LS AG+EVL+KSV  A+P+Y M  F  P+G  ++I   +  FWWGN  T+G 
Sbjct  200   IAGWKQNTLSMAGKEVLIKSVATAIPAYPMTCFRFPEGTCNEINSDLANFWWGN-STEGN  258

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             GL WK+W KL V KK GG+GFR +  FNLALL+KQAWR+  +P+S+ A+I++A+Y+P+  
Sbjct  259   GLHWKSWKKLGVSKKSGGLGFRDLSSFNLALLAKQAWRIVQNPQSIWAQILQARYFPHCN  318

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRIT-TPPF  1162
             F  AKKG   S+ WASL+E +  +    +++I NG +  IW DNW+   N+  I  T P 
Sbjct  319   FLQAKKGSRSSWAWASLIEGRDALLMEAKFQIFNGATTNIWKDNWISASNSGVIKPTCPV  378

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P  A   V  +++     W+ +++ D  +     LI S PI   PR D+++W  +  G F
Sbjct  379   PITAPQLVCEIMDKPNHSWNLDLIADCLDRETINLIRSTPISLSPRPDRLVWPWNPNGSF  438

Query  981   TVKSCYKAI-----------SLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             +V+S Y              +    SV    W  IWN+   P+ K F+W+  SG + +  
Sbjct  439   SVRSGYHRFHTSKNGPLLQHTYSSHSVDAKVWKVIWNIKTLPKIKHFLWRAISGAISSRL  498

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWITK  661
              L  R++  +PLCP+C   EES  HIL  C +    W   +F      +   +   W+  
Sbjct  499   ALFRRKLVTNPLCPICNCFEESVEHILFLCPWTHPVWFGSVFSYRIIPNAFTTLDRWLHD  558

Query  660   CFESLQPP------RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRD-WKAC  502
                    P      R SL   +CW IW+AR + V+K      + V++ +   + + W+A 
Sbjct  559   MLSIPDTPHEDFLHRFSLLSFLCWEIWKARCDFVFKGTNPDPRLVIKRANDSYSEFWEAN  618

Query  501   T---EVDDQQRRSQHQYI--TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
             T    +   +      Y+   +W+ P     K+N D A    +    +G + R+  G + 
Sbjct  619   TCFSRLSGSRTSPSSPYVGRDRWLPPPANAIKINFDGAWSPGTSHGSIGVIARDDCGTWR  678

Query  336   SAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
                  S I   S   AEA A   A+S+   +    +  ESDS V V  +
Sbjct  679   GGTA-SPISCNSALVAEAAAALYAVSYAITRDFSKVVFESDSKVFVDSI  726



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score =   266 bits (680),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 168/518 (32%), Positives = 264/518 (51%), Gaps = 25/518 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSR G+E+++K+V QA+P+Y M++F +P GL+ +I      FWWG+  +  
Sbjct  741   KLQGWKEKLLSRPGKEIMIKAVAQAIPTYMMSIFKIPDGLIDEIHSLFARFWWGSTGSHR  800

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K L W  W+ LC+PK  GG+GFR +K FN ALL+KQ WRL +   +L  KI+KA+Y+ N 
Sbjct  801   K-LHWHKWEDLCLPKAMGGLGFRDLKSFNAALLAKQGWRLIHGTGTLLHKILKARYFKNC  859

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A  G NPS+ W SL   K ++    +WR+GNG  +R+W D WLP   +  + TP  
Sbjct  860   SFLEAPCGFNPSYSWRSLWGVKDLLMEGTKWRVGNGTQIRVWEDAWLPGHGSHLVPTPMA  919

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                A+  V++L+      W+ E +   F + D +LI  IP+ Q    D M W  ++ GVF
Sbjct  920   HSTADLLVSNLICFESGKWNVEKLNVTFGAHDRRLIRDIPLSQPWSSDVMYWWPNKDGVF  979

Query  981   TVKS--------CYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +V+S        C ++  L      +  W  +W V  PP+   F+W+ C G L   + L+
Sbjct  980   SVRSGYWLARKGCIRSWQLQHGMEELDRWRHVWQVEGPPKLLHFLWRACRGSLAVRERLK  1039

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESL  646
             HR I     CP+C   EE+  H L  C++A + W   +      QA   S      FE  
Sbjct  1040  HRHIIEETSCPICGAAEETITHSLFHCTYAKEIWESSKLYELVVQAPYSS--FATVFEWF  1097

Query  645   QPPRAS----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVDDQQ  481
                       +FV +CW  W ARN  V++ I   + ++      L  D+ +   +V D +
Sbjct  1098  HAKVCKADFLIFVSLCWAAWYARNIAVFEQITPNSLSIASGFMKLVHDYLEYAHKVFDPR  1157

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG-IFHSAAC---NSWI  313
               ++   + +W  P   + KLNVDA + ++   +GLG V R+  G +   A C   + W 
Sbjct  1158  SMARPSAVCRWSPPPDNFIKLNVDAHV-MDGVGVGLGVVARDSGGQVVGMAVCRCSSRWD  1216

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
               +    AEA A++  +    R     + +ESD+L  V
Sbjct  1217  AAM----AEAGALKFGMQVAGRLGFRCVILESDALNAV  1250



>ref|XP_008367240.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=806

 Score =   262 bits (670),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 171/565 (30%), Positives = 278/565 (49%), Gaps = 36/565 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W+ +FLS+AG+EVL+K+V   LP++AM+ F LP G+  D+E+ +  +WW  G++Q
Sbjct  246   ARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYWW-RGNSQ  304

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G  W +WDKL   K  GG+GF+ I+ FNLA L+K  WRL  +P SL A +++ KYYP 
Sbjct  305   KRGCHWASWDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVLRDKYYPG  364

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F DA KG N S+ W  + E++ ++Q   RWR+G+G S+ I  D WLP          P
Sbjct  365   KCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWLPTPTT--FLAKP  422

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V  L++     W + V+ + FN  +A+ ILSIP+ +    D+++W     G 
Sbjct  423   LDNLEEIKVRDLIDPISKSWKEGVITEGFNREEARTILSIPLSKSGCLDRLVWHYTVNGD  482

Query  984   FTVKSCYKAISLDLDSVPIA---------------SWSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VK+ Y      +++  +                +W  IW + +P + K F+W+ C+  
Sbjct  483   YSVKTGYGVAMNMMENGALGKKGRGASSMLRKNNLTWKRIWKLQVPNKIKFFLWKCCNKA  542

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ----AQS  682
             L     L+ R+I    +C +C   +ES  H+  +C F+ + W    PL   S     A  
Sbjct  543   LAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCDFSHRFW-FGSPLHINSHELAGADF  601

Query  681   CSEWITKCFESLQPPRASLFV----IICWNIWRARNEKVWKNI--------CLPAKAVVE  538
                W   C  +    +A   +       W +W+ RN+ V+  +         L  K + E
Sbjct  602   LENWDKICTSTKNMDKAEEILQEVAFGLWRLWKNRNDVVFNGVHRQHLEVMMLWRKNIYE  661

Query  537   NSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
               +AL    K   ++     +++      W +P  G  K+N DAA   +S + G+GWV R
Sbjct  662   FREALSLSLKCEDQLISNNLKTEQSPRLHWTKPKFGTIKVNTDAAWCXSSLRTGVGWVGR  721

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSP  181
             +  G+   A  +      S   AEA AIR AL        D + +ESD+L ++  L    
Sbjct  722   DFAGLLQFAGGSGTSICHSAAAAEACAIRSALVSXIENGCDKVIIESDALGIIKMLRKXS  781

Query  180   AFVTSFDLLLADIKDLLSTFCSLLY  106
             +   S + +L DI+ L+    S+ +
Sbjct  782   SHDYSIECILGDIEILVQRLMSVTF  806



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score =   266 bits (680),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 182/555 (33%), Positives = 271/555 (49%), Gaps = 24/555 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  +W+ RFLS AG+E++LKSV  A+P YAM+ F LP+G+VS+IE  +  FWW     Q 
Sbjct  931   RTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWEKASNQ-  989

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AW +L   KK GG+GFR +  FN ALL+KQAWRL  +P SL A++MKA+Y+ + 
Sbjct  990   RGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYFKDV  1049

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                DAK     S+ WASLL+   +++   R  IG+G ++RI  DN + D + PR      
Sbjct  1050  SILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN-IVDSHPPRPLNTEE  1108

Query  1161  PYlanasvnsllnNHGSG--WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              Y      N      GS   WDD  +    +  D   I  I + +  + DK+IW  +  G
Sbjct  1109  TYKEMTINNLFERK-GSYYFWDDSKISQFVDQSDHGFIHRIYLAKSKKPDKIIWNYNTTG  1167

Query  987   VFTVKSCYKAISLDLDS-VP--------IASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TV+S Y  ++ D  + +P        I   + IWN+ + P+ K F+W+  S  L T +
Sbjct  1168  EYTVRSGYWLLTHDPSTNIPAINPPHGSIDLKTRIWNLPIMPKLKHFLWRALSQALATTE  1227

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQS--CSEWITK  661
              L  R +   P+CP C    ES  H L  C FAT  W L +     +Q  S    E I+ 
Sbjct  1228  RLTTRGMRIDPICPRCHRENESINHALFTCPFATMAWWLSDSSLIRNQLMSNDFEENISN  1287

Query  660   CFESLQPPRASLF-----VIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
                 +Q    S F     V + W IW+ARN  V+          V ++KA   DW   T+
Sbjct  1288  ILNFVQDTTMSDFHKLLPVWLIWRIWKARNNVVFNKFRESPSKTVLSAKAETHDWLNATQ  1347

Query  495   VDDQQ---RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
                +     R   +   +W  P   + K N DA  D+   +   GW++RNH+G   S   
Sbjct  1348  SHKKTPSPTRQIAENKIEWRNPPATYVKCNFDAGFDVQKLEATGGWIIRNHYGTPISWGS  1407

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLAD  145
                    +P EAE  A+  AL     +    + +E D   +++ ++  +F +S    L D
Sbjct  1408  MKLAHTSNPLEAETKALLAALQQTWIRGYTQVFMEGDCQTLINLINGISFHSSLANHLED  1467

Query  144   IKDLLSTFCSLLYLF  100
             I    + F S+ + F
Sbjct  1468  ISFWANKFASIQFGF  1482



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score =   261 bits (668),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 158/518 (31%), Positives = 259/518 (50%), Gaps = 32/518 (6%)
 Frame = -2

Query  1695  KSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKG  1516
             + W+ ++LS  G+EVLLKS+  A+P ++MN+F LP+ +  +I R +  FWWG+G+   KG
Sbjct  536   QGWSQKYLSPGGKEVLLKSIALAMPIFSMNVFRLPKEVCDEINRVLARFWWGSGEN--KG  593

Query  1515  LRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQF  1336
             + W  W ++ +PK  GG+GFR ++ FN ALL KQ WR+  +P  L A+I+KA+Y+ +   
Sbjct  594   MHWYDWKRVSLPKSEGGLGFRDLEKFNQALLGKQVWRILQNPGCLMARILKARYFLDGDI  653

Query  1335  FDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPY  1156
               A+     S+ W S+L  + +++   R+ IG+G  +  W D W+PD + PR   P  P 
Sbjct  654   LSAELKTKASYAWKSILYGRDLVKQGMRYIIGDGSLINTWTDPWIPD-HTPRAPRPRTPG  712

Query  1155  lanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTV  976
             L    VN L + +G GWD++ VR +    D   +L++ +    ++D + W   + G++TV
Sbjct  713   LRIGKVNQLFSQYGYGWDEQKVRAVIVDEDIPKVLALKLSTTAKQDLLGWHYKDDGIYTV  772

Query  975   KSCY---------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRH  823
             KS Y         + +   L +  +     IWN  LP +   FIW+V S  + +   L+ 
Sbjct  773   KSGYWLSTHLPTRERMEPTLGNPSLK--KKIWNTKLPSKIHHFIWKVLSRSIASGANLKR  830

Query  822   RRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFES  649
             R I     C  C N +E+  H+L +C +A Q WR         T    S  E I  C + 
Sbjct  831   RHIMPDAQCRRCCNGDETDKHLLFDCIYAQQIWRASGISNTILTDPRASLEEKIEVCLQC  890

Query  648   LQPPR----ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT------  499
                       +L   + W IW++RN  +++N  +  + V++ ++   ++W   +      
Sbjct  891   CTSIHLRHLTNLPFWLLWRIWKSRNLLIFQNKQIDGRHVLQQARRDAQEWSTHSTLNVSS  950

Query  498   ---EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
                 +  QQ   Q+Q   +W RP  GW K NVDA+          GW++R+ +G +  A 
Sbjct  951   GRPNISSQQTLMQNQ---RWKRPPVGWLKCNVDASFVNAETPSKAGWIIRDENGTYKGAG  1007

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESD  214
                 + V SP E E   I  A+  C  +    +  ESD
Sbjct  1008  QGIGVCVRSPMEGEIQGIIMAMQQCWARGYTRVIFESD  1045



>gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=612

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 159/556 (29%), Positives = 246/556 (44%), Gaps = 95/556 (17%)
 Frame = -2

Query  1665  AGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLC  1486
             A  EV++KSV+QA+PSY M++F LP  L+S IE+  N FWWG+G T   G+ W  W+KL 
Sbjct  60    AKHEVMIKSVMQAIPSYVMSIFQLPATLISTIEKMTNSFWWGHGRTNQHGINWLNWEKLS  119

Query  1485  VPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPS  1306
             + K  GGMGF+ +  FNLA+L KQ  +L   PESL  +I KA+Y+P++ +  A  G NPS
Sbjct  120   MHKNHGGMGFKDLTAFNLAMLGKQGCKLHTMPESLVFRIFKAQYFPSTSYLTANLGHNPS  179

Query  1305  FVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsll  1126
             + W S+L  + I+ G  RW IG   S          D+ +  I TP F  +         
Sbjct  180   YDWRSILRARFIVCGGARWSIGTVFS---------HDIASAIINTPLFSKV---------  221

Query  1125  nNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLD  946
                                              + D++IW  +  G ++V+S Y     +
Sbjct  222   ---------------------------------QHDRIIWKAENDGKYSVRSAYTLCVEE  248

Query  945   LDSVPI----ASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNV  778
             L           WS IW + +PP+ K F+W+VC G LPT + LR + + C   C  C   
Sbjct  249   LIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRGVLPTRNKLRDKGVQCPEACVNCSTT  308

Query  777   EESAFHILAECSFATQCWRLFEPLPATSQA----QSCSEWITKCFESLQPPRASLFVIIC  610
              E   H+   C+F  Q W+L +      QA     + S  I    +     ++ +FV + 
Sbjct  309   SEDVKHLFCVCTFDVQVWQLSDLWSEIQQAVIHFDTASAVIFDLLQRFTLEQSQIFVTM-  367

Query  609   WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYI---------  457
             W++W+ RN KVW+N        V+ ++ +  +W+  T         QH ++         
Sbjct  368   WSLWKRRNLKVWENKNESCAMTVDRARVMMEEWQLATATRSAPTH-QHTHLQNPSAATAQ  426

Query  456   ------------------------TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHH  349
                                       W RP +G FK NVDA    +  ++G+G  +R+  
Sbjct  427   QPVVHLQQSHVASAVSAQQSLVPSISWERPSRGRFKCNVDAGFSTSKNRIGIGICVRDDD  486

Query  348   GIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FV  172
             G +  A   S+  V   +  EAL +  AL W      D +    DS +     +S    +
Sbjct  487   GAYVLAKTISFDVVHPVRVGEALGLYHALEWLSDMQFDNMDFAMDSKITYDAFNSQKDDI  546

Query  171   TSFDLLLADIKDLLST  124
             + F  +++  + L ST
Sbjct  547   SEFGHIISARQSLFST  562



>ref|XP_010506884.1| PREDICTED: uncharacterized protein LOC104783422 [Camelina sativa]
Length=1248

 Score =   261 bits (668),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 176/558 (32%), Positives = 268/558 (48%), Gaps = 35/558 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R   W+ R LS+ G+EV++KS+  A+P++ M+ F LP+ + S +   +  FWW + D +
Sbjct  660   GRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSS-DGR  718

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AW+KLC  K+ GG+GFR + DFN ALL+KQ WRL  +P+SL A+I+K +YY N
Sbjct  719   TGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRN  778

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   +  +  +PS+ W S++  + ++Q     R+G+G S+ IW D W+P   +PR     
Sbjct  779   SDPMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIP-AQSPRPALSK  837

Query  1164  FPYla-nasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P+   +  ++ L+++    W  +V+ D F+  D  LI ++P+   P++D + W   + G
Sbjct  838   GPFKDPSLKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHFTKNG  897

Query  987   VFTVKSCYKAISLD----LDSVPIAS-----WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TVKS Y    L       +V +        +++W V  PP+   F+WQV SGC+P + 
Sbjct  898   RYTVKSGYHVARLTKTGPFKAVGVGPEITSLLASVWKVRCPPKLHHFMWQVLSGCIPVSR  957

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              LR R I C   C  C   EE+  H+L  C  A Q W L + +P  SQ            
Sbjct  958   NLRKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQ-VPVGSQCFPVESVFANMD  1016

Query  654   ESLQP----PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
               L P       S F  I W +W+ARN KV++NI    +  V  ++     W    E  +
Sbjct  1017  HLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEGEAVSWHKAQEGGE  1076

Query  486   QQRRSQHQYITKWIRPMQ---------GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
                 S    + +  RP +           ++  VD +   N R  G GW     H     
Sbjct  1077  DGVNSDQPTVAE-SRPQRPNGSLPLFFTGYRCFVDGSWKSNDRFAGAGWFCIQPHDPRPG  1135

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHI--DYIHVE--SDSLVVVHGLSSPAFVTS  166
                 ++   LSP  AE     EA  W  R  I  DY  V   SD   +V  +SSP    +
Sbjct  1136  RGATNFRQSLSPLHAEV----EAFIWAMRCMIGHDYCDVAFYSDCADLVKMVSSPHDWPA  1191

Query  165   FDLLLADIKDLLSTFCSL  112
             F   L DI+     F S 
Sbjct  1192  FSTYLHDIRTDREEFSSF  1209



>ref|XP_009149643.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=687

 Score =   255 bits (652),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 168/536 (31%), Positives = 268/536 (50%), Gaps = 37/536 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +RI SW  +FLS+ G+E+L+KSV QALP+Y M+ FLLPQ ++  ++  +  FWW      
Sbjct  94    NRINSWTAKFLSKGGKEILIKSVAQALPTYVMSCFLLPQEILQKLKSAIAKFWWST-KQN  152

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +GL W AWDK+C P + GG+GFR +K+FNLALL+KQ WRL +HP SL A+++K +YY  
Sbjct  153   NRGLHWMAWDKVCKPVEKGGLGFRDLKNFNLALLAKQLWRLLHHPTSLLARVLKGRYYRF  212

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +     +PS+ W S+L  + +++   R  IG+G + R+W D WLP  + PR+T   
Sbjct  213   TNPMEIASSNSPSYGWKSMLAARDLLKKGLRRTIGSGFNTRVWFDCWLP-TSIPRLTRDN  271

Query  1164  FPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
               +       + L +H +G W  +++++I    D +LI SI   +  + D   WV  + G
Sbjct  272   GAWRDPELYVNHLIDHSTGEWKIDMIQNICEPEDMRLIQSIKPSRQFKADGFCWVHSKSG  331

Query  987   VFTVKSCYKAIS-----------LDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
             ++TVK+ Y   S           L+    P+   + +WN+  P + K F+WQ  +GC+  
Sbjct  332   LYTVKTGYDLASQLCEESEEQQVLEPSINPLL--TKVWNLRAPRKMKHFLWQCLTGCVVV  389

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE------PLPATSQAQSC  679
                L  R       CP C + EES  H+L EC  A Q W L +        P TS   + 
Sbjct  390   CSRLSDRHCGTDRSCPRCGDEEESINHLLFECPPALQTWALSDLPTGPGHFPRTSLYDNF  449

Query  678   SEWITKC-FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
                +++     +   R +    I W +W+ARN+K++  I +    V++ +     +W   
Sbjct  450   DFLLSRAPTRGISAQRLAKVPWIMWYLWKARNDKLFNGIEVSPMDVLQKATQECAEWLVA  509

Query  501   TEV---DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
              ++      + R Q +   +  R  +   +  VDA+   N    G G+V+    G   S 
Sbjct  510   QQIMSTGKAKERPQSEDQEEMNRLHK--LRCQVDASWATNQSTFGGGFVMELEDGSTISG  567

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQ--HIDYI--HVESDSLVVVHGLSSPAF  175
             +      VL+P  AE      AL W  R   H+ ++  H ESD L +V  L    +
Sbjct  568   SLGG-KQVLTPLHAEM----NALLWAMRNSLHMRHVSMHFESDCLQMVKLLEEEDY  618



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score =   261 bits (667),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 178/540 (33%), Positives = 263/540 (49%), Gaps = 56/540 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS AG+EVLLK V Q++P Y M+ FLLPQGL  +IE+ M  FWWG    + 
Sbjct  713   KLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWWGQ-QGEN  771

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W  W++LC  K  GGMGFR ++ FN+A+L+KQ WRL ++P SLA++++KAKY+P +
Sbjct  772   RKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPQT  831

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F++A  G  PS VW S+   + +++   R++IG+G SVRIW D W+P      + T P 
Sbjct  832   NFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITSPL  891

Query  1161  PYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               + N  V+ L+ N GS  WD + + ++F   D   I+ IP+      D+++W  D+ G+
Sbjct  892   DGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVDIVRIPLSIRAPPDRIVWNYDKHGL  951

Query  984   FTVKSCYKAISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             FTVKS Y+ ++L + S                W  IWN  +P + K F W+V    LPT 
Sbjct  952   FTVKSAYR-VALRVTSGDEDESSSSNSDTGMLWRHIWNATVPTKLKIFAWRVAHDILPTK  1010

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKC  658
               L  + +D   +C  C ++ ESA H+LA C FA   W +                    
Sbjct  1011  ANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAVATWNI--------------------  1050

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
               SL    A         + R+ +E V        + V E   A     K    V D  R
Sbjct  1051  --SLLTRHAH------QGVQRSPHEVV----GFAQQYVHEFITANDTPSKVTDRVRDPVR  1098

Query  477   RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSP  298
                      W  P  G  K N D A D  S +  +G V R+  G F +A   S   VLS 
Sbjct  1099  ---------WAAPPSGRLKFNFDGAFDPTSGREAVGVVARDADGGFVAAVAKSVGEVLSA  1149

Query  297   KEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKDLLSTF  121
             + AE L  RE ++            E DS VVV  +       ++   ++ D+K L   F
Sbjct  1150  EHAEILVAREGVALALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQF  1209



>ref|XP_010412448.1| PREDICTED: uncharacterized protein LOC104698743 [Camelina sativa]
Length=1329

 Score =   261 bits (668),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 176/558 (32%), Positives = 268/558 (48%), Gaps = 35/558 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R   W+ R LS+ G+EV++KS+  A+P++ M+ F LP+ + S +   +  FWW + D +
Sbjct  741   GRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSS-DGR  799

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AW+KLC  K+ GG+GFR + DFN ALL+KQ WRL  +P+SL A+I+K +YY N
Sbjct  800   TGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRN  859

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   +  +  +PS+ W S++  + ++Q     R+G+G S+ IW D W+P   +PR     
Sbjct  860   SDPMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIP-AQSPRPALSK  918

Query  1164  FPYla-nasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P+   +  ++ L+++    W  +V+ D F+  D  LI ++P+   P++D + W   + G
Sbjct  919   GPFKDPSLKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHFTKNG  978

Query  987   VFTVKSCYKAISLD----LDSVPIAS-----WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TVKS Y    L       +V +        +++W V  PP+   F+WQV SGC+P + 
Sbjct  979   RYTVKSGYHVARLTKTGPFKAVGVGPEITSLLASVWKVRCPPKLHHFMWQVLSGCIPVSR  1038

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              LR R I C   C  C   EE+  H+L  C  A Q W L + +P  SQ            
Sbjct  1039  NLRKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQ-VPVGSQCFPVESVFANMD  1097

Query  654   ESLQP----PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
               L P       S F  I W +W+ARN KV++NI    +  V  ++     W    E  +
Sbjct  1098  HLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEGEAVSWHKAQEGGE  1157

Query  486   QQRRSQHQYITKWIRPMQ---------GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
                 S    + +  RP +           ++  VD +   N R  G GW     H     
Sbjct  1158  DGVNSDQPTVAE-SRPQRPNGSLPLFFTGYRCFVDGSWKSNDRFAGAGWFCIQPHDPRPG  1216

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHI--DYIHVE--SDSLVVVHGLSSPAFVTS  166
                 ++   LSP  AE     EA  W  R  I  DY  V   SD   +V  +SSP    +
Sbjct  1217  RGATNFRQSLSPLHAEV----EAFIWAMRCMIGHDYCDVAFYSDCADLVKMVSSPHDWPA  1272

Query  165   FDLLLADIKDLLSTFCSL  112
             F   L DI+     F S 
Sbjct  1273  FSTYLHDIRTDREEFSSF  1290



>ref|XP_009138115.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1081

 Score =   259 bits (663),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 162/547 (30%), Positives = 271/547 (50%), Gaps = 26/547 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R++    + LS+ G+E++LKSV  ALP +AM+ F LP+ L + +   M  FWWG G +  
Sbjct  481   RLRGGGSKILSQGGKEIILKSVGMALPVFAMSCFRLPKDLCAKLTSIMTEFWWG-GTSGK  539

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W AW +LC PK+ GGMGF+ I   N ALL KQAWR++++P+SL A++MK++Y+   
Sbjct  540   RKIPWVAWKRLCKPKELGGMGFKDIAWCNQALLCKQAWRIWSNPQSLLARVMKSRYFRQG  599

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNW--LPDVNNPRITTP  1168
              F D   G  PS+ W S++  + ++       IGNG    +W+DNW  LP    PR  T 
Sbjct  600   DFLDCPIGNRPSYAWRSIVHGRELLSQGILKHIGNGRETHVWYDNWLLLPTPRPPRYRTD  659

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                       + + + HG+ WD + +R +F   DA  IL + +    RED M+W   + G
Sbjct  660   EVDL-TLTVHDLIDSRHGT-WDAQKIRHLFVEEDATAILGMKL-NLQREDTMVWAFSKNG  716

Query  987   VFTVKSCYKAISL-----------DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              +  +S YK ++L           +L  V    WS +W V   P+ + F+W+  +G L  
Sbjct  717   TYDSQSGYKLLNLIQTIESPMTASNLPPVERNLWSNLWKVKTLPKVRHFMWRALAGALAV  776

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSC-----  679
             ++ L  R I+    C +C +  E+  H+L  C  A + WRL   P+PA   + +      
Sbjct  777   SERLASRGINVGTTCKVCQSQPETICHVLFHCPVAKEVWRLSGFPIPAAGFSTNSVFLNF  836

Query  678   SEWITKCFESLQPPRASL-FVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
                +  C +   P +  L F  + W +W++RN  V++++   AK V E  +     W+A 
Sbjct  837   HHLLESCKKCHLPEKTRLVFPWVLWQLWKSRNRCVFEHVVFGAKEVWERIQVEAEAWRAA  896

Query  501   --TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
               T+ +D+ + +     + W +P   + K N+ ++    ++  G+ W+ RNH G   + +
Sbjct  897   NVTDKEDRDQDAAGDSTSTWKKPCPSFVKCNIGSSWVDGNQNCGVAWLTRNHAGAALAHS  956

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLA  148
               S+  + S  EAE L    A         + +  ES S +    +  P     +  L+ 
Sbjct  957   RRSYSHISSSLEAELLGFYWASESVSTMRYEKVVFESTSYLAGEAILKPGNFPQWLSLIE  1016

Query  147   DIKDLLS  127
              I++ LS
Sbjct  1017  AIREKLS  1023



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   262 bits (669),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 168/554 (30%), Positives = 262/554 (47%), Gaps = 24/554 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S+++ W    +S+ G+EVL+K+V+QA+P Y M++F +P  +   IE+ +  FWW N D +
Sbjct  911   SKMEGWKENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEKKIARFWWQN-DCR  969

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ WK WD L   K  GG+GFR +  FN A+L KQAWRL   P SL +K+ KA Y+P 
Sbjct  970   KAGIHWKQWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSLWSKLFKAIYFPA  1029

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F  A KG  PS+ W SLL ++ +I  N +W +G+G ++ I  D WLP      I   P
Sbjct  1030  QDFRYAHKGVRPSWGWQSLLSSREVILPNLQWSVGDGKNINIREDRWLPR----GIVGGP  1085

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                   + V  LL  + + W+   + + ++ +    IL IP+ +   +DK++W +   G 
Sbjct  1086  ANREEPSLVAELLVQNSNHWNLATLNNFYDEQTTAEILRIPVRRNLTQDKLVWTETTNGQ  1145

Query  984   FTVKSCYKAI-----------SLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             +T++S Y ++           +      P   W  IW+V LPP+ K F W VC   LPT 
Sbjct  1146  YTIRSAYHSVRKASICKLTRQASSSYQQPPQLWKCIWSVKLPPKLKVFFWSVCHNALPTK  1205

Query  837   DLLRHRRIDCSPLCPLC-LNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWI  667
             + L  RRI   P+CPLC LN  ES  H+   C + T  W          T+  +   EWI
Sbjct  1206  ENLFRRRITPDPICPLCTLNQPESIEHLFLLCPWTTAIWSHPTINIHIDTTTVRRIDEWI  1265

Query  666   T-KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
               +       P   LF+ +CW +W+ARN  ++          V  + A  R    C    
Sbjct  1266  VDRILHKKSKPDLELFIAVCWQVWKARNGAIFSKHQPDPHFGVHAAFAQVRSAAICDHSL  1325

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
               + +        W  P  G  ++N+D A      +  + ++ R+  G        S + 
Sbjct  1326  MTKPKQSVDLGHFWQPPAPGTLRINIDGAYTSGHTEGSIAFICRDKSGCLQEGLTRS-VQ  1384

Query  309   VLSPKEAEALAIREALSWCKRQ--HIDYIHVESDSLVVVHGLSSPAFVT-SFDLLLADIK  139
               S  + EA A+  AL    +Q      + ++SD L++V  L++          L+ +  
Sbjct  1385  AASALQTEAQALIFALCHLLQQGKMSTSLEIDSDCLLLVDALNNQQEPPWEIRPLVYEAV  1444

Query  138   DLLSTFCSLLYLFC  97
             DL   F +L   FC
Sbjct  1445  DLCRQFLNLNIRFC  1458



>ref|XP_010667704.1| PREDICTED: uncharacterized protein LOC104884717 [Beta vulgaris 
subsp. vulgaris]
Length=1578

 Score =   262 bits (670),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 180/549 (33%), Positives = 266/549 (48%), Gaps = 58/549 (11%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W    LS+AGREV++K V Q+LP+YAM++F  P  L  +I   ++ FWWG    + 
Sbjct  1030  KLQGWKGMVLSKAGREVMIKVVAQSLPTYAMSVFKFPSSLCDEIRSLISQFWWGQKRGER  1089

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW KLC PK  GG+GFR +K FN ALL KQAWRL     SL  +I +A+YYPNS
Sbjct  1090  K-IHWVAWKKLCRPKVEGGLGFRDMKLFNWALLGKQAWRLTLQNGSLIEQIWRARYYPNS  1148

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F D+  G  PS+ W  + E K +++   RWR+G+G S+RIW D W+P   + +I +P  
Sbjct  1149  NFMDSNLGATPSYTWRGIWEAKWVLRRGVRWRVGDGESIRIWKDAWIPGSQSRKIISPRG  1208

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +A V +L++     W +++V D+F   +A  +LSIPI      D + W  ++ G +
Sbjct  1209  NANVDAEVGALIDPITKSWKEDLVADLFLPFEAARVLSIPISHRLPADTLCWDLEKDGCY  1268

Query  981   TVKSCYKAISLD---LDSVPIAS----WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRH  823
             +VKS Y A+S D   L+  P       W+ IW+  + PR K F W+     LPT   L  
Sbjct  1269  SVKSAYNALSNDTWQLNEGPSLCSKDLWNIIWSATVLPRVKLFAWRAYLDALPTRLGLHK  1328

Query  822   RRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQ  643
             R       C LC   EESAFH L +C  A   W + +              I  C     
Sbjct  1329  RMCSMEASCSLCGAREESAFHALFDCGLAQSVWDVSD--------------IDACL----  1370

Query  642   PPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD--QQRRSQ  469
              P        C N+      + W  + LP  +          + + C EV D  + RR Q
Sbjct  1371  -PEG------CDNV------RDWWAVSLPQLS----------EEQMCVEVKDMVEGRRRQ  1407

Query  468   H-----QYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
                    +   W  P   W K+NVDA   +     GLG V R+  G+         +   
Sbjct  1408  QGVAAINHQVSWTAPKADWVKINVDAG-QVGEFCSGLGAVCRDEGGVVLGCLSVQSLVAW  1466

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKDLLS  127
               + AEA A  E +    R     + +ESD L+++  L +P    ++F L++ DI  L S
Sbjct  1467  ELRIAEAKAALEGIKMAIRGGYSQVIIESDCLLLIQALRNPVVGASNFHLVVEDILFLSS  1526

Query  126   TFCSLLYLF  100
                ++++ F
Sbjct  1527  QLDAVIWSF  1535



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   262 bits (669),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 179/540 (33%), Positives = 264/540 (49%), Gaps = 56/540 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS AG+EVLLK V Q++P Y M+ FLLPQGL  +IE+ M  FWWG    + 
Sbjct  1193  KLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWWGQ-QGEN  1251

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W  W++LC  K  GGMGFR ++ FN+A+L+KQ WRL ++P SLA++++KAKY+P +
Sbjct  1252  RKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPQT  1311

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F++A  G  PS VW S+   + +++   R++IG+G SVRIW D W+P      + T P 
Sbjct  1312  NFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITSPL  1371

Query  1161  PYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               + N  V+ L+ N GS  WD + + ++F   D   I+ IP+      D+++W  D+ G+
Sbjct  1372  DGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVDIVRIPLSIRAPPDRIVWNYDKHGL  1431

Query  984   FTVKSCYKAISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             FTVKS Y+ ++L + S                W  IWN  +P + K F W+V    LPT 
Sbjct  1432  FTVKSAYR-VALRVTSGDEDESSSSNSDTGMLWRHIWNATVPTKLKIFAWRVAHDILPTK  1490

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKC  658
               L  + +D   +C  C ++ ESA H+LA C FA   W +                    
Sbjct  1491  ANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAVATWNI--------------------  1530

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
               SL    A         + R+ +E V        + V E   A     K    V D  R
Sbjct  1531  --SLLTRHAH------QGVQRSPHEVV----GFAQQYVHEFITANDTPSKVTDRVRDPVR  1578

Query  477   RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSP  298
                      W  P  G  K N D A D  S +  +G V R+  G F +A   S   VLS 
Sbjct  1579  ---------WAAPPSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSA  1629

Query  297   KEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKDLLSTF  121
             + AE LA RE ++            E DS VVV  +       ++   ++ D+K L   F
Sbjct  1630  EHAEILAAREGVALALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQF  1689



>ref|XP_007210987.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
 gb|EMJ12186.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
Length=759

 Score =   255 bits (651),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 263/512 (51%), Gaps = 39/512 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGN-G  1534
                ++  WN   LS+AGRE+L+KSV  A+P+Y MN+F  P  L  +I+  + GFW G  G
Sbjct  166   ILRKVHGWNQHCLSQAGREILIKSVALAVPAYPMNIFKFPTTLCKEIDSVLAGFWCGQIG  225

Query  1533  DTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKY  1354
             D   + L W  WD L  PK  GGM FR +  FNLALL+KQ WR+   P+SL  K++K +Y
Sbjct  226   DN--RKLHWINWDTLGQPKHEGGMDFRNLHKFNLALLAKQCWRILMEPQSLWVKVLKGRY  283

Query  1353  YPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNN--PR  1180
             +PN  F +AK+ G  S+ WASLLE + I+     W++ NG  +R+W D WLP+  N  PR
Sbjct  284   FPNVSFLEAKRSGRTSWAWASLLEGRDILLRGAHWQVMNGAHIRLWIDRWLPNSLNDCPR  343

Query  1179  ITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVK  1000
             + +       N  V +++N     W+ + +R   +  DA+ I  +        D++IW  
Sbjct  344   LHSTE-TLDRNLRVEAIINRELDEWNLDPIRHAISDSDARAITRVKFGSSRLPDRLIWPM  402

Query  999   DEKGVFTVKSCYK--------------AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQV  862
             +  G ++V+S Y               + S+ +D      W  IW   +PP+ + F+W+ 
Sbjct  403   ERNGSYSVRSGYHWLHNTECRRRNPRPSSSMTIDP---RLWKQIWKADVPPKIRNFLWRA  459

Query  861   CSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW-RLFEPLPATSQA-  688
                CL T+  L  ++I  SP+CPLC +  E+A HIL  C +    W R    L    QA 
Sbjct  460   LRNCLATSANLHKKKIARSPMCPLCNDHPETAEHILLLCPWVEPVWFRCSLNLRINRQAV  519

Query  687   QSCSEWITKCFESLQPPRA-----SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKAL  523
              S  +W+    E  + P+      ++    CW IW+ + + V ++I  P+ A   ++ ++
Sbjct  520   TSFGQWLGNVIEKGKTPQERSRCLTVIAYFCWQIWKDKCKAVLEHIS-PSPARTTHAASI  578

Query  522   WRDWKACTEVDDQQRRSQHQYITK------WIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
               + +    +D  + +++H  ++       W  P   + K+NVDA+ + NS+++G+G ++
Sbjct  579   AIN-EFLGSLDHGRHQTEHPTLSNDNQQQLWNPPTSPFVKVNVDASWNPNSKRVGIGILI  637

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREA  265
             RN HG F   +    +   S  EAEA A  E 
Sbjct  638   RNTHGDFIKGSSIPSVAN-SAIEAEAQACLEG  668



>ref|XP_009132673.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=824

 Score =   256 bits (654),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 166/537 (31%), Positives = 266/537 (50%), Gaps = 26/537 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +   W++R+LS AG+  +LKSV+  +PS+AM  F LP  L   I+ T+ GFWWG  D + 
Sbjct  255   KAAGWSNRYLSTAGKMTMLKSVLTPIPSFAMTCFQLPVSLCKRIQSTLTGFWWGKNDGRN  314

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W K+ +PK  GG+ FR I+  N A L+K +WRL  +P +L  +I+  KY P+ 
Sbjct  315   K-MAWISWTKMTMPKDKGGLDFRDIQSINDAFLTKFSWRLVRNPTNLLGRILLGKYCPDG  373

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F       + S  W  ++  + +I  N  W +GNG S+ IW   WL      R   P  
Sbjct  374   DFLTCTISSSCSHGWRGIMVGRDLIAENSGWAVGNGESLNIWESPWLSLTAQERPMGPAP  433

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L N +V  L     + W+ E++R I    + ++    P   G   DK++WV    G +
Sbjct  434   EALVNTTVAELFLPEKNEWNLELIRQILPFEEHKIRTLKPSLTGA-PDKLMWVHSVTGEY  492

Query  981   TVKSCYKAISL----DLDSVPIA----SW-STIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
             T K+ Y A+++    D   +P      +W  ++WN+H  P+ K FIW++    LP  ++L
Sbjct  493   TTKTGY-AVAIPKHTDFTHIPQGILDFNWRKSVWNLHTAPKIKLFIWKIFHRALPVGEIL  551

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPA---TSQAQSCSEWITKC  658
             R R+I+    C +C  + E+  H+   CSFA Q W L    P+   +  A+  SEW    
Sbjct  552   RARQINVDGRCKIC-GLPETIDHLFLHCSFAKQVWNLVPVWPSIEYSGTAELQSEWNHLM  610

Query  657   FESLQPPR----ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
                  PP      SL   I W +W+ARN  ++ +  L  + V+  + A  R+W    E+D
Sbjct  611   ARQALPPTGIAAGSLAPWILWQLWKARNSLLFNDKGLSVREVISVAIAAAREWNQSQELD  670

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
               +R      +T    P +    +  DAA +  ++  GLGW++R+ +     +    ++G
Sbjct  671   STKRTLPKPRVT----PQEESVVVRSDAAWNEANKVAGLGWIIRSRNKSSSYSEPARYVG  726

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIK  139
               SP  AE LA+REA+  C+   +  +  ESD   ++  L+S         ++ADIK
Sbjct  727   --SPLVAEGLALREAILRCRDLGLPRLRCESDCAQLIKALTSDQSFAELYGIVADIK  781



>ref|XP_009114067.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=524

 Score =   249 bits (637),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/471 (32%), Positives = 244/471 (52%), Gaps = 19/471 (4%)
 Frame = -2

Query  1695  KSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKG  1516
             + WN +FLS  G+EVLLK+V  A+P ++MN+F LP+ +  +I   +  FWWG+GD  G  
Sbjct  43    QGWNKKFLSHGGKEVLLKAVALAMPIFSMNVFRLPRNICDEINSILAKFWWGSGDKTG--  100

Query  1515  LRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQF  1336
             + W +W ++ VPK+ GG+GFR ++ FN ALL KQ WR+  +P+ L A+I+KA+Y+P+   
Sbjct  101   MHWYSWKRVSVPKREGGLGFRDLEKFNQALLGKQVWRIIQNPQCLMARIIKARYFPDGNI  160

Query  1335  FDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPY  1156
             F A      S+ W SL+  + +++   R+ IG+G +V +W D WLP V+ PR        
Sbjct  161   FTATIKRKSSYAWKSLIYGRDLLKRGMRFIIGDGSTVNMWADPWLP-VHPPRAPRSRNGT  219

Query  1155  lanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTV  976
              A  SV + +   G+GW+ + +RD     D ++ILS+ I    + D + W   + G++TV
Sbjct  220   QALESVRNYMLEDGTGWNIDKLRDNVVPEDVEVILSLKISSNAQLDLLGWHYTDDGIYTV  279

Query  975   KSCY-KAISLDLDSVPIASWST------IWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             KS Y  +  L  + +    W        +W ++ PP+ K F+W+  S  L     L+ R 
Sbjct  280   KSGYWLSTHLPDNDIIEPIWGDPLIKQRVWKMNSPPKIKHFLWKTLSRSLAVGSNLKRRH  339

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFESLQ  643
             I     C  C +  E+  H+L +C +A + WR              +  E I  C    +
Sbjct  340   ITRYDQCMRCCSAIETEQHMLFDCPYAQKIWRASGISSNIINGSYSTLEEKIEACLTCNR  399

Query  642   PPRAS----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT--EVDDQQ  481
                 +    L + + W IW++RN  +++   +   +V+  + A   +W   +  EV +  
Sbjct  400   SSSLTHIKDLPIYLLWRIWKSRNMMMFQQRNIQWWSVIHQANADAAEWSKYSQEEVCNGT  459

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
             RR   Q I  W RP +GW K N D +    + +   GWV+R++ G F  AA
Sbjct  460   RRVTKQSIN-WQRPREGWMKCNFDGSFYNTATQSRAGWVVRDNFGSFKFAA  509



>ref|NP_001175214.1| Os07g0501200 [Oryza sativa Japonica Group]
 dbj|BAH93942.1| Os07g0501200 [Oryza sativa Japonica Group]
Length=620

 Score =   251 bits (642),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 175/562 (31%), Positives = 268/562 (48%), Gaps = 47/562 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W    LS  G+E+L+KSV+QA+P Y M +F +P  +  ++ + +  FWWG  D   
Sbjct  16    RILLWGENHLSVGGKEILIKSVLQAIPVYVMGIFKIPDSVCDELTKAVRNFWWG-ADRGK  74

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W+AWD L  PK+ GGMGFR  K FN ALL++QAWR+ ++  SL A+++KAKY+PN 
Sbjct  75    RKTHWRAWDTLIKPKQCGGMGFRDFKLFNQALLARQAWRILDNLNSLCARVLKAKYFPNG  134

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLP-DVNNPRITTPP  1165
                D   GGN S  W  +     +++    WR+GNG S+RIW D WLP D +   IT   
Sbjct  135   SIIDTSFGGNSSPGWKGIEYGLELLKKGIIWRVGNGHSIRIWRDPWLPRDFSRRPITRKG  194

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                         L N    WD E ++  FN  D  +IL I   +    D + W  D+ G+
Sbjct  195   ---NCRIKWVPDLLNDNGEWDLERIQQHFNQIDTDIILKIRPSRSQEADFVAWHPDKHGI  251

Query  984   FTVKSCYKAISLDLDSVPIA----------SWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             F+V+S Y  +++ L +V  +          +W  +WN ++P + K F W+  +  L T  
Sbjct  252   FSVRSAYH-LAVSLANVNSSSSSSGHDLSKAWKLVWNCNIPQKVKIFAWKAATNSLATLQ  310

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW---RLFEPLPATSQAQ-SCSEWI  667
               + RR++   +C +C   EE   H L  C  AT  W   R  + +   + A  S S WI
Sbjct  311   NKKTRRLEPMAICSICGREEEDVAHALCRCPHATNLWLSLRSSKDISFEAGASWSGSGWI  370

Query  666   TKCFESLQPPRASLFVIICWNIWRARNE----KVWKNICLPAKAVVENSKALWRDWKACT  499
                   +     ++F+++ W IW  RNE    K    + +  + +V    +L R+ K   
Sbjct  371   LDQLGLIAKEEGAMFLMLLWRIWYNRNEIYHGKSAPPVSVSHRFIVSYVSSL-REIKQFP  429

Query  498   EVDDQQRR---------------SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWV  364
               D  + +                  + +  W +P  GW KLNVD + D      G+G V
Sbjct  430   RADFAKGKFVVSNLGCMKGTSQVPDPKVLNHWEKPNPGWMKLNVDGSFDARYGSGGIGAV  489

Query  363   LRNHHG--IFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             LRN  G  IF    C +        EAE LA RE +    +  +    VE+DSL ++  +
Sbjct  490   LRNSAGSLIF----CGNMSRCGGALEAELLACREGIIMALQWTLLPFIVETDSLELLKLV  545

Query  189   SSPAFVTS-FDLLLADIKDLLS  127
              + +   S    L+ +++D LS
Sbjct  546   GAGSSDRSELAFLVKEVRDPLS  567



>ref|XP_010688970.1| PREDICTED: uncharacterized protein LOC104902764 [Beta vulgaris 
subsp. vulgaris]
Length=1289

 Score =   259 bits (661),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 271/540 (50%), Gaps = 15/540 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQALP+Y M +  +P  ++ +I   M  FWWG G    
Sbjct  712   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVHKIPTAIIKEIHSAMARFWWG-GKGVA  770

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K+C PK  GGM F+ +  FN ALL +Q WRL ++  SL +++M AKYYP+ 
Sbjct  771   RKMHWLSWEKMCKPKCMGGMRFKDLGVFNDALLGRQVWRLLHYKSSLLSRVMSAKYYPHG  830

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F A+ G + S+ W+S+   K +++    W++G+G S+ +W D WL D +   + +   
Sbjct  831   DIFQARLGYSNSYSWSSIWSAKSLVKEGLIWKVGDGKSINLWSDPWLSDEDGRFVLSNRV  890

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L+++    W  +V+ ++F  RD + IL+IP+     +D++ W   + G +
Sbjct  891   E--GVELVGDLIDDDRKEWKMDVIENLFEERDQKCILAIPLSSRCLQDELTWAYSKDGTY  948

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD V  A W  +W++ + P+ + F+W+VC+  LP   +LR   +   
Sbjct  949   SVKTAYMLGKGGNLDDVHKA-WGILWSLEVSPKVRHFLWRVCTNSLPVRAVLRACHLVDQ  1007

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLF--EPLPATSQAQSCSEWITK--CFESLQPP  637
               CP CLN  E+  H L  C+     W     + +    + ++  E + +    ++    
Sbjct  1008  DECPWCLNGAETIHHSLFTCARWRSVWGELGCQAMVDGVEGETMCEMVVRWSELDAKMVQ  1067

Query  636   RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA-CTEVDDQQRRSQHQY  460
             R S F    WN+W  RN+ V++    P   +V+       ++ +  T +    +R     
Sbjct  1068  RGSFFA---WNVWTERNKMVFEGQRQPVPVIVQRVGRQCDEFNSYTTRIYGGPKRGSCVS  1124

Query  459   ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEAL  280
               KW    +G  KLN DA L      +GLG V R+  G    +A            AE  
Sbjct  1125  SAKWCASPRGTIKLNTDACLG-EEGWIGLGLVARDFQGKVCFSAVRRTRACWPAAIAECK  1183

Query  279   AIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFCSLLYL  103
             AI  A    K   +  + +ESDS VV + LS+   +    D +L D+  L + F S+ +L
Sbjct  1184  AIYMAARMAKAHGLVDVIIESDSQVVTNRLSNETLYFADLDNILGDVLSLCNAFESVKFL  1243



>ref|XP_009138597.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=622

 Score =   251 bits (642),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 164/551 (30%), Positives = 263/551 (48%), Gaps = 33/551 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+ SW  R LS+ G+EVLLKS   ALP + M+ F LP+ ++ ++E  M  +WW N +   
Sbjct  23    RLNSWFLRKLSQGGKEVLLKSTAAALPVFPMSCFRLPKTIIKNLESLMANYWW-NSEAHV  81

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
               + W +WD+LC+PK  GG+GF+ ++ FN ALL+KQAW+L N+ E L  + +K++Y+PNS
Sbjct  82    NKIHWSSWDRLCLPKALGGIGFKDLESFNQALLAKQAWKLVNNQECLMTRFLKSRYFPNS  141

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD----VNNPRIT  1174
              F +A  G  PSF W S++  + ++Q   +  IGNG   R+W D W+ D    +  P I 
Sbjct  142   HFLEAPVGARPSFAWRSIIHGRELLQKGLKKSIGNGGDTRVWLDKWIDDPETGLRAPWIK  201

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                F             +    W++  ++++F   D +LILS P P    ED   W  + 
Sbjct  202   CITFDVNLMVRDLIDSTSR--KWNESALQEVFVPSDVELILSNP-PSISHEDSFTWRHNR  258

Query  993   KGVFTVKSCY-----KAIS------LDLDSV-PIASWSTIWNVHLPPRAKTFIWQVCSGC  850
              G  TVKS Y     + I       L+L S+ PI     +W +  PP+ K F+W+V S  
Sbjct  259   SGNLTVKSAYWLARDQKIKECCPEVLELPSLNPIK--EEVWKITSPPKIKIFLWKVLSEA  316

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSE  673
             LP ++L+  R +     C  C    ES  H L +C  A Q W L   P P     +    
Sbjct  317   LPVSELIIKRGLQIDERCQSCGVEGESILHALFQCDPARQVWALSGIPHPKIGFDEGSLF  376

Query  672   WITKCFESLQPPRASLFVI------ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW  511
                     L+  +     +      + W IW++RNE ++K      + + E +     +W
Sbjct  377   GNLNYLLKLKNSKRGEITVNRTWPWLLWGIWKSRNELIFKGRRWLPEEIKEKAVYEAEEW  436

Query  510   KACTEVDDQ-QRRSQHQYIT---KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
                 EV+++  +RS ++ ++    W  P + W   NV       S +MG+ WV+RNH G+
Sbjct  437   FLAQEVEEETTKRSANEVVSIKRNWSPPRKDWLMCNVGFDWVKQSNRMGVAWVVRNHRGV  496

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
                 +  ++  V S  EA   +I  A+      H   +    D   +   + +P    + 
Sbjct  497   VRMHSRRAFSNVRSLAEARLASILWAVESMSSLHYTKVVFAGDYKEIFMAVQNPLQWPAL  556

Query  162   DLLLADIKDLL  130
                + ++K LL
Sbjct  557   RYQVVELKTLL  567



>ref|XP_008341112.1| PREDICTED: uncharacterized protein LOC103404034 [Malus domestica]
Length=1332

 Score =   258 bits (660),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 178/568 (31%), Positives = 281/568 (49%), Gaps = 38/568 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  ++LS+AG+E+L+KSV  ALP+YAM+ F LP G+  D+ER +  + W  G+ Q
Sbjct  723   ARMSGWAEQYLSQAGKEILVKSVAMALPNYAMSCFRLPIGVCRDVERAIRNYXW-RGNEQ  781

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W +WD+L   KK GGMGF+ I+  NLALL+K    +  +P SL A ++  KY+P 
Sbjct  782   RKGIHWVSWDRLMKQKKAGGMGFKDIQCVNLALLAKIGXXITQNPLSLLASVLXDKYFPG  841

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A KG N S+ W  L E + +++   RWR+GNG S+ I  D WLP  +  +    P
Sbjct  842   KSFGEALKGKNTSWGWKGLFEXRKVLKLGLRWRVGNGKSINIRKDPWLPXPSTYKXI--P  899

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P L    V  L++   + W  +++   F   D   ILSIP+     +D+++W      +
Sbjct  900   KPILEGTMVCDLIDPVTNSWXTDLIELGFQREDVLPILSIPLSHAGIDDRLVWHYTTNXI  959

Query  984   FTVKSCYK---------AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGC  850
             F+VK+ Y          A+       P  S      W+ IW++ +P + K FIW  C+  
Sbjct  960   FSVKTGYSLALKLMEEXALGRKGRGAPSESNNLNLVWNNIWSLQVPNKIKCFIWXCCNNA  1019

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     L+ R +    +C +C  + E+  H+   C F+   W    PL   S A   S++
Sbjct  1020  LAVXXNLKRRHMRIDNVCGVCNAINETENHLFFXCEFSHVFW-FCSPLHLNSHALEGSDF  1078

Query  669   I---------TKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVE---NSKA  526
             +          K   +    R   F    W +W+ RN+ ++K I      ++E    S +
Sbjct  1079  LXSWSNFXAQVKDXNNADDIRQE-FXFGLWRLWKNRNDVIFKGIYRQPLDILEAWRKSTS  1137

Query  525   LWRDWKACTEVDDQQR-----RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
              ++D  A  E D++ R     ++     TKW +P  G  K+N DAA   ++  MGLGW+ 
Sbjct  1138  EYKDCLAREEXDNRPRLPKXIKASXSXCTKWQKPRFGTIKINSDAAWCKDTMXMGLGWLG  1197

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSP  181
             R+  G+  +A         S   AEA AIR AL  C     + I +ESD+ +V+  L   
Sbjct  1198  RDFAGLLQAAGGIGSGFCXSXAAAEASAIRYALLACIEHGFNDIIIESDASLVIKMLKKE  1257

Query  180   AFVT-SFDLLLADIKDLLSTFCSLLYLF  100
               V  S + +L DI+ L+    ++ + F
Sbjct  1258  VLVDFSIECILGDIEVLVHKLRTVSFAF  1285



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   259 bits (661),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 155/514 (30%), Positives = 251/514 (49%), Gaps = 12/514 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSR G+EVL+KSV QA+P+Y M++F LP GL+ +I   +  FWWG+ DT  
Sbjct  778   KLQGWKEKLLSRPGKEVLIKSVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGSSDTNR  837

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WD LC PK  GG+GFR +  FN +LL+KQAWRL    ++L  ++++A+Y+ +S
Sbjct  838   K-MHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQARYFKSS  896

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  +A++G NPSF W S+  +K ++    +W +G+G  +R+W D W+       + TP  
Sbjct  897   ELLEARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGERIRVWEDAWILGEGAHMVPTPQA  956

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  L++     W+ E V+  F   + +L+LSIP+ +   +D   W     G+F
Sbjct  957   DSNLDLKVCDLIDVARGAWNIESVQQTFVEEEWELVLSIPLSRFLPDDHRYWWPSRNGIF  1016

Query  981   TVKSCY--------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +V+SCY        +   L         W  +W +  PP+   F+W+ C G L     L 
Sbjct  1017  SVRSCYWLGRLGPVRTWQLQHGERETELWRRVWQLQGPPKLSHFLWRACKGSLAVKGRLF  1076

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFE  652
              R I     C +C + +ES  H L +C+FA   W++  F  L   +   S SE +    +
Sbjct  1077  SRHISVDATCSVCGDPDESINHALFDCTFARAIWQVSGFASLMMNAPLSSFSERLEWLAK  1136

Query  651   SLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRS  472
                           W  W  RN+ +++N    A  V +    L  D+        +    
Sbjct  1137  HATKEEFRTMCSFMWAGWFCRNKLIFENELSDAPLVAKRFSKLVADYCEYAGSVFRGSGG  1196

Query  471   QHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKE  292
                    W  P  G FK+N DA L  N  ++GLG V+R + G              +   
Sbjct  1197  GCGSSALWSPPPTGMFKVNFDAHLSPNG-EVGLGVVIRANDGGIKMLGVKRVAARWTAVM  1255

Query  291   AEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             AEA+A   A+    R     I +E D+++V++ +
Sbjct  1256  AEAMAALFAVEVAHRLGFGRIVLEGDAMMVINAV  1289



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score =   258 bits (658),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 186/566 (33%), Positives = 272/566 (48%), Gaps = 51/566 (9%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SRI  W+ +FLS+AG+ VL+KSV+QA+P+Y+M  F LP  L++++   ++ FWW   D +
Sbjct  670   SRILHWHTKFLSKAGKMVLIKSVLQAIPAYSMQCFKLPASLIAELNGLLSSFWW---DDR  726

Query  1524  GK-GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
             GK  +   AWDKLC     GG+GFR +  FN ALL+KQ WR+   P+SL A+++K KYY 
Sbjct  727   GKPKMHLLAWDKLCRATVHGGLGFRNLAIFNKALLAKQCWRILMKPDSLLAQLLKGKYYR  786

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVN--NPRIT  1174
             N+ F  A  G +PSF W SLL  + ++    RW  G+G  + IW   WLP +    P   
Sbjct  787   NTSFLCASLGRSPSFTWRSLLTARELLVSGLRWCPGDGSQINIWSSPWLPRMGFFKPIYK  846

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
              P  P     S           W+  ++R +F   DA  ILSIP+  G   D++IW   +
Sbjct  847   RPELPPTLRVSDLINPGTR--DWNRSLIRHLFLPIDASSILSIPLGTGRHPDRLIWHFSK  904

Query  993   KGVFTVKSCYK-------------AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSG  853
              G ++VKS YK             A S D  S   A W  +W + LPP+   F W++C  
Sbjct  905   DGAYSVKSGYKRAWSTEHLRCPGPAHSSDTFS---AFWKQLWRIALPPKILLFAWRLCRN  961

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE  673
              LPT  LLR R +     C +C   EE+  H +A   +A   W     LP    + S S+
Sbjct  962   ILPTKALLRRRNVCRDSQCEVCDQEEENWHHAIATYPWAKLVWSNIH-LPWALLSASLSD  1020

Query  672   ---WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAV-VENSKALWRDWKA  505
                W+  CF +L        +I CW IW  RNE     + L A++  V ++ A    + A
Sbjct  1021  PLIWVHHCFRALTASDFRKMLIGCWAIWSKRNE-----VRLFARSPDVMSTVAFINTYLA  1075

Query  504   --CTEVDDQQRRSQHQ--YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
                T  D + +   H      +W  P  G FK+NVD+    N        ++R+  G   
Sbjct  1076  TSTTAFDPEPQPLPHSPTVTRRWEAPAHGTFKVNVDSGRAGN--HTVCAGIIRDDRG---  1130

Query  336   SAACNSWIGV-----LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-  175
                C  W        L P+  E LA +  L + +   +  + +ESD L +V  ++     
Sbjct  1131  --KCVGWFSKTSFPPLDPEHGEYLAAKSGLEFARFLGLQAVTLESDCLTLVSAVNENVMH  1188

Query  174   VTSFDLLLADIKDLLSTFCSLLYLFC  97
               S   +L DI  LL+TF +   +F 
Sbjct  1189  NASLFNILNDITALLATFDTYHVIFV  1214



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score =   258 bits (658),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 171/544 (31%), Positives = 281/544 (52%), Gaps = 25/544 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLKSVIQA+P+Y M ++  P  ++  I+  M  FWWG+ DTQ 
Sbjct  684   KLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSSDTQR  743

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK WD +C  K +GGMGF+ +  FN ALL +QAWRL   P+SL  ++MKAKY+PN 
Sbjct  744   K-IHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKYFPNC  802

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A  G + S+ W+S+  +K +++    WR+GNG  + +W D W+ D     +T+   
Sbjct  803   DFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLTST--  860

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P+ +   V+ L++     W   ++    N RD + IL+ P+   P  D++ W   +   +
Sbjct  861   PHASIRWVSELIDFDRMEWKTSLLESFLNERDLRCILASPLSATPVPDELTWAFTKDATY  920

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W  IW++ + P+ + F+W++C+  LP   LL+HR +   
Sbjct  921   SVKTAYMIGKGGNLDNFHQA-WVDIWSLDVSPKVRHFLWRLCTTSLPVRSLLKHRHLTDD  979

Query  804   PLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWITKCFESLQPPRA  631
              LCP      E+  H + +C      W     + L +   + S  + +   + SL     
Sbjct  980   DLCPWGCGEIETQRHAIFDCPKMRDLWLDSGCQNLCSRDASMSMCDLLVS-WRSLDGKLR  1038

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYIT-  454
                  + W IW  RN K++ N   P+  +++    L        E +    R  +Q +  
Sbjct  1039  IKGAYLAWCIWGERNAKIFNNKTTPSSVLMQRVSRL-------VEENGSHARRIYQPLVP  1091

Query  453   -------KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPK  295
                    +WI P     KLNVDA+L ++   +GL  + R   G    AA        +P+
Sbjct  1092  RRTGSPRQWIAPPADSIKLNVDASLAVDGW-VGLSVIARRSDGGVLFAAVRRVRAYWAPE  1150

Query  294   EAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLSTFC  118
              AEA A+  A+   +R  +  + +ESD  VV++ LS  A F++  DL+L +I    + F 
Sbjct  1151  IAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLDLVLFNILASCTYFS  1210

Query  117   SLLY  106
             S+++
Sbjct  1211  SVVW  1214



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   258 bits (659),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 172/548 (31%), Positives = 278/548 (51%), Gaps = 33/548 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLKSVIQA+P+Y M ++  P  ++  I+  M  FWWG+ DTQ 
Sbjct  779   KLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSSDTQR  838

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK WD +C  K +GGMGF+ +  FN ALL +QAWRL   P+SL  ++MKAKY+PN 
Sbjct  839   K-IHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKYFPNC  897

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A  G + S+ W+S+  +K +++    WR+GNG  + +W D W+ D     +T+   
Sbjct  898   DFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLTST--  955

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P+ +   V+ L++     W   ++    N RD + IL+ P+   P  D++ W   +   +
Sbjct  956   PHASIRWVSELIDFDRMEWKTSLLESFLNERDLRCILASPLSATPVPDELTWAFTKDATY  1015

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W  IW++ + P+ + F+W++C+  LP   LL+HR +   
Sbjct  1016  SVKTAYMIGKGGNLDNFHQA-WVDIWSLDVSPKVRHFLWRLCTTSLPVRSLLKHRHLTDD  1074

Query  804   PLCPLCLNVEESAFHILAECS------FATQCWRLFEPLPATSQAQSCSEWITKCFESLQ  643
              LCP      E+  H + +C         + C  L     + S       W      SL 
Sbjct  1075  DLCPWGCGEIETQRHAIFDCPKMRDLWLDSGCQNLCSRDASMSMCDLLVSW-----RSLD  1129

Query  642   PPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQ  463
                      + W IW  RN K++ N   P+  +++    L        E +    R  +Q
Sbjct  1130  GKLRIKGAYLAWCIWGERNAKIFNNKTTPSSVLMQRVSRL-------VEENGSHARRIYQ  1182

Query  462   YIT--------KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGV  307
              +         +WI P     KLNVDA+L ++   +GL  + R   G    AA       
Sbjct  1183  PLVPRRTGSPRQWIAPPADSIKLNVDASLAVDGW-VGLSVIARRSDGGVLFAAVRRVRAY  1241

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLL  130
              +P+ AEA A+  A+   +R  +  + +ESD  VV++ LS  A F++  DL+L +I    
Sbjct  1242  WAPEIAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLDLVLFNILASC  1301

Query  129   STFCSLLY  106
             + F S+++
Sbjct  1302  TYFSSVVW  1309



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score =   259 bits (662),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 156/473 (33%), Positives = 242/473 (51%), Gaps = 17/473 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W  + LSR G+EVL+K+V QA+P+Y M++F LP GL+ +I      FWWG+ D + 
Sbjct  984   KLTGWKEKLLSRPGKEVLIKAVAQAIPTYMMSIFRLPDGLIDEIHALFAKFWWGSNDVEK  1043

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W  W+ LC+PK  GGMGFR +K FN A+L+KQ WRLF +P SL  K+ KA+Y+ + 
Sbjct  1044  K-MHWHNWESLCLPKAMGGMGFRDLKCFNQAMLAKQCWRLFENPHSLLYKVFKARYFKHD  1102

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F  A +G +PS+ W S+   K ++    RWR+GNG+S+++W + WL D +  ++ TP  
Sbjct  1103  EFLTAHRGFDPSYSWRSIWGAKSLLLEGLRWRVGNGVSIKVWDEAWLADDDANKVPTPTA  1162

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQG-PREDKMIWVKDEKGV  985
                 +  V+ L+++    W++  VR+     DA  +L+IP+ +  PR+DK  W   + GV
Sbjct  1163  AAEPHILVSELIDHELGWWNEAKVREQMVEADADRVLNIPLSKFWPRDDKFWW-PSKTGV  1221

Query  984   FTVKSCY--------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
             + VKS Y        +A       + +  W  +W +  P + K F+W+ C G L   + L
Sbjct  1222  YEVKSGYWMGRLGKTRAWQWGAGLIEMDLWKHVWAIEGPNKLKHFVWRACKGSLAVKERL  1281

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITKCF  655
              +R I    LC +C  + E+  H L  C  A + WR   F      +   S +E      
Sbjct  1282  FYRHITPDNLCQICGGI-ETIIHSLFYCKHAVEMWRHSRFRDEIQAAPHDSFAELFRWMI  1340

Query  654   ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW--KACTEVDDQQ  481
               L      +F  + W  W  RN ++++        V      + RDW   A       +
Sbjct  1341  TMLSKEDLRIFSTLAWAAWTCRNHEIFELTPPSPSHVATGYCKMVRDWCEHAANTSCPGR  1400

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
              +S       W +P  GW K+NVDA +  N R +GLG V R+  G    AA  
Sbjct  1401  LQSGIPSSVGWHKPDVGWVKVNVDAYVGPN-RVVGLGAVFRDSAGTLLMAAAT  1452



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score =   258 bits (659),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 169/544 (31%), Positives = 265/544 (49%), Gaps = 30/544 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWW-GNGDT  1528
             ++I  W+ R LS+AGR VL+K+V+Q +P Y M+ FLLP+  +  +   +  FWW G+G  
Sbjct  1086  AKIMHWSSRMLSQAGRSVLIKAVLQVIPVYTMSCFLLPKSFLHKLMAAITRFWWSGSG--  1143

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
               K + W   ++L V    GG+ FR +  FN A+++KQ+WRL +HP S+ ++++KAKYYP
Sbjct  1144  -SKKMHWLPREELTVNLAAGGLSFRDLLLFNRAMVAKQSWRLLSHPNSICSRLIKAKYYP  1202

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
             +S F  A  G +PS+VW  +  ++ ++ G  RWRIGNGLSV  W D W+P+    + T+ 
Sbjct  1203  HSSFLMAPLGRSPSYVWRGIHSSREVLLGGLRWRIGNGLSVDAWKDPWIPNTFAFKPTSA  1262

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                 + +  V   + ++ SGW+   +R IF+  D + ILSIP+ +    D++IW     G
Sbjct  1263  APQGVGSILVKDFILSNHSGWNHTRLRQIFSPLDVKHILSIPLAKNSCPDRLIWHYTRHG  1322

Query  987   VFTVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
              ++VK+ Y+ +    D +  +S          W  +W + LP R  TF W+     LP  
Sbjct  1323  EYSVKTGYQLLKGREDMLRPSSSQVNHDCILMWRALWKLQLPTRILTFGWRFAKNILPLK  1382

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQS---CSEWI  667
             + L  RR+   P CP+C    ES +H    C F+   WRL   +P  S  +      +W+
Sbjct  1383  ENLVRRRVGTDPTCPVCEMDRESWYHAFLTCPFSQAVWRL-GGIPMDSVGREPLFPVDWL  1441

Query  666   TKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
                F+ L+  + S  ++  W IWR R +     + L         +       +      
Sbjct  1442  IARFQQLRAEQFSGLLVTLWCIWRHRMDHRHNQVTLDPLRTHHLIRYYVDSSGSAFSEQL  1501

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGV  307
                        +W  P  G+ KLN D+     S   GLG ++R+  G      C +W   
Sbjct  1502  DPPLLPPLLQQRWECPPVGFVKLNFDSGRCTPS-STGLGGLIRDDQG-----RCQAWFSY  1555

Query  306   -----LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADI  142
                  L P+  EALA R+ L          + VE D L V+  L+  A VT F  L   +
Sbjct  1556  QLDTELDPEAGEALAARKILELALAMGFTRVIVEGDCLTVLQALADQA-VTLFASLGNVL  1614

Query  141   KDLL  130
             +D L
Sbjct  1615  QDSL  1618



>ref|XP_009124085.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=578

 Score =   248 bits (633),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/523 (30%), Positives = 257/523 (49%), Gaps = 26/523 (5%)
 Frame = -2

Query  1629  ALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRR  1450
             ALP +AM+ F LP+ L + +   M  FWWG G    K + W AW +LC PK+ GGMGF+ 
Sbjct  2     ALPVFAMSCFRLPKDLCAKLTSIMTEFWWG-GTAGKKKISWVAWQRLCKPKELGGMGFKD  60

Query  1449  IKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGI  1270
             I   N ALL KQAWR++++P+SL A++MK++Y+    F D   G  PS+ W S++  + +
Sbjct  61    IAWCNQALLCKQAWRIWSNPQSLLARVMKSRYFRQGDFLDCSIGSRPSYAWRSIVHGREL  120

Query  1269  IQGNCRWRIGNGLSVRIWHDNW--LPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDE  1096
             +      RIGNG    +W+DNW  LP    PR  T           + + + HG+ WD +
Sbjct  121   LAQGILKRIGNGSETHVWYDNWLLLPTPRPPRYRTDEVDL-TLTVHDLIDSRHGT-WDAQ  178

Query  1095  VVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISL-----------  949
              +R +F   DA  IL + +    RED M+W   + G++  +S YK ++L           
Sbjct  179   KIRHLFVEEDASAILGMKL-NLQREDTMVWAFSKNGMYDSQSGYKLLNLIQTIERPMSAS  237

Query  948   DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEES  769
             +L  V    WS +W V + P+ + F+W+  +G L  ++ L  R I+    C +C +  E+
Sbjct  238   NLPPVERNLWSNLWKVKMLPKVRHFMWRALAGALAVSERLASRGINVETTCKVCQSQPET  297

Query  768   AFHILAECSFATQCWRLFE-PLPATSQAQSC-----SEWITKCFESLQPPRASL-FVIIC  610
               H+L  C  A + WRL   P+PA   + +         +  C +   P +  L F  + 
Sbjct  298   ICHVLFHCPVAKEVWRLSGFPIPAAGFSTNSVFLNFHHLLESCKKRHLPEKTRLVFPWVL  357

Query  609   WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC--TEVDDQQRRSQHQYITKWIRPM  436
             W +W++RN  V++N+   AK V E  +     W+A   T+ +D+ + +     + W +P 
Sbjct  358   WQLWKSRNRCVFENVVFGAKEVWERIQVEAEAWRAANVTDREDRDQDAAGDSTSTWQKPC  417

Query  435   QGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSW  256
               + K N+ ++    ++  G+ W+ RNH G   + +  S+  + S  EAE L    A   
Sbjct  418   PSFVKCNIGSSWVDGNQNCGVAWLTRNHAGAALAHSRRSYSHISSSLEAELLGFYWASES  477

Query  255   CKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLS  127
                   + +  ES S +    +  P     +  L+  I++ LS
Sbjct  478   VSTMRYEKVVFESTSYLAGEAILKPGNFPQWLSLIEAIREKLS  520



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score =   258 bits (658),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 162/522 (31%), Positives = 252/522 (48%), Gaps = 20/522 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  + LS+AG+EVL+K+V QA+P+Y M++F LP G    I + +  FWWG     
Sbjct  1062  NRVHGWEGKLLSKAGKEVLIKTVAQAIPNYTMSVFQLPAGTSDAINKCVARFWWGK--EG  1119

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             GKG+ W+ W  LC  KK GG+GFR +  FN ALL KQ WRL  +P+SL A+++KAKY+P 
Sbjct  1120  GKGIHWRRWSDLCFSKKDGGLGFRDLSLFNQALLGKQGWRLMMYPDSLVARMLKAKYFPW  1179

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A+ G +PS++W S L  + +++   RWRIG+G  VR++ D W+P + + R   P 
Sbjct  1180  DDFMEAELGSSPSYLWRSFLWGRELLRKGVRWRIGDGKEVRVFIDPWVPGLPSFR---PI  1236

Query  1164  FPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                 A   +      H + GW+ E +   F   + + I SI +    R D  +W   + G
Sbjct  1237  LRQGAPLFLRVSDLLHNNGGWNMEALNYWFTDDECEAISSITVGATRRPDVYMWNYCKNG  1296

Query  987   VFTVKSCY-------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
              +TVKS Y       +  ++++   P   W  +W + LPP+   F+W+   G +P  ++L
Sbjct  1297  RYTVKSGYWLACEENREEAINIVLAPRNFWKHLWKLKLPPKINHFLWRCSMGFIPCMEVL  1356

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCF  655
               + I  S  C  C    ES  H    CS     +    F    ++ Q  S    +   F
Sbjct  1357  LWKHIAHSASCFRCQQGRESPVHATWGCSCCVAVFERAGFYSKLSSGQFPSFIHLLHHAF  1416

Query  654   ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRR  475
              +L      LF ++ W  W  RN    K   +P+  + EN     + +K           
Sbjct  1417  STLDKEELQLFAVLLWLNWHERNNCYHKGAVVPSDIIYENGVKFLKCFKEALGCRAGVEV  1476

Query  474   SQHQY-----ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
                +      + +W  P  G  K+N D A +   R  G G ++R+  G    A   ++  
Sbjct  1477  KAVEEVVPGSLRRWQAPSSGQLKVNCDGAANFKDRCFGGGTIIRDEFGSLIVAGGKNFQH  1536

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
              +S   AE LAI+  L     + +  I VESD L  +H L+S
Sbjct  1537  PVSSLVAELLAIKVGLDLVVERRLRNIMVESDCLEAIHLLNS  1578



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   256 bits (654),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 168/544 (31%), Positives = 264/544 (49%), Gaps = 15/544 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSR G+E+L+KSV QA+P+Y M++F LP GL+ +I   +  FWWG+   + 
Sbjct  738   KLQGWKEKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDEIHAMLARFWWGSNGGER  797

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WD +C+PK  GG+GFR +  FN ALL+KQAWRL     +L +++++A+YY N 
Sbjct  798   K-MHWHSWDAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRDATLLSQVLQARYYKNV  856

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +F +A++G NPSF W S+  +K ++    +W +G+G  + +W + W+    +  + TP  
Sbjct  857   EFLEARRGYNPSFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGEGSHHVPTPRH  916

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L++ +  GW+ EVV+ +F   + + IL IP+ +   ED   W     GVF
Sbjct  917   DSNMELRVCDLIDVNRGGWNVEVVQQVFVEEEWRSILDIPLSRFWPEDHRYWWPSRNGVF  976

Query  981   TVKSCYKAISLDLDSV--------PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +V+SCY    L  D              W  +W +  PP+   FIW  C G L   + L 
Sbjct  977   SVRSCYWLGRLGHDRTWRLQHGEGETRLWKEVWRIGGPPKLGHFIWWACKGSLAVKESLA  1036

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFE  652
              R I  S +C +C    ES  H L ECSFA   W +  F  L   +   S +E      +
Sbjct  1037  RRHICESTVCAVCGASVESIHHALFECSFAKAIWEVSPFVALLNMAPTSSFAELFIWLRD  1096

Query  651   SLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRS  472
              L          + W  W  RN+ +++   + A  V  N   L  D+    +   +   +
Sbjct  1097  KLSSDDLRTVCSLAWASWYCRNKFIFEQQSVEASVVASNFVKLVDDYGLYAKKVLRGSTT  1156

Query  471   QHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKE  292
                    W RP  G  K N DA +  N  ++GLG V+R+  G                  
Sbjct  1157  MCTSEVSWQRPPAGLIKANFDAHVSPNG-EIGLGVVVRDSSGRIVVLGVRRMAASWDAST  1215

Query  291   AEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS--PAFVTSFDLLLADIKDLLSTFC  118
             AEA+A   A+   +R     + VE DSL+V+  L +  P     F+ +  DI  L  +F 
Sbjct  1216  AEAMAALFAVELAQRFGYGNVVVEGDSLMVISALKNKLPGGSPIFN-IFNDIGRLCVSFN  1274

Query  117   SLLY  106
             +  +
Sbjct  1275  AFSF  1278



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   254 bits (648),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 198/337 (59%), Gaps = 13/337 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++++W  + LS AG+E+L+K V QA+P Y M+ FLLP+ +  D+ + +  FWW N  T+ 
Sbjct  668   KLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWW-NSSTEN  726

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWD+LC PK+ GG+GFR +  FNLALL+KQ WRL  +P+SL  K++KAKY+P  
Sbjct  727   KKIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLITKVLKAKYFPTR  786

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +     + S VW SL E + +I    RW++G+G ++ IW D WLP  N+ RI  P  
Sbjct  787   SFLETAVSLHASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIFFPKP  846

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              + A   V+ L++     W+  +++++F   +  LI SIP+      D ++W  D+KG+F
Sbjct  847   EHSAITKVSDLIHGDSREWNVPLLQNVFFPEEVMLIRSIPLSLRLTPDMLVWHYDKKGMF  906

Query  981   TVKSCY-----------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             TVKS Y           +A S + D+V   +WS +W   +P R KTF W+V SG LPT  
Sbjct  907   TVKSAYHVARSVHSSTGRASSSNSDAVA-RNWSLLWKAIVPARVKTFWWRVISGILPTKA  965

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW  724
              L  +++     C LC    ES+ HIL +C FA   W
Sbjct  966   NLARKKVSLDEECMLCEGPVESSIHILCDCPFAICAW  1002



>ref|XP_010468701.1| PREDICTED: uncharacterized protein LOC104748809 [Camelina sativa]
Length=691

 Score =   249 bits (637),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 155/472 (33%), Positives = 242/472 (51%), Gaps = 24/472 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  +W+ +FLS AG+EVLLKSV  A+P YAM+ F LP GL+S++E  +  FWW   +   
Sbjct  205   RTANWSGKFLSPAGKEVLLKSVAAAMPVYAMSCFKLPLGLISELESILMNFWWKK-NASS  263

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AW +L   KK GG+GFR +  FN ALL+KQAWR+  +P SL AK+MKA+Y+P++
Sbjct  264   RGISWIAWKRLQYSKKEGGLGFRNLAKFNDALLAKQAWRIIQYPNSLFAKVMKARYFPDN  323

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                DA    N S+ W+S+L    +++   R  +G+G ++R+  DN + D + PR      
Sbjct  324   SVTDASAKKNQSYGWSSILVGLDLLKKGLRVAVGDGSTIRVNIDNVIAD-HPPRPICSMD  382

Query  1161  PYlanasvnsllnNHGS--GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
             P+    ++++ + +HGS   W++    +I    D   ++ I IPQ P  DK+IW  +  G
Sbjct  383   PH-TQCTLSAFIQSHGSVKSWNNHTAANILEPTDFDALMQIYIPQTPVMDKIIWHYNPSG  441

Query  987   VFTVKSCYKAISLD-LDSVP--------IASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             V+TV+S Y   + D  D  P        + S + IW + + P+ K F+W V S  L TA 
Sbjct  442   VYTVRSGYWLATHDPSDMTPAPNIPHGSVESKNQIWKLKILPKIKHFLWNVLSKSLGTAT  501

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              L  R +    +C  C   +E+  H L  C      W L   LP  +        +   +
Sbjct  502   RLVTRGVVIETICKRCKQSDETINHTLFTCPSLQTIWNLAN-LPLQNSFDITDHELNISY  560

Query  654   -------ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
                     SL   +  L   + WNIW+ RN  V+ N     +  +  +KA   +W    E
Sbjct  561   LLSLYKDSSLSLEQKLLPFWLIWNIWKGRNNFVFNNKEEDHQQTLSQAKADVSEWTRTLE  620

Query  495   VDDQQRRSQHQYIT--KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
             ++ ++       +T   W RP +   K N D +  + ++K   GW++RNH G
Sbjct  621   METRRMTISSHSVTNINWTRPAESMVKCNFDVSYTVGTKKTIGGWMVRNHLG  672



>ref|XP_010495244.1| PREDICTED: uncharacterized protein LOC104772312 [Camelina sativa]
Length=1200

 Score =   254 bits (650),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 172/559 (31%), Positives = 270/559 (48%), Gaps = 31/559 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R K WN++FLS  G+E+LLK++  A+P Y MN F +P+ +  +IER +  +WW N    
Sbjct  601   NRTKGWNNKFLSHRGKEILLKAIALAMPVYTMNCFKIPKWICEEIERIIANYWW-NTQQN  659

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             G  + W AWD+L   KK GG+GFR I+ FN ALL+KQAWR+  HP SL ++I+K +Y+ +
Sbjct  660   GNAVHWVAWDRLKYMKKEGGLGFRDIEQFNEALLAKQAWRILQHPNSLMSRILKGRYFSD  719

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   DA +G  PSF W SLL  + +++   R+ +G+  S++ W D WLP V+ PR   PP
Sbjct  720   SNILDATRGTQPSFGWQSLLVGRDLLKKGLRFTVGDETSIKTWTDPWLP-VHPPR---PP  775

Query  1164  FPYlanasvnsllnN----HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
                      +S +N     + S W++ +VRD     D   IL I       +D + W   
Sbjct  776   RLAKNIQGDSSTVNTLFLPNRSSWNESLVRDKVYLDDVNHILLIKKSHWQNQDYLGWHYT  835

Query  996   EKGVFTVKSCY-KAISLDLDSVPIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPT  841
             E G++ VKS Y  A  L      +          + IW   LPP+ K F+W++    L T
Sbjct  836   ENGIYPVKSGYWLATHLPEQEFQVRPPYGNPQLKTDIWKTKLPPKFKHFLWRMSFRTLAT  895

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWIT  664
              D L  R I  +P C  C++V E+  H+   C  A Q WR    P+ +        E   
Sbjct  896   GDELERRHISTNPFCKRCVHVVETTEHLFFTCPNAMQIWRCSNIPIRSLLNPNEHLEDKL  955

Query  663   KCFESLQPPRA-----SLFVI-ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
             K        R+     SL    I W IW +RN+ +++ I    + ++  +K    +W A 
Sbjct  956   KAILEFYKQRSHYDRLSLLPFWILWKIWTSRNKLIFQKINHTWQRLLREAKQETDEWLAI  1015

Query  501   ----TEVDDQ---QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
                 + V+ Q      S  +  + W +P  GW K N D +     R+   GW++R+  G 
Sbjct  1016  IPPPSRVNPQVPCSTISSKRNSSNWQKPPYGWVKCNYDGSFLDEDRQATSGWIVRDDQGH  1075

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
             F  A   +   V S  EAE  ++  A+    R     +  E D   +V  +++ +     
Sbjct  1076  FKEAGQVTGAKVKSAFEAECQSLIFAMQQTWRNGYTNVIFEGDCQSLVTAINNSSLCFDI  1135

Query  162   DLLLADIKDLLSTFCSLLY  106
                + +IK   + F ++++
Sbjct  1136  YNWIQEIKGWATRFNNVVF  1154



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score =   256 bits (655),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 175/563 (31%), Positives = 264/563 (47%), Gaps = 59/563 (10%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              RI  W  +FLS AG+EVL+KSV  ALP Y M+ F LP  L  +IE+ +  FWW +  T+
Sbjct  1168  ERINGWAEQFLSMAGKEVLIKSVAAALPXYTMSCFQLPIHLAKEIEQVIARFWWRDQRTK  1227

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W  W+K+   K +GG+GFR I DFNLA+L+K  WRL ++  S  A++++AKYYP+
Sbjct  1228  -KGIHWMTWNKVAXKKVYGGLGFREIIDFNLAMLAKVGWRLISNXGSJLARVLQAKYYPS  1286

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F DA  G   S+ W  +L+ + I++   RWR+G+   ++I  D WLP    PR   P 
Sbjct  1287  SSFLDAPVGXGTSWGWKGILQGRKILKAGVRWRVGDXTCIQIGKDPWLP---IPRTFRPT  1343

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +       + L +    W  EV+   F+  +A+ ILS+PI +    D+++W     GV
Sbjct  1344  SRHEEMPIFVADLVDMEGMWKREVIELCFSEDEAKTILSMPISRFGCPDRVVWHYTRNGV  1403

Query  984   FTVKSCY-------KAISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VKS Y       K   L    V  +S        W  IW++ +PP+   F W+ C   
Sbjct  1404  YSVKSGYIVAQEMNKNXELGRKGVGQSSVDDNRDMVWRDIWSLKVPPKLCHFXWKGCKNI  1463

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     L+ R +     CP C N  E+ +              L+       +A     W
Sbjct  1464  LAXXMNLQRRGVRLDINCPFCDNEVETQW--------------LYAKYSKEGEASDLLXW  1509

Query  669   ITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
                                 W +W+ RN  V++ + +     +   K  W +W    E  
Sbjct  1510  XVGGL---------------WRLWKCRNSLVFEKVAVDPLTAIHLLKQQWEEWVISDEAQ  1554

Query  489   DQQRRSQHQYIT-----KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
              Q   S+ Q +      +WI+P  G  K+N D A    +   G+GWV R+  GIF+ A  
Sbjct  1555  VQP-LSRGQLVRAPXPHQWIKPPFGTLKVNCDGAWCSRTXIGGVGWVARDFVGIFNGAGG  1613

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVH---GLSSPAFVTSFDLL  154
                +  +S   AEA A+R AL  C  +    I +E+DS V+V    G   P  +   D +
Sbjct  1614  XGNMQCVSSIMAEAEALRVALVACVAKGFTXIQLETDSQVLVDMIXGRIQPEVI--LDGI  1671

Query  153   LADIKDLLSTFCSLLYLFC*TFC  85
             L DI  L   F ++ +L+    C
Sbjct  1672  LWDISILKQQFVAIEFLYTPRAC  1694



>ref|XP_009140270.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=866

 Score =   252 bits (643),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 168/551 (30%), Positives = 274/551 (50%), Gaps = 22/551 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             ++ + W ++FLS  G+EVL+KSV  A   Y MN F LP+ +  +I   +  FWWG  D  
Sbjct  274   TKTQGWQNKFLSPGGKEVLIKSVASATSVYPMNTFKLPKSVCEEINNILATFWWGKDDG-  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W AW+++ +PKK GGMGFR I+ FN ALL KQAWR+   P SL A++MK +Y+P+
Sbjct  333   SKGMHWFAWNRMSLPKKEGGMGFRDIEKFNDALLGKQAWRILTKPNSLMARVMKGRYFPS  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +A++    S++W S+L  K ++    R  IGNG ++  W D WLP  N PR   P 
Sbjct  393   TSILNARETRQNSYIWRSILHGKDLLTKGVRCVIGNGNTIDTWTDPWLP-TNPPRAPVPI  451

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
             F    N+ V+  ++     W++E++R+  N  DA+ IL+I +     +D+++W  ++ G 
Sbjct  452   FDQHGNSKVSDFMHRGLKEWNEELIRNTMNQADAEEILAIKLCSSDEDDQLVWHYNKTGD  511

Query  984   FTVKSCY---KAISLDLDSVPIASWST----IWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +TVKS Y        +   +P    +     IW ++  P+ K F+W++ +  LP    L+
Sbjct  512   YTVKSGYWLATHTPNNQQVIPPPGDTQLKQLIWKLNTAPKVKQFMWKMITLSLPLGKNLQ  571

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSE----WITK  661
              R I  S  CP C   EE+A H+  +C  A   WR    P     ++Q   E     +  
Sbjct  572   RRHITNSVKCPHCYQ-EETADHLFFDCINAQCIWRASGYPNSGLLRSQVTLEAKLSLLLN  630

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD--  487
                ++      L   I W IW+ RN+ +++      + +++ +    ++W    +  +  
Sbjct  631   QDATIPDHLKQLPWWILWRIWKDRNKMIFQQKLTHWRYLLQAAYQDTKEWMEAQQFTEEV  690

Query  486   ---QQRRSQHQYITKWIRPMQGWFKLNVDAAL-DINSRKMGLGWVLRNHHGIFHSAACNS  319
                Q RRS +    +W RP  G+ K N D +  +IN+     GW++R+  G+F  A    
Sbjct  691   QPGQPRRSPNSKRNEWKRPEMGFVKCNYDGSFYNINTPAQA-GWLIRDSTGLFKGAGQFK  749

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIK  139
                  +  E+E  A+  A+  C  Q    +  E D++ V++ L       +    L DI 
Sbjct  750   TRKPHNALESELQALLGAMMICWSQGYTKVIFEGDNINVINLLKKRTKNINVVNWLRDIW  809

Query  138   DLLSTFCSLLY  106
                  F SL Y
Sbjct  810   KWEQKFESLQY  820



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   255 bits (651),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 177/524 (34%), Positives = 267/524 (51%), Gaps = 27/524 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
               ++++ W    LS+AG+E+++K+VIQA+P+Y M+LF  P  L SD +  +  FWWG   
Sbjct  692   ILAKVQGWKQYTLSQAGKEIMIKAVIQAIPAYPMHLFKFPTTLCSDFDALIAEFWWGKSG  751

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              Q KG+ W +   L  PK+  GMGFR  + FN ALL+KQ WRL + P SL A+++KA+Y+
Sbjct  752   GQ-KGIHWVSRGILGYPKQEEGMGFRNFQAFNDALLAKQCWRLIHDPNSLWAQLLKARYF  810

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             P+  F D   GG  S+ W+SLL  + I+     W+I NG S+R+WHD W+P +   + T 
Sbjct  811   PHCSFLDDSLGGRASWGWSSLLVGREILLRGAHWQIMNGRSIRLWHDRWVPSIPAGKPTA  870

Query  1170  PPFPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  ++     + L N  SG W+ E +R   +  D + IL   I  G R+D++IW    
Sbjct  871   VGGVRVSRNMRVNTLINDVSGTWNIEAIRPFISLEDFEAILDTSIGDGLRDDRLIWPATR  930

Query  993   KGVFTVKSCY---KAISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
              GV++VKS Y    A S  +   P AS        W  IW++  PP+ + F+W+  S  L
Sbjct  931   NGVYSVKSGYHWKHANSSSMIGRPSASSSVIPGNVWKCIWHLKTPPKVRNFMWRALSRAL  990

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLP---ATSQAQSCS  676
              T + L  RR   SP CP+CL  +ES  H+L  C +    W    PL      +   +  
Sbjct  991   ATMENLFKRRCSPSPCCPICLVQDESVEHMLLLCLWVEPIW-FGGPLNYRVNRANILNFP  1049

Query  675   EWITKCFESLQPPRASLFVII------CWNIWRARNEKVWKNICL-PAKAVVENSKAL--  523
              W+     S    +  +  I+      CW IW+ R   V+ N  + P + ++  SK++  
Sbjct  1050  AWVLSSLGSDLGSKDEIARILMNVAFTCWFIWKTRCSFVYDNRGIYPNQVILSISKSVNG  1109

Query  522   WRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
             + +    +E   Q+  S+      W  P   + K+NVDA+ + +S+    G V+R+H G 
Sbjct  1110  FLEASVASEGHPQRNLSRPDPPACWGPPGHPFLKVNVDASWEASSKSGFAGVVIRDHAGK  1169

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDS  211
             F  AA   WIG  +   AEA AI       K   +  I VESDS
Sbjct  1170  F-VAARRGWIGASNVAAAEAAAILLGCELAKALELACIIVESDS  1212



>gb|EAZ40645.1| hypothetical protein OsJ_25114 [Oryza sativa Japonica Group]
Length=560

 Score =   246 bits (627),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 170/556 (31%), Positives = 271/556 (49%), Gaps = 31/556 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSR G+EVL+K+V QA+P++AM  F L + +   I + +  +WW N + + 
Sbjct  14    RIQGWKEK-LSRTGKEVLIKAVAQAIPTFAMGCFDLTKDICEQISKMIARYWWSNQEKEN  72

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL  PK  GG+GFR I  FNLA+L+KQ WRL  +PESL A+++KAKYYP+ 
Sbjct  73    K-MHWLSWEKLTEPKWAGGLGFRDIHAFNLAMLAKQGWRLIQNPESLCAQVLKAKYYPSG  131

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F AKK  N S+ W S+      ++    WR+GNG ++ IW D W+P  +  R  TP  
Sbjct  132   NIFSAKKCANMSYTWRSICRGLLTLRDGMIWRVGNGAAINIWSDPWIPSDHTRRPITPRG  191

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +  + GS WD E++   F   D  +I +IP+     +D + W  DEKG+F
Sbjct  192   RNLVTRVEELIDPSTGS-WDVELLTQTFWPEDVNMIRTIPV-HIEMDDMLAWHYDEKGLF  249

Query  981   TVKSCYKAISLDLD-------SVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             +VKS YK +  D +       S  +++        W  +W + LP + K FIW+     L
Sbjct  250   SVKSAYK-VQRDGELQRRKRGSAGLSNGSTEREMYWKKVWKMQLPGKVKHFIWRFSHNIL  308

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPL-PATSQAQSCS  676
                  L+ R +D    C +C  + E A H+  +C    + W+    E L    ++ +S  
Sbjct  309   ALRVNLQQRGMDLDSRCIICNRMNEDAGHLFFKCKKVKKVWQENNLEILRQELAEKRSGR  368

Query  675   EWITKCFESLQPPRASLFV-IICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
             E +   F   +P +  L   I  W  W  RN             +     AL  ++    
Sbjct  369   EVMETVFN--RPAKEILLASITLWQWWSERNRVQEGERGRSPSELGFIIAALAEEYMKLN  426

Query  498   EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
             + D ++  S+++   KW R  QG  K+N D A D  +R  G G+ +R+H G    +    
Sbjct  427   KKDSKRAPSRNE---KWSRTDQGVMKINTDGAFDPFTRTGGWGFAIRDHSGKVVKSGAGK  483

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADI  142
                +++   AEALA    +       +  +  E+DS ++   L    F +S    ++ +I
Sbjct  484   VQILMNAFHAEALACAAGIRAASECGMQRVTAETDSTMLKSALEKNTFASSALGGIICEI  543

Query  141   KDLLS-TFCSLLYLFC  97
             K+ ++  F S    +C
Sbjct  544   KNFVNFAFLSFNVSYC  559



>gb|EEC83784.1| hypothetical protein OsI_29682 [Oryza sativa Indica Group]
Length=666

 Score =   248 bits (634),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 162/522 (31%), Positives = 254/522 (49%), Gaps = 39/522 (7%)
 Frame = -2

Query  1677  FLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAW  1498
              LS+ G+EV++K++ QA+P Y M +F LP G+  ++ + +  FWWG+ D   + + WKAW
Sbjct  137   ILSQGGKEVMIKAIAQAIPVYVMGVFKLPDGVCEELTKIIRNFWWGS-DNGKRKVHWKAW  195

Query  1497  DKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKG  1318
              +L   K  GG+GFR +K FN ALL++QAWRL ++P SL A+++KAKYYPN    D    
Sbjct  196   SQLTKSKNAGGLGFRDMKAFNQALLARQAWRLIDNPVSLCARVLKAKYYPNGCLMDTVFS  255

Query  1317  GNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasv  1138
             GN S  W ++     +++    WRIGNG  VRIW D W+P  +  ++ T           
Sbjct  256   GNASPTWRAIEHGLELLKEGLVWRIGNGTRVRIWRDPWIPRSSTRKVITS--QGRCRIKW  313

Query  1137  nsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYK-  961
              + L +  + W++++VR IF   DA  ILSI   +   +D + W  ++ G+FTVK+ Y+ 
Sbjct  314   VADLLDANTNWNEQLVRQIFLPMDADAILSIRTSRQGEDDFLAWHLEKSGIFTVKTAYRL  373

Query  960   AISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRI  814
             AI   L+S    +           W+TIW+  +PP+ + F W+V S CL T    + RR+
Sbjct  374   AIENKLNSKNSNASGSSIEGSKSLWNTIWSCPVPPKVRIFAWRVASDCLATRVNKKGRRL  433

Query  813   DCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPL----PATSQAQSCSEWITKCFESL  646
             +    C LC    E+AFH L  C++A   W     +      T+     ++W+      L
Sbjct  434   EALDTCTLCGTESETAFHALCRCTYARALWAALREVWQIPDQTTWTYQGTKWLLLTLVKL  493

Query  645   QPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQH  466
                     +++ W IW  RNE V      P    +E SK     +     VD      QH
Sbjct  494   SEMERMFILMLLWRIWHVRNEVVHDKRHAP----IEVSKRFLVSY-----VDSLLGIRQH  544

Query  465   QYITKWIRPMQGWFKLNV---------DAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                TK I   +G     +         +    + S + G+G +LRN  G        +  
Sbjct  545   P--TKDIHKGKGVICYQLPNSSRQGGSERQTRLGSGQAGIGMILRNSEGEAIFTGRQAIA  602

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLS  187
               +   E+E LA +  L+      I  I +E+DS++ V  ++
Sbjct  603   NCVDALESELLACKFGLALALHWSILPIILETDSILAVSAIN  644



>ref|XP_010667928.1| PREDICTED: uncharacterized protein LOC104884923 [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score =   251 bits (641),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/536 (30%), Positives = 269/536 (50%), Gaps = 43/536 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+ VLLK+VIQA+P+Y M ++  P  ++  I+  M  FWWG+ D + 
Sbjct  292   KLQGWKEKLLSRAGKAVLLKAVIQAIPTYLMGVYKFPAVIIQKIQAAMVRFWWGSSDAKR  351

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK W+ +C  K  GGMGF+ +  FN ALL +QAWRL   P SL  ++MKAKY+P+ 
Sbjct  352   K-IHWKNWEAMCTLKCLGGMGFKDLAVFNDALLGRQAWRLLTVPHSLLGRVMKAKYFPSC  410

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G + S+ W S+   K +++    WR+GNG+ + IW   W+ D +   I++P  
Sbjct  411   DFLDASLGYSCSYSWRSIWSAKALVKEGLIWRVGNGVDINIWEAPWVGDEHGKYISSPRQ  470

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P     +VN L++   + W  +++ ++FN RD + IL+IP+   P  D + W   + G++
Sbjct  471   P--ELLTVNQLIDPSSTEWRLDIIEEVFNDRDKKCILAIPLCPTPSHDVLTWSLSKDGIY  528

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W  +W++ + P+ + FIW++C+  LPT  LL  R +  +
Sbjct  529   SVKTTYMLGKGCNLDNFHNA-WVDLWSLDVSPKVRHFIWKMCTVILPTQALLFKRHLIDT  587

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW--ITKCFESLQPPRA  631
               CP     +E+  H + +CS   + W        T     C+    + + ++SL     
Sbjct  588   MACPWGCGEDETDRHAIFQCSRFAEIWDE-SGCSLTRDDNGCATMCDVVEKWKSLDKKMM  646

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITK  451
                  + W IW  RN K++     P   ++E +  L  ++     V              
Sbjct  647   IKGAFLMWCIWGERNNKIFNGKTTPNHLLLERALRLAEEYGKYAAV--------------  692

Query  450   WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIR  271
                  +GW               +GLG + R+H  +    A        SP+ AEA AI 
Sbjct  693   -----EGW---------------VGLGVIARDHLSVVRFVALQRVRAFWSPEIAEAKAIE  732

Query  270   EALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFVTSFDLLLADIKDLLSTFCSLLY  106
               +   K   + ++ VESD   V++ L  +  F++  D++L++I    + F SL++
Sbjct  733   MGVRLGKHFGLQHVVVESDCQTVINRLRKTSLFLSDLDIILSNIFSTSTCFRSLVW  788



>ref|XP_007210228.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
 gb|EMJ11427.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
Length=787

 Score =   250 bits (639),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 221/410 (54%), Gaps = 26/410 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W  + LS AG+E+LLK V QA+P Y MN FL+P+ L  +I++ M  +WWG  D Q 
Sbjct  370   KIQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCDEIQQVMAHYWWGEQDGQR  429

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK+ GG+GFR +  FN+ALL+KQ WRL   P SL A+I+KA+Y+ N 
Sbjct  430   K-IHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVARILKARYFKNC  488

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A+ G +PS++W SL + + +I+   RWRIGNG SVRIW D WLP+  + ++++P  
Sbjct  489   SILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSPQA  548

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                  A VNSL+N     W + +++  F++ +   I +IP+      D +IW  +  G +
Sbjct  549   EGFDEAKVNSLINPVTVQWKENLLQAWFSAEEVNCIRNIPLSFRHPPDILIWHFERDGQY  608

Query  981   TVKSCYKAI----------SLDLDSVPIAS----WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TV+S ++              +++  PI +    W  IW   +PP+   FIW+     LP
Sbjct  609   TVRSGHEVARRVLLRQDGDDTNMNGGPIVACEQVWKKIWKARVPPKVLIFIWRALLNILP  668

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPA-----TSQAQSC  679
             T D L HR I     C  C   EE+  H+L  C  A   W LF   PA     T   +  
Sbjct  669   TKDNLIHRSISELGGCVFC-GAEETVAHVLLRCPMAIASWSLF---PAWAHFNTDATEEF  724

Query  678   SEWITKCFESLQPPRASLFVIIC-WNIWRARNEKVWKNICLPAKAVVENS  532
               W  + F +  P      V++C W +W  RN+  W      A  +V  +
Sbjct  725   KMWF-QGFVADHPLHVLEKVMVCLWMLWYERNQMAWAGRQRSATEIVSGA  773



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   255 bits (652),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 163/546 (30%), Positives = 261/546 (48%), Gaps = 29/546 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQ+LP+Y M ++  P  ++ +I   M  FWWG G    
Sbjct  970   KLRGWKEKLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQEIHSAMARFWWG-GKGME  1028

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K+  PK  GGMGF+ +  FN ALL +Q WRL ++  SL ++++ AKYYP+ 
Sbjct  1029  RKMHWVSWEKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYKNSLLSRVLSAKYYPDG  1088

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A+ G + SF W S+   K ++Q    WR+G G ++ IW D W+ D     I +   
Sbjct  1089  DVLQARLGFSNSFSWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDERGRFILSNRA  1148

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L   S           W  E +   F  RD Q ILSIP+     ED + W   + G++
Sbjct  1149  EGLNTVSDLIDDTT--KEWKFEAIEQHFGERDQQCILSIPLSSRETEDVLTWAYSKDGLY  1206

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +L+    A W  +W + + P+ + F+W+ C+  LPT   L  R +   
Sbjct  1207  SVKTAYMIGKGGNLEDFHKA-WVVLWGLDVSPKVRHFLWRYCTSSLPTRATLMARHLLEE  1265

Query  804   PLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWITKCFESLQPPRA  631
               CP C +  E++ H +  C+   + W     E +    + +   E + + + +L     
Sbjct  1266  GGCPWCPSELETSQHAIFSCARIRRLWVDHGCEAMVGDGRVEGGCEMLER-WNALDKKMV  1324

Query  630   SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQY---  460
                  + WNIW  RN  V++N C P   + +         +   +VDD    +   Y   
Sbjct  1325  QKGCFLAWNIWAERNRFVFENTCQPLSIISQ---------RVSRQVDDHNEYTTRIYGQP  1375

Query  459   -------ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
                     + W  P +G  KLN DA ++ N   + +  V RN  G    AA         
Sbjct  1376  ACVRPVSSSHWCAPPEGVIKLNTDAHIEGNGW-VSVATVARNTCGQVLFAAVRRQRAYWP  1434

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDLLST  124
             P  AE  AI  A+   K + +  + VESD+LVV+  LS  A F +  D ++ D+  L   
Sbjct  1435  PDIAECKAILFAVRMAKARGLQNVMVESDALVVISRLSKAALFYSDLDAIMGDVFSLSVY  1494

Query  123   FCSLLY  106
             F ++ +
Sbjct  1495  FNAISF  1500



>ref|XP_010681977.1| PREDICTED: uncharacterized protein LOC104896888 [Beta vulgaris 
subsp. vulgaris]
Length=1131

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 168/549 (31%), Positives = 279/549 (51%), Gaps = 35/549 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+E+LLKSVIQA+P+Y M ++  P  +   ++  M  FWWG  D++ 
Sbjct  555   KLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKFPVSITQKLQSAMAKFWWGGSDSRR  614

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK+WD +C  K  GGMGF+ +K FN ALL +QAWRL   P SL  ++MKAKY+PNS
Sbjct  615   K-VHWKSWDSMCNLKCLGGMGFKDLKIFNDALLGRQAWRLIREPTSLFGRVMKAKYFPNS  673

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A  G + SF W+S+  +K +I+    WR+GNG ++ +W+D W+ D     +T+ P 
Sbjct  674   DFLNAPLGHSGSFSWSSIWSSKALIKEGVLWRVGNGSNINMWNDPWVLDEEGRFLTSTP-  732

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V+ L++     W  +V+    N RD + +L+ P+   P  D++ W   +   +
Sbjct  733   -NGNFELVSELIDFDSMEWKIDVLETFLNPRDIRCVLATPLSSIPVADELTWAFTKDANY  791

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+   A W  IW++ + P+ + F+W++C+  LP   LL++R +   
Sbjct  792   SVKTGYMLGKGGNLDNFHQA-WVDIWSLDVSPKVRHFLWRLCTSSLPVRSLLKYRHMAVD  850

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESLQPPRASL  625
              LC       E+  H + +C      W             S S     C      P   L
Sbjct  851   DLCRWGCGEIETQGHAIFDCPRMAPLW-------------SDSGCHGLCSSDASLPMKDL  897

Query  624   FV--------------IICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA-CTEVD  490
              V               + W IW  RN KV+ N   P   +++  + L ++  +  ++V 
Sbjct  898   LVSWRGLDNSLRVKGAYLAWCIWGERNAKVFSNKTTPHHVLLQRVERLVQENGSYASKVY  957

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
             +   +       +W+ P +G  KLNVDA L +    +G+  + R   G    AA      
Sbjct  958   NSPLQGSIPSPRQWVAPPEGTIKLNVDACLAVEGW-IGMSVIARKCDGGVLFAAVRRVRA  1016

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-FVTSFDLLLADIKDL  133
               +P+ AEA A+  A+   +R  +  + +ESD  VV+  LS  + F++  DL+L++I   
Sbjct  1017  FWTPEIAEAKAVELAVKLGRRYGLQEVILESDCQVVIKRLSKNSIFLSDLDLVLSNILAS  1076

Query  132   LSTFCSLLY  106
              ++F S+++
Sbjct  1077  CTSFSSIVW  1085



>ref|XP_008234850.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=1009

 Score =   252 bits (644),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 179/567 (32%), Positives = 270/567 (48%), Gaps = 32/567 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              ++  W  +FLS AG+EVL+K+V  A+P Y M+ F LP  L  +IE  M  FWW    T 
Sbjct  406   GKLHGWAEQFLSPAGKEVLIKAVAMAMPCYTMSCFKLPVTLCKEIEAAMARFWW-KSHTD  464

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W +W KL   KK GG+GFR ++ FN+ALL+K  WR+  +P SL A ++  KY+  
Sbjct  465   KNGIHWASWTKLSQLKKAGGLGFRDLQCFNMALLAKIGWRILLNPSSLLACLLHDKYFVG  524

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             + F  A    + S+ W  +L  + +++   RWRIG+G +V++ +D WLP     R  +  
Sbjct  525   ASFLTATSQKSSSWGWKGILLGRRLLESGLRWRIGDGTTVQVRNDPWLPTPYTFRTLSRH  584

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                 +              W  +V+   F   +A  ILSIPI +    DK+IW     G 
Sbjct  585   LDLPSMVHELIDPLL--KTWKKDVINRCFVPEEASHILSIPINRWGCPDKLIWHFSMHGR  642

Query  984   FTVKSCYK-AISLDLDS--------------VPIASWSTIWNVHLPPRAKTFIWQVCSGC  850
             +TV+S Y+ A+ L  +                  A W ++W+V  PP+ K FIW+ CS  
Sbjct  643   YTVRSGYELALHLQRNGELGRKGAGEASSSSSQSAVWKSVWHVDAPPKLKAFIWRGCSNF  702

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     LR RR+ C+  C  C   +E+  HI  EC FA   W    PL       +  ++
Sbjct  703   LAVRHNLRRRRVPCTGECGFCGFQDETQAHIFFECDFARAFW-FASPLQLDVSKLAGDDF  761

Query  669   ITKCFESLQPPRASL--------FVIICWNIWRARNEKVWKNI-CLPAKAVVENSKAL--  523
             I+     +    +S         FV   W IW+ARN  V+  +   P +AV+   K +  
Sbjct  762   ISTWQHMMTTLNSSEHAAEAIQWFVFGLWRIWKARNLAVFDGVQADPIEAVLLLLKQVSE  821

Query  522   WRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
             +R  K   +    Q  S    ++ W +P  G  K+N DAA        G+GWV+R+  G+
Sbjct  822   FRTAKQDLQPQALQPVSSPAPLS-WCKPPPGLLKVNCDAAWSAQRLGGGVGWVIRDSFGL  880

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-  166
                A     +   S    E LAIR ALS C   H+  I VESDS   +  L+    V S 
Sbjct  881   LLCAGGQGDLHGSSALMMELLAIRHALSECANFHLTDIIVESDSQKGIFMLNGRVSVDSD  940

Query  165   FDLLLADIKDLLSTFCSLLYLFC*TFC  85
              + ++ DI+ L+++   + ++F    C
Sbjct  941   LEGIVFDIRQLVASLSRVSFVFAPRSC  967



>ref|XP_008244613.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=930

 Score =   251 bits (641),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 171/557 (31%), Positives = 272/557 (49%), Gaps = 27/557 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I  W    LS AG+EV LK V  A+P++ M  F  P+G  + I   +  FWWGN + + 
Sbjct  322   KIDGWKLNSLSLAGKEVPLKVVATAVPAFPMTCFRFPEGTCNQINSDLASFWWGNNE-ES  380

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
              G+ WK+W KLC+ KK GG+GFR + +FNLAL++KQ+WR+  +PE+   KI+KA+Y+P +
Sbjct  381   AGIHWKSWKKLCLAKKVGGLGFRDLSNFNLALIAKQSWRIILNPEAAWVKILKARYFPTT  440

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDV-NNPRITTPP  1165
              F +A KG  PS+ W S LE +  +    R++I +G +  IW+D W+P   + P  T  P
Sbjct  441   DFLNATKGSRPSWAWVSFLEGRKAMMKEARFQIFSGANTNIWNDVWIPSCESGPVKTLQP  500

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P  A   V  L++     W  + +    N+   Q I  IPI    R D+++W  +  G 
Sbjct  501   IPPQAPQLVQELMDKQNHTWKLDSISTFINNDILQSIRCIPIGHSSRPDRLVWPWNSSGS  560

Query  984   FTVKSCYKAI----SLDLDS-------VPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             +TVKS Y       + D+ S       V    W TIW V   P+ K F+W+  SG + T 
Sbjct  561   YTVKSGYHRFHARQNTDIASHNHSSHFVSEGVWKTIWKVETLPKIKLFLWRALSGYISTR  620

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWIT  664
               L  R+I   P+CP+C   EES  HIL  C +    W            +  +   WI 
Sbjct  621   LALFKRKIATDPICPICEGFEESVEHILFLCPWTQLVWFGSNLSYKVDPRRISTFDRWIE  680

Query  663   KCFESLQPPRA------SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA-  505
                      R       S    +CW IW+AR + V+  +    + V+ +++    ++ A 
Sbjct  681   GIISIPGTSRTDGDFLLSFLSFLCWEIWKARCKFVFNGVSPDPRLVITHARDACSEYLAV  740

Query  504   CTEVDDQQRRS--QHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
              ++VD +   S   H   T+W +P   + K N+D +    + K  +G V RN  G +   
Sbjct  741   VSKVDARGNLSPVHHVQGTRWSKPGPNYVKFNLDGSWLPGTMKGSIGIVSRNSSGDWCGG  800

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL--  157
               +    V S     A A+        R ++  I +E+D  V++ G+S      S+ +  
Sbjct  801   LASPLSCVSSLSAEAAAALCALHLAKNRGNMKVI-LETDCKVLLDGISGNHDNNSWAILP  859

Query  156   LLADIKDLLSTFCSLLY  106
             L+ +I D++S+F  +++
Sbjct  860   LIDEIHDVVSSFEEVIW  876



>ref|XP_010054717.1| PREDICTED: uncharacterized protein LOC104443052 [Eucalyptus grandis]
Length=916

 Score =   251 bits (641),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/411 (34%), Positives = 218/411 (53%), Gaps = 18/411 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++SW  + LS+AG+EVLLK+VIQALP YAM++F L   +   IE+ +  FWW   + + 
Sbjct  356   KLESWKEKLLSKAGKEVLLKTVIQALPQYAMSVFKLSVSICKAIEQKIASFWWKTNEKK-  414

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ WK WD L + K  GGMGFR +  FN A+L KQAWRL   P SL   + K  YYP +
Sbjct  415   EGMHWKRWDTLKIRKDRGGMGFRDLLSFNRAMLGKQAWRLAQQPSSLWGSLFKGLYYPYT  474

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               + A +G  PS+ W SL+  +  I     W++G+G  ++I  D WL   +   I  P  
Sbjct  475   DLWHATRGIRPSWGWRSLVLGRDSIAPKIMWKVGDGTKIKIREDKWL---HRGVIEGPVH  531

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +     +    G  WD+  +   F+ + A+ IL+IPI      D+++W   + G +
Sbjct  532   VNEPSLVSEIINKVQGR-WDELKIAAHFDEKLAEEILTIPIKPQTETDQIVWTGTQAGKY  590

Query  981   TVKSCYKAISLDLDSV-----------PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             T+KS Y  I      V           P + W  IWN+H PP+ K F+W +C+  LPT D
Sbjct  591   TMKSAYNFIKEAKAQVQENQPTTSFQPPPSLWKDIWNLHTPPKIKIFMWNLCNNALPTKD  650

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQA-QSCSEWITKC  658
              L  R+I   P+CPLC    E+  H+   C + TQ W     +  + Q      EW  + 
Sbjct  651   NLFGRKILPDPICPLCNLERETVEHLFLLCPWTTQIWHKELHIKISRQGLMRIEEWFCQL  710

Query  657   FE-SLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK  508
              + ++ PP  ++  +  WN+W+ARN+ V++       A++++++AL + ++
Sbjct  711   KQKTMNPPSLNMVAVTLWNMWKARNQAVFRGRKPEMSAIIDSAQALLKSYQ  761



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score =   254 bits (650),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 181/565 (32%), Positives = 281/565 (50%), Gaps = 49/565 (9%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
               +++ W    LSRAG+EVL+K+VIQA+P+Y M +F  P  +  +++  + GFWWG  + 
Sbjct  1211  MEKLQGWKQNTLSRAGKEVLIKAVIQAIPAYPMCIFKFPGAVCKELDALVAGFWWGCKEG  1270

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
               K + W +   L +PK  GG+GFR  ++FN ALL+KQ WRL   P+SL AK++KA+Y+P
Sbjct  1271  AHK-IHWVSKGVLGLPKDMGGLGFRNFQEFNEALLAKQCWRLITEPDSLWAKVIKARYFP  1329

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
             +S  +DAKKGG  S+ W+SL+  +G+++    W+I  G  VR+W D WLP +  P     
Sbjct  1330  HSSIWDAKKGGRASWAWSSLICGRGLVREGSHWQILGGQEVRVWQDRWLPSL--PLGHPE  1387

Query  1167  PFPYlanasvnsllnN---HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
             P   +A      +          W+   ++   +    Q I   P+    R+D++IW   
Sbjct  1388  PVGQVAVTPSLRVSALICPESGRWNINFLQPFISEEAMQAIEETPLGDLSRKDRLIWDTS  1447

Query  996   EKGVFTVKSCYK------AISLDL-----DSVPIASWSTIWNVHLPPRAKTFIWQVCSGC  850
             + G ++VKS Y+       +  DL       VP A W  IW + +PP+ + F+W     C
Sbjct  1448  KNGAYSVKSGYRWLQGRSLVRRDLRRPSVRGVPKAFWKGIWKLEVPPKLRHFLWLTVHNC  1507

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW-------RLFEP-LPATS  694
             LPT D L  RR   +  CP+C   +E+  HI   CS+    W       ++  P LP   
Sbjct  1508  LPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCSWVEPIWFGGALGYKMDRPSLP---  1564

Query  693   QAQSCSEWITKCFESLQPP---------RASLFVIICWNIWRARNEKVWKNICL-PAKAV  544
                S S+WI   F    P          R S  V  CW IW+AR + V+K + + P K +
Sbjct  1565  ---SWSDWIQGVF---SPNLCNSGDIMWRQSYIVFTCWCIWKARCDFVFKEVPINPLKVL  1618

Query  543   VENSKAL--WRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLG  370
                S+A+  +   KA           ++  +T+W  P   + K+NVDA+    S+   +G
Sbjct  1619  AAISEAVRSFISAKAKDGERGGGEGRRNSQVTRWCAPTYPFVKINVDASWSKASKMGFVG  1678

Query  369   WVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
              ++R+    F +AA +  I   S   AEA A+           + Y+ +ESDSL  +  L
Sbjct  1679  VIVRDMESKFVAAARHP-INAPSAAAAEAYALLHGCRLGAELGVRYVILESDSLDAIKCL  1737

Query  189   SSPAFVTSFDL--LLADIKDLLSTF  121
             SS   + S++   +LA +K L   F
Sbjct  1738  SSSLSMGSWEAYPVLARVKQLGGDF  1762



>ref|XP_007207773.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
 gb|EMJ08972.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
Length=1060

 Score =   251 bits (642),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 163/548 (30%), Positives = 266/548 (49%), Gaps = 41/548 (7%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             I  W  + LSRAG+E+L+K+V+QA+P+Y+M+ F +P+GL  ++   M  FWW     + +
Sbjct  479   ISGWKEKLLSRAGKEILIKAVLQAIPTYSMSCFRIPKGLCKELNGIMARFWWAKAKDK-R  537

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             G+ W  W+ LC  K  GG+GFR ++ FN ALL+KQ WR+   PESL A+I +A+Y+P+  
Sbjct  538   GIHWVKWELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRARYHPSVP  597

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP-F  1162
             F +A+ G NPSF+W SL   K ++    RWR+G+G+S++++ D WLP  +  +I +PP  
Sbjct  598   FLEAEVGTNPSFIWRSLQWGKELLNKGLRWRVGSGVSIQVYTDKWLPAPSCFKIMSPPQL  657

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P           +     W+  +++DIF  ++   IL IP+      D +IW  +  G++
Sbjct  658   PLSTRVCDLFTSSGQ---WNVPLLKDIFWDQEVDAILQIPLASLAGHDCLIWHYERNGMY  714

Query  981   TVKSCYKAISLDLDSV---PIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +VKS Y+   L+ D +   P A        W  IW + +P + K F+W+     LP   +
Sbjct  715   SVKSGYRLAGLEKDKMSGEPSARVDLNSKFWKKIWALKIPNKIKFFLWRCAWDFLPCGQI  774

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFE  652
             L +R+I  +P+CP C    ES  H +  C  A + WR       ++    C  W    F 
Sbjct  775   LFNRKIAPTPICPKCHRKAESVLHAVWLCEAAKEVWR------NSAWGNVCEVWRVNSFR  828

Query  651   SL--------QPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
              L              LF  +CW +W  RN  +++     A  ++     L +++     
Sbjct  829   ELWHALQLSSSGEEQGLFAYLCWGLWNRRNSFIFEGKSETAIQLLSRMTKLAQEFSDANN  888

Query  495   V--DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
             +      R+S  Q       P+QGW       A+       G+G V+RN +G F +A   
Sbjct  889   ILHTIHGRQSSPQA------PLQGW---RPPPAVKSGDSVRGVGVVVRNANGEFMAACVR  939

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL-LLAD  145
                     ++ E +A  E L +          +E D+   ++ + S       D  LL +
Sbjct  940   RIHASYGARQTELMATIEGLRFAIDMGFTDAILEMDAQDCLNSIFSTEEYNGIDGPLLEE  999

Query  144   IKDLLSTF  121
             +  LL+ F
Sbjct  1000  VNYLLNNF  1007



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   252 bits (644),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 170/549 (31%), Positives = 265/549 (48%), Gaps = 24/549 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS+AG+EVL+K+VIQA+P+Y M+LF +P G++ DI      FWW       
Sbjct  627   KLQGWKEKLLSKAGKEVLIKAVIQAIPTYMMSLFAIPDGILEDINSMCARFWW-RATGMA  685

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K C+PK +GGMGFR +K FN ALL+KQ WRL     SLA +IM+A+Y+ N 
Sbjct  686   RKMHWISWEKFCLPKSYGGMGFRDLKTFNQALLAKQGWRLMCDDGSLAHQIMRARYFKNV  745

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA++G +PSFVW S+   K ++    +WR+GNG S+R+W   WLP  ++ ++ TP  
Sbjct  746   PFLDARRGYDPSFVWRSIWGAKSLLMEGLKWRVGNGASIRVWDMAWLPGDSSSKVPTPNV  805

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  LL+ +G GWD   +       DA L   IP+ +    D + W   + G+F
Sbjct  806   ESREDLMVADLLSVNG-GWDVAALAHHLTEEDAMLAREIPLSERYPIDVLYWWPAKDGIF  864

Query  981   TVKSCYKAISLD--------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             + KS Y    L                +WS IW +   P+   F+W+ C G L T   LR
Sbjct  865   STKSAYWLGRLGHVRGWMNRFGGGHGDAWSIIWKLGGLPKLAHFLWRACVGALATRGRLR  924

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFE  652
              R I     C  C+   ++  H + +CS     W    F+ L +   A S  + +     
Sbjct  925   DRHIIADGQCIHCVGQTDTIVHAVCKCSLVASIWAASPFQQLLSDCNASSFVDLLLWLNS  984

Query  651   SLQPPRASLFVIICWNIWRARN----EKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
              L       F  + W  W  RN    ++ W N  + A   +     L  D+K+       
Sbjct  985   KLDRMDLLSFASLAWAAWSFRNSVHHDEPWSNAQVGALGFLR----LVHDYKSYGGAVLA  1040

Query  483   QRRSQHQYITK--WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
             + +      ++  WI P +G  ++N DAA+ +    +GLG V+R+  G   + A      
Sbjct  1041  RPQGVLGVFSRASWIPPGEGAVRINTDAAI-LGDDGVGLGAVVRDSTGQVCAVAVRRVQA  1099

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADIKDL  133
                   AEA A +  L   +     ++ +E D+L +V  L   +F  +  +LL  DI  L
Sbjct  1100  RWPAGLAEAAAAKFGLLVSRELGYGHVELEVDALNLVKALHVRSFGRAPIELLYEDISML  1159

Query  132   LSTFCSLLY  106
                F S  +
Sbjct  1160  GDGFSSFTF  1168



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score =   253 bits (645),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 268/540 (50%), Gaps = 23/540 (4%)
 Frame = -2

Query  1677  FLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAW  1498
             +LS+AGREVL+K+V QA+P+YAM  F++P+ ++  IE+    F+WG  + + + + W AW
Sbjct  792   YLSQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFWGQKEEERR-VAWVAW  850

Query  1497  DKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKG  1318
             +KL +PKK GG+G R    FN ALL+KQAWR+   P+SL A+++K KY+P S F +A+  
Sbjct  851   EKLFLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVIKGKYFPRSNFLEARVS  910

Query  1317  GNPSFVWASLLETKGIIQ-GNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanas  1141
              N SF   S+L  + +IQ G CR  IG+G    IW D W+P +    I         +  
Sbjct  911   PNMSFTCKSILSARAVIQKGMCRV-IGDGRDTTIWGDPWVPSLERYSIAATEGVSEDDGP  969

Query  1140  vnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSC-Y  964
                        W+ E++  +F   ++  I  IP+    + D+ +W+  + G FTV+S  Y
Sbjct  970   QKVCELISNDRWNVELLNTLFQPWESTAIQRIPVALQKKPDQWMWMMSKNGQFTVRSAYY  1029

Query  963   KAISLDLDSVPIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
               +  D  + P  S       W  IW   +PP+ K F W+     L     +R R ++  
Sbjct  1030  HELLEDRKTGPSTSRGPNLKLWQKIWKAKIPPKVKLFSWKAIHNGLAVYTNMRKRGMNID  1089

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFEPL---PATSQAQSCSEWITKCFESLQPPR  634
               CP C   EE+  H++  C  +++ W +  PL       +A S   W+    ++ +   
Sbjct  1090  GACPRCGEKEETTEHLIWGCDESSRAWYI-SPLRIHTGNIEAGSFRIWVESLLDTHKDTE  1148

Query  633   -ASLFVIICWNIWRARNEKVWKNICLPAKAVVENS-KALWRDWKACTEVDDQQRRSQHQY  460
               +LF +ICWNIW  RN+ V++   L  + VVE + + +    + C      +  + H+ 
Sbjct  1149  WWALFWMICWNIWLGRNKWVFEKKKLAFQEVVERAVRGVMEFEEECAHTSPVETLNTHE-  1207

Query  459   ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG-IFHSAACNSWIGVLSPKEAEA  283
                W  P  G  KLNVDAA+      +G+G V+R+  G +  +  C  W  +  P  AEA
Sbjct  1208  -NGWSVPPVGMVKLNVDAAV-FKHVGIGMGGVVRDAEGDVLLATCCGGW-AMEDPAMAEA  1264

Query  282   LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKDLLSTFCSLLY  106
              ++R  L          + VE D   +   L   A  VT F  ++ DI  L S   ++++
Sbjct  1265  CSLRYGLKVAYEAGFRNLVVEMDCKKLFLQLRGKASDVTPFGRVVDDILYLASKCSNVVF  1324



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   252 bits (643),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 226/449 (50%), Gaps = 21/449 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVLLK++IQ++P+Y M+LF +P  ++++I    + FWWG   T+ 
Sbjct  752   KLQGWKEKLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILNEINAMCSRFWWGARGTER  811

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK +GGMGFR +K FN ALL+KQ WRL     SLA  +MKA+Y+P +
Sbjct  812   K-MHWVSWEKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCDTNSLAHLVMKARYFPRT  870

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F  A++G +PS+VW S+   K ++    +WR+G+G S+ +W D+WLP  +   + TP  
Sbjct  871   LFTSARRGFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWEDSWLPGDSCSVVPTPNI  930

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L + G  W++  +   F S DA LI +I I +   ED   W     G +
Sbjct  931   E-SPADLQVSDLIDRGGTWNELALSTHFTSNDAALIRTIHISRRMPEDIQYWWPASNGEY  989

Query  981   TVKSCYKAISLD--------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             + KS Y    L                +W  IWN+  PP+ + F+W+ C+G L T   L 
Sbjct  990   STKSGYWLGRLGHLRRWVARFGGDHGVAWKAIWNLDGPPKLRHFVWRACTGALATKGRLC  1049

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITKCFE  652
              R +     C  C    ES  H L  CS     WR   F          S  E       
Sbjct  1050  DRHVINDEACTFCHGERESVLHALFHCSLVAPIWRNSPFLNYVVDGPVSSFMESFIWIRS  1109

Query  651   SLQPPRASLFVIICWNIWRARN----EKVWKNICLPAKAVVENSKALWRDWKA-CTEVDD  487
              L       F+ + W  W  RN    E+ WKNI + A   ++    L  D+K+  T V  
Sbjct  1110  KLASSELLSFLALAWAAWTYRNSVVFEEPWKNIEVWAVGFLK----LVNDYKSYATLVHR  1165

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAAL  400
                 S     + WI P  GW+KLN DAA+
Sbjct  1166  AVSVSPFPSRSAWIPPTVGWYKLNSDAAM  1194



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   252 bits (643),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 170/557 (31%), Positives = 274/557 (49%), Gaps = 31/557 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++  W  R LS++G+E+LLKSV+QALP YAM++F LP  L   IE+ ++ FWW N + +
Sbjct  910   AKLDGWKERLLSKSGKEILLKSVVQALPQYAMSIFKLPLSLCRLIEKKISVFWWSNNNGK  969

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W+ W  L + K  GGMGFR +  FN A+L KQAW LF  P +L +++ K  Y+ N
Sbjct  970   -TGIHWQNWTSLKLSKDSGGMGFRDLVSFNKAMLGKQAWHLFQQPNALWSQLFKGLYFRN  1028

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F  A+ G    + W S+L+ +  I    RW +G+G  ++I  DNWLP           
Sbjct  1029  SSFQCAQAGNRTLWGWQSILKGREAILPRLRWLVGDGSKIKIREDNWLPMGTLGGTVAQG  1088

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P L    +++  +     W+  ++ ++F+S+ ++ IL IPI      D+++W     GV
Sbjct  1089  EPVLVADLIDNSHHT----WNSTLISNLFDSQVSEEILKIPINPLLLTDQLVWTATSSGV  1144

Query  984   FTVKSCYKAISLDLDSV----------PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++VKS Y  +S  L++           PI  W TIW++   P+ + F+W  C   L T  
Sbjct  1145  YSVKSSYHLLSSHLNTQLNVPSTSYQNPIKLWRTIWHMKTAPKIRVFMWLACHNALATKA  1204

Query  834   LLRHRRIDCSPLCPLCL-NVEESAFHILAECSFATQCWR----LFEPLPATSQAQSCSEW  670
              L HR I  SP+C LC  N+ E+  H+   C++ ++ W       + LP +   Q    W
Sbjct  1205  NLFHRHISPSPVCSLCTQNMPETVEHLFFFCTWTSKIWAHPHIRVQILPTS--VQRFDAW  1262

Query  669   I-TKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             +  +  +S       +   + W IWR RN  +++N        VE++ A  R +K     
Sbjct  1263  VAARATDSKAFHEFEVITNLLWQIWRQRNNFIYRNQSPDPIQAVEDALAQSRIYKVVDPT  1322

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
               +   S      +W  P +G  K N+D A      +  +  + RNH GI       S+ 
Sbjct  1323  PHRFPISSLSPDQRWKPPDKGSLKCNIDGAFQSEGLQGSMACICRNHKGILTDVFTRSF-  1381

Query  312   GVLSPKEAEALAIREALSWCKR--QHIDYIHVESDSLVVVHGLSS---PAFVTSFDLLLA  148
                S  +AE  A+   +    +  +H + + VESD L +V  ++    P +     LL A
Sbjct  1382  SAQSAFQAELYALIFFIQHLIQHGRHQERLIVESDCLQLVEMVAEKKPPPWTER--LLFA  1439

Query  147   DIKDLLSTFCSLLYLFC  97
             +++DLLS   +L    C
Sbjct  1440  EVEDLLSQCPNLSLKHC  1456



>ref|XP_009139523.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=753

 Score =   246 bits (629),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 164/557 (29%), Positives = 271/557 (49%), Gaps = 39/557 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W+ R LS+AG+EV++K+V  ALP  AM++F +P+ +++ +   +  FWW   + + 
Sbjct  150   RISGWHARTLSQAGKEVMIKAVASALPVSAMSVFKIPKTVITSLSSALANFWWSAVEHKR  209

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+K+C+PK  GGMGF+ ++ FN ALL+KQAWRL N    L ++++K KY+  +
Sbjct  210   K-IHWISWEKMCLPKDLGGMGFKDLESFNKALLAKQAWRLINLESCLMSQVLKGKYFEGT  268

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F  A+ G  PS+ W S+LE K ++    +  +GNG S+++W D WL D N   I  PP 
Sbjct  269   CFVKAQLGKRPSYAWRSVLEGKDLLVQGLKVAVGNGSSLKVWTDPWLEDDNG--ICRPPL  326

Query  1161  P----YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  +     V+ L+N H   W    + ++F  RD  +IL    P     D  +W   +
Sbjct  327   RKQRFFNVELQVSELINYHTRRWSRRKLSELFVPRD-MMILEKNQPVISEHDSWVWRHTK  385

Query  993   KGVFTVKSCY------KAISLDLDSVPIASWS----TIWNVHLPPRAKTFIWQVCSGCLP  844
              G+++VKS Y      K + L  D   + S +     +WN+  P + K FIW+  SG L 
Sbjct  386   SGLYSVKSGYELAFTMKNVELIRDQQVLPSLNPLKDRVWNLLAPSKLKVFIWKALSGALS  445

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQS----  682
               D LR R + C   C  C    ES  H+L  C+FA Q W +  F   PA   + S    
Sbjct  446   VLDGLRDRGMKCDLECQTCGQTGESINHVLFSCTFARQVWAMTRFPSPPAGFDSFSIFAN  505

Query  681   ----CSEWITK--CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALW  520
                  S W TK   FE+ +      F  + W +W+ RN  +++     +  V   ++   
Sbjct  506   VNYLISFWETKKHVFEATRN-----FPWVLWYLWKNRNNLLFEGALFESVQVCTKAEEEA  560

Query  519   RDWKACTEVD----DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
               W A   ++    D  R    Q    W RP + + K N+    +   +  G  WV+R+ 
Sbjct  561   SQWYAAQSLERRSTDDNRNRLIQASAAWKRPPENFVKCNIGFKWEYKKKIAGAAWVVRDS  620

Query  351   HGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFV  172
              G     +  S+  V S  +A+ L++  A+   +      ++   +  ++V  ++ P+  
Sbjct  621   RGTVLLHSRRSFGNVESKDDAQFLSVAWAIESMRCHRFRMVYFAVEGRMLVDAINKPSDW  680

Query  171   TSFDLLLADIKDLLSTF  121
              SF   + +++ +L  F
Sbjct  681   PSFKFKVFELRSILRDF  697



>ref|XP_006482369.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=494

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 161/515 (31%), Positives = 262/515 (51%), Gaps = 51/515 (10%)
 Frame = -2

Query  1611  MNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNL  1432
             M++F +P GL  DI+R++ GFWW     + KG+ W  W+++   K  GGMGFR I  FN 
Sbjct  1     MSVFKIPVGLCDDIQRSIVGFWWSKKKDK-KGIPWTRWEEMSRAKIRGGMGFRDISSFNQ  59

Query  1431  ALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCR  1252
             AL++KQ+WRL  +PESLAA+++KA+Y P + F  A  G NPS++W S++  + +I    R
Sbjct  60    ALVAKQSWRLIQNPESLAARVLKARYLPKTDFLRASIGSNPSYIWRSIMWGRQVIHNGHR  119

Query  1251  WRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNS  1072
             WRIGN   + ++ DN                               + W  ++++  F  
Sbjct  120   WRIGNREKISVYRDN------------------------------ENNWKTDLIQQNFVK  149

Query  1071  RDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLD---------SVPIASW  919
              DA+   SIP+P+   ED++IW  D++G +T+KS Y+ ++L L          S   ++W
Sbjct  150   EDAKADQSIPLPRRQSEDEVIWHYDKRGKYTMKSGYQ-VALKLKFPYSPNCSNSSSSSNW  208

Query  918   STIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSF  739
             S IW + LP + K FIW+     LPTA+ L  R+I     C  C N  E+  H L  C  
Sbjct  209   SVIWKLTLPAKIKIFIWRAAKNLLPTAENLWKRKIVHEAYCKRCGNRVENTLHALITCKA  268

Query  738   ATQCWRLFEPLPATSQAQSCSEWITKC-FESLQPPRASLFVIICWNIWRARNEKVWKNIC  562
             A + W+L  P+ ++ Q     + +     + L      + + I W IW  RN+ V++++ 
Sbjct  269   AKKVWQL-SPMASSFQEMGNPDILGDLGGKKLSRADMEMLMTILWVIWYDRNKLVFEDLK  327

Query  561   LPAKAVVENSKALWRDWKACT--EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINS  388
             L  +  +  ++A+   ++     E+ ++ +  + +  T W  P QGW KLNVDA  D N 
Sbjct  328   LDPRLSMAKAEAINEAFRRTQFPEITNEGKLQKLKQ-TVWTPPPQGWLKLNVDATTDSNK  386

Query  387   RKMGLGWVLRNHHGIFHSAACNS--WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESD  214
                GLG ++R+  G   +A   +  + GV+S  EAE  A   A+   ++  +  I +E+D
Sbjct  387   SCAGLGAIIRDSTGKCMAAGIKTVKFSGVVSRVEAE--ATEWAVQIAQQLGMQSIILETD  444

Query  213   SLVVVHGLSS-PAFVTSFDLLLADIKDLLSTFCSL  112
             S  VV  ++     +T     ++ I+ L  TF S 
Sbjct  445   SQEVVDLINDRERSLTEICWTISKIQSLKKTFSSF  479



>ref|XP_010513002.1| PREDICTED: uncharacterized protein LOC104788940 [Camelina sativa]
Length=1347

 Score =   251 bits (641),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 168/561 (30%), Positives = 267/561 (48%), Gaps = 33/561 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +   W  RFL+ AG+E L+KSV  A+P Y+MN F LP+ L S+++  +  FWWG+   + 
Sbjct  748   KTDGWQTRFLNTAGKETLIKSVAFAMPVYSMNCFELPKKLCSELDSLIARFWWGSTQ-EK  806

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW KL   K  GG+GFR    FN ALL+ QAW++   P++L  +++KA+Y+ ++
Sbjct  807   KKISWVAWKKLVTSKNEGGLGFRDFHLFNQALLANQAWKILQRPDNLIYRLLKARYFRDT  866

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              FF A  G  PS+ W SL   + +++   ++ IG+G   ++  D WLP  N PR   PP 
Sbjct  867   SFFSASWGTKPSYSWNSLRFGRELLKSGIQYSIGDGRLTKLGVDPWLP-TNPPR---PPL  922

Query  1161  PYlanasvnsllnNHGS---GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                A  +   +          WD+  V+   + RD  LI    +PQ P  D  IW   + 
Sbjct  923   LIRAEDAEMPVSTIIDPVSFHWDELQVQRFIDPRDHHLIYKTYLPQIPALDSYIWSGTKH  982

Query  990   GVFTVKSCY-KAISLDL-DSVPIASWST-------IWNVHLPPRAKTFIWQVCSGCLPTA  838
             G++TVKS Y KA+SLD  D  P+A   +       IW +++ P+ + F+W++ S  +  A
Sbjct  983   GMYTVKSGYWKALSLDRDDDAPVAPLKSNPDIAAQIWRLNITPKLQHFLWRLASHAIGVA  1042

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQ---SCSEWI  667
             D LR R I+  P C  C    ES+ H    C      WRL   +P T       +  + +
Sbjct  1043  DNLRRRNINVYPYCSRCCMSFESSDHTFFFCPQVIPIWRLI-GIPTTLIGDPHITIEDKL  1101

Query  666   TKCFESLQPPRASLF-----VIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
                F+  Q     L        + W IW++RN+ V+    +    + +N+     +W  C
Sbjct  1102  RYLFQLHQDNTIGLIHRYAPFWLMWRIWKSRNDLVFNYRLIEITDIAKNALTDTEEWLNC  1161

Query  501   TEVDDQQRRSQHQ-------YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
                ++Q    Q            +W +P  GW K N D +     R  GLGW++RN +GI
Sbjct  1162  MVTEEQPSAGQSTGQQCPRPRRIQWKKPNDGWVKCNYDVSHYEGDRHSGLGWLIRNTNGI  1221

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
             F       + G  + +EAE  A+  A+          +  E D+ VV   +++    +  
Sbjct  1222  FLDGGMGKYQGRATIEEAECTALIWAIQSAWGLGYRSVEFEGDNEVVNKIINNHGSYSRL  1281

Query  162   DLLLADIKDLLSTFCSLLYLF  100
                L  I+   + F ++ + F
Sbjct  1282  QHYLETIRGWCTKFTNIRFTF  1302



>gb|EEE59920.1| hypothetical protein OsJ_12548 [Oryza sativa Japonica Group]
Length=1076

 Score =   249 bits (635),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 265/543 (49%), Gaps = 47/543 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  WN +++S   +EVL+KSV QALP+Y M +F +      D  R +  FWWG+ + + 
Sbjct  468   RMSDWNEKYMSSGAKEVLIKSVAQALPTYIMGVFKMTDKFCDDYTRMVRNFWWGHDNGER  527

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW+K+  PK  GG+GFR +K FN ALL++QAWRL   P+SL A++ KAKYYPN 
Sbjct  528   K-VHWIAWEKILYPKSHGGLGFRDMKCFNQALLARQAWRLLTSPDSLCARVFKAKYYPNG  586

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D       S VW  +     +++    WR+GNG +++IW   W+P   +  +     
Sbjct  587   NLVDTAFPTVSSSVWKGIQHGLDLLKQGTIWRVGNGHNIKIWRHKWVPHGEHINVLEKK-  645

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    VN L+N     W++ +VR +    DA  +L I +P    +D   W  ++ G+F
Sbjct  646   GRNRLIYVNELINEENRCWNETLVRHVLKEEDANEVLKIRLPNHQMDDFPAWHHEKSGLF  705

Query  981   TVKSCYK-AISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             TVKS YK A +L    V  +S           WS +WN  +  + K FIW++    LPT 
Sbjct  706   TVKSAYKLAWNLSGKGVVQSSSSTATSGERKIWSRVWNAKVQAKVKIFIWKLAQDKLPTW  765

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFA---TQCWRLFEPLPATSQAQ-SCSEW  670
             +  R R+I+ +  CP+C    E+++H   EC+ A    +  R    LP   +   +  +W
Sbjct  766   ENKRRRKIEMNGTCPVCGTKGENSYHATVECTKARALREALRAVWHLPGEDKFLWTGPDW  825

Query  669   ITKCFESLQPPRASLFVIICWNIWRARNEKV-----------------WKNICLPAKAVV  541
             +    + +   + +  + + W  W  RN+ +                 ++ + LP + + 
Sbjct  826   LLILLDGVNEEQRTHIMYMLWRAWYLRNDLIHGDGRCSIAGSVSFLTSYEEVLLPNRQMP  885

Query  540   ENSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
             ++ K      K       +++    +  + WI P  G  K+NVDA   + + +   G V+
Sbjct  886   DDIKGK----KPMYSEGQKEKHMAEKQSSGWIAPPDGAAKINVDAGFRMETGEASAGIVI  941

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALA----IREALSWCKRQHIDYIHVESDSLVVVHG  193
             R+  G+   AAC +     S ++AEALA    IR AL W    H+  I +E+D+  VV  
Sbjct  942   RDCRGLILLAACKTLHPCSSAEQAEALASLEGIRCALQWI---HMPVI-LETDNAEVVAR  997

Query  192   LSS  184
             L +
Sbjct  998   LKT  1000



>emb|CAB75484.1| putative protein [Arabidopsis thaliana]
Length=851

 Score =   247 bits (631),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 153/456 (34%), Positives = 238/456 (52%), Gaps = 22/456 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  SW+ +FLS AG+E+LLKSV  A+P YAM+ F LPQG+VS+IE  +  FWW     + 
Sbjct  396   RTASWSAKFLSPAGKEILLKSVALAMPVYAMSCFKLPQGIVSEIESLLMNFWWEKASNK-  454

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AW +L   KK GG+GFR +  FN ALL+KQAWR+  +P SL A++MKA+Y+ ++
Sbjct  455   RGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRIIQYPNSLFARVMKARYFKDN  514

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPR-ITTPP  1165
                DAK     S+ W+SLL    +++   R+ IG+G ++R+  DN + D + PR + T  
Sbjct  515   SIIDAKTRSQQSYGWSSLLSGIALLRKGTRYVIGDGKTIRLGIDN-VVDSHPPRPLLTDE  573

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  +         H   WD+  ++   +  D   I  I +    + D++IW  +  G 
Sbjct  574   QHNGLSLDNLFQHRGHSRCWDNAKLQTFVDQSDHDYIKRIYLSTRSKTDRLIWSYNSTGD  633

Query  984   FTVKSCYKAISLD-LDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TV+S Y   + D  +++P  +         + IWN+ + P+ K F+W++ S  LPT D 
Sbjct  634   YTVRSGYWLSTHDPSNTIPTMAKPHGSVDLKTKIWNLPIMPKLKHFLWRILSKALPTTDR  693

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATS-QAQSCSEWITKC  658
             L  R +   P CP C    ES  H L  C FAT  WRL + PL  +S  + +  + I+  
Sbjct  694   LTTRGMRIDPGCPRCRRENESINHALFTCPFATMAWRLSDTPLYRSSILSNNIEDNISNI  753

Query  657   FESLQPPRAS-----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
                LQ    +     +   + W IW+ARN  V+ N+       V  +KA   +W   T+ 
Sbjct  754   LLLLQNTTITDSQKLIPFWLLWRIWKARNNVVFNNLRESPSITVVRAKAETNEWLNATQT  813

Query  492   DDQQR---RSQHQYITKWIRPMQGWFKLNVDAALDI  394
                +R   R+     T W++P   + K N DA+ ++
Sbjct  814   QGPRRLPKRTTAAGNTTWVKPQMPYIKCNFDASFNV  849



>ref|XP_008387184.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=887

 Score =   247 bits (631),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 160/519 (31%), Positives = 248/519 (48%), Gaps = 41/519 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              RI  W  +FLS AG+EV++K+V  ALP+YAM+ F LP  L  ++E  +  FWW  G  +
Sbjct  361   GRINGWAEQFLSPAGKEVMIKTVAMALPNYAMSCFKLPVNLCKEMETNIANFWW-RGSRE  419

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W +W+K+   KK GG+GFR I  FNLA L+K  WR+  +P SL  KI+K KY+P 
Sbjct  420   KNGMHWISWEKMKRRKKVGGLGFRDILSFNLAYLTKIGWRILTNPLSLLGKILKEKYFPE  479

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT--  1171
               F +AK G   S+ W  +++ K I++   RWR+G+G S+R+  D WLP  +  R+ +  
Sbjct  480   CSFMEAKVGKRSSWGWKGIMQGKRILERGRRWRVGDGSSIRVKIDPWLPRPHTFRVNSNH  539

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
             P  P +    ++ +       W  E+V+  F   ++ +IL IP      +D++IW     
Sbjct  540   PDMPVMVKDLIDPVT----GSWMVELVKGCFEEEESNIILGIPTXLEGCDDRIIWHXTSN  595

Query  990   GVFTVKSCYKAISLDLDS----------------VPIASWSTIWNVHLPPRAKTFIWQVC  859
             G +TV++ Y  I++D+                   P   W  IW + +P + K FIW+ C
Sbjct  596   GDYTVRTGY-GIAMDMQENXELGRKGTGGCSRRDEPBKRWMEIWRLEVPNKMKFFIWRCC  654

Query  858   SGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC  679
                L     L  RR+  +  C LC +  E+  H+  EC F+   W    PL       S 
Sbjct  655   XSSLAVRGNLHRRRMRVNTACVLCGDARETEHHLFFECEFSRVFW-FSCPLQLDITFASG  713

Query  678   SE----WITKCFESLQPPRASLF----VIICWNIWRARNEKVWKNIC---LPAKAVVENS  532
              E    W   C    +     L     V I W IW+ RN+ ++K +    + +  VV N 
Sbjct  714   KEFGDCWHXLCNRFRKEKNHVLILQECVFIMWRIWKCRNDLMFKGMEANPMESVNVVRNQ  773

Query  531   KALWRDWKACTEVDDQ-----QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGW  367
                +R      ++ +      +  S      +W RP  G  K+N D A   ++ + G GW
Sbjct  774   IMXYRAAHETAKMSNAVGARGETVSYXGXPVRWKRPRFGVLKVNCDGAWCASTFRXGYGW  833

Query  366   VLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCK  250
             V+R+  G+  +A     +       AE  A+R AL  C+
Sbjct  834   VVRDFAGMLLAAGGEGGLFFNKAAMAEVSAVRAALLVCR  872



>ref|XP_008378657.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=653

 Score =   243 bits (621),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 161/540 (30%), Positives = 257/540 (48%), Gaps = 26/540 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LS+AGRE+L+K+V QA+P+Y MNLF  P    ++++  +  FWWG   
Sbjct  24    LLDKLQGWKKSTLSQAGREILIKAVAQAIPAYPMNLFKFPVSFCNEMDALITKFWWGQKL  83

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W + ++L   K+ GG+G      FN ALL+KQ WRL + P +L A ++KA+Y+
Sbjct  84    GENR-IHWVSRERLGRSKEEGGLGLXSFTIFNDALLAKQCWRLISEPNTLWALVLKARYF  142

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN  F DAK G   S+VWASLL  + I++    W+I +G   R+W D W+P +   R + 
Sbjct  143   PNXSFLDAKXGXRASWVWASLLXGREILRAGAHWQIMDGNDTRVWVDRWIPPIPLGRPSP  202

Query  1170  PPFPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  ++       L    SG WD + ++      + + IL +       +D+++W  D+
Sbjct  203   LGSVQVSKNLKVKSLICPVSGEWDLDFLKPFLADSEVEAILDLXTGDPMLKDRLVWPFDK  262

Query  993   KGVFTVKSCYK----------AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLP  844
             +G ++VKS Y                L S+P   W  +W + +PP+ +TF+W+     L 
Sbjct  263   RGSYSVKSGYYWSLNRSQVRCQQPTRLVSIPSTLWKNVWKLKVPPKIRTFLWKTLHAALA  322

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEW  670
             T   L  RR   SP CPLC + +ES  H+   C +    W        P   Q  S + W
Sbjct  323   TMKNLYIRRSSPSPTCPLCNSFDESIEHLFLFCPWVEVVWFGGRLNLRPNRQQVSSXASW  382

Query  669   ITKCFES------LQPPRASLFVIICWNIWRARNEKVWKN-ICLPAKAVVENSKALWRDW  511
             + +   +      ++  R S     CW+IW++R +  + N +  P++ V   S+++  D+
Sbjct  383   LXQMGAAENGSXEVRIDRISYIAFTCWHIWKSRCDFQFNNQVIYPSRVVAAVSRSV-SDY  441

Query  510   KACTEVDDQQRRSQHQYI---TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
             +        +    H  +    KW  P  G  K+NVDA  +  S     G V R+  G F
Sbjct  442   QGTILRQSSRSLLNHSSLGDGVKWXHPDHGVIKINVDANWEAKSGVGFTGVVARDEQGCF  501

Query  339   HSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFD  160
               AA    I       AEALAI    +       + I VESDS   +  L  PA   ++D
Sbjct  502   L-AASRQKIKATGATMAEALAILHGCNLGVSNGWNSICVESDSYDAISCLWDPALKGNWD  560



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score =   250 bits (639),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 164/542 (30%), Positives = 259/542 (48%), Gaps = 23/542 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  + LS+ G+EVLLKS+  ALP Y M+ F LP+ L   +   M  FWW N   Q
Sbjct  773   SRLTGWYAKTLSQGGKEVLLKSIALALPVYVMSCFKLPKNLCQKLTTVMMDFWW-NSMQQ  831

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W +W +L +PK  GG GF+ ++ FN ALL+KQAWR+     SL +++ +++Y+ N
Sbjct  832   KRKIHWLSWQRLTLPKDQGGFGFKDLQCFNQALLAKQAWRVLQEKGSLFSRVFQSRYFSN  891

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F  A +G  PS+ W S+L  + ++    R  IGNG    +W D WL D +N R     
Sbjct  892   SDFLSATRGSRPSYAWRSILFGRELLMQGLRTVIGNGQKTFVWTDKWLHDGSNRRPLNRR  951

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  +  V+ L++     W+  ++RD+F  +D ++IL    P   +ED   W+    G+
Sbjct  952   RFINVDLKVSQLIDPTSRNWNLNMLRDLFPWKDVEIILK-QRPLFFKEDSFCWLHSHNGL  1010

Query  984   FTVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++VK+ Y+ +S  +                 +  IWN+H  P+ + F+W+   G +P  D
Sbjct  1011  YSVKTGYEFLSKQVHHRLYQEAKVKPSVNSLFDKIWNLHTAPKIRIFLWKALHGAIPVED  1070

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ-AQSCSEWITKC  658
              LR R I     C +C    E+  HIL EC  A Q W +     A S+ + S    +++ 
Sbjct  1071  RLRTRGIRSDDGCLMCDTENETINHILFECPLARQVWAITHLSSAGSEFSNSVYTNMSRL  1130

Query  657   FESLQP---PRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
              +  Q    P    FV   I W +W+ RN  +++        +V+ +   + +W +    
Sbjct  1131  IDLTQQNDLPHHLRFVSPWILWFLWKNRNALLFEGKGSITTTLVDKAYEAYHEWFSAQT-  1189

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                Q   +H  ITKW  P+ G  K N+  A        G  WV+R+  G     +  S+ 
Sbjct  1190  -HMQNDEKHLKITKWCPPLPGELKCNIGFAWSKQHHFSGASWVVRDSQGKVLLHSRRSFN  1248

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDL  133
              V SP  A+  +   AL      H D +   S +  ++  L  P     + LLL DI +L
Sbjct  1249  EVHSPYSAKIRSWEWALESMTHHHFDRVIFASSTHEIIQALHKPH---EWPLLLGDISEL  1305

Query  132   LS  127
             LS
Sbjct  1306  LS  1307



>ref|XP_009120142.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=583

 Score =   242 bits (617),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 166/558 (30%), Positives = 263/558 (47%), Gaps = 64/558 (11%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +RI SW  +FL++ G+E+L+KS+ QALP+Y M+ FLLPQ +++ ++  +  FWW   +  
Sbjct  28    NRINSWTAKFLTKGGKEILIKSIAQALPTYVMSCFLLPQDVLNKLKSAIAKFWWSTKE-H  86

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KGL W AWDK+C P + GG+GFR +K+FNLALL+KQ WRL +HP SL A++MK +YY +
Sbjct  87    NKGLHWMAWDKICKPAEKGGLGFRDLKNFNLALLAKQLWRLLHHPTSLLARVMKGRYYRH  146

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +     +PS+ W S+L  K +++   R  IG+G + R+W D W+P    PR+    
Sbjct  147   TNPLEISSSNSPSYGWKSMLAAKDLLKKGLRHTIGSGYNTRVWFDQWIP-TQTPRL----  201

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                                     V+D    RD +L +        + D   W   + G+
Sbjct  202   ------------------------VKDNGTWRDPKLNI--------KADGFCWTHTKSGL  229

Query  984   FTVKSCYKAISLD---------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TVKS Y+  +L+         L+       S +W +  P + K F+WQ  +GC+     
Sbjct  230   YTVKSGYELATLEKCESDDQQVLEPSINPLLSKVWKLKAPRKIKHFLWQCLTGCIAVCSR  289

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE--PLPATSQAQSCSE-----  673
             L  R       CP C   EE+   +L EC  A Q W L +   +P    ++S  E     
Sbjct  290   LAERHCGNERACPRCGGDEETINDLLFECPPAVQTWALSDIPSIPGQFPSKSLLENFDFL  349

Query  672   WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
                   + +   R   F  I W +W++RN+K++  + +     ++N+     +W    +V
Sbjct  350   LFRATAKGISTQRLIKFPWIAWYLWKSRNDKLFNGVEISPLDSLQNASQESDEWCVAQDV  409

Query  492   ---DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
                   + R+   Y  + +   +   +  VDA+  IN    G G+VL    G   S +  
Sbjct  410   VLAGKARERAATVYREEMMESHKP--RCQVDASWAINQATFGGGFVLDKEDGSSISGSFG  467

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADI  142
                 V+SP  AE  ++  A+    R   + +H ESD L +V  +    F  S    LA  
Sbjct  468   R-NQVISPIHAEFQSLLWAMGNSLRLGHESMHFESDCLQMVKLIEEEEFWPS----LASE  522

Query  141   KDLLSTFCSLLYLFC*TF  88
              D  S   SL   F  +F
Sbjct  523   WDEFSRLWSLFNFFSISF  540



>ref|XP_010666352.1| PREDICTED: uncharacterized protein LOC104883509 [Beta vulgaris 
subsp. vulgaris]
Length=1234

 Score =   249 bits (636),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 153/503 (30%), Positives = 243/503 (48%), Gaps = 12/503 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQALP+Y M ++ LP  ++ +I   M  FWWG G    
Sbjct  701   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPGAVIHEIHSAMARFWWG-GRGDE  759

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+K+C PK  GG+GF+ +  FN ALL KQ WRL +H ESL +++M AKYYP+ 
Sbjct  760   RKMHWLSWEKMCKPKCMGGLGFKDLTVFNDALLGKQVWRLLHHKESLLSRVMSAKYYPHG  819

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A+ G + S+ W S+   K ++     WR+G+G  + IW   W+ D     I +   
Sbjct  820   DVCQARLGYSSSYSWRSIWGAKSLVMEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARV  879

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L++     W+ E++   FN RD Q IL+IP+     +D + W   + G++
Sbjct  880   E--GLEVVGDLMDVERKEWNVELIESHFNERDQQCILAIPLSTRCLQDDLTWAYSKDGIY  937

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD      W+ +W++++ P+ + F+W+ C+  LP   +L+ R +   
Sbjct  938   SVKTAYMLGKGGNLDDFHRV-WNILWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDE  996

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRLFE---PLPATSQAQSCSEWITKCFESLQPPR  634
               CP C   +E+  H+   C  + + W        LP       C   +   +  +    
Sbjct  997   AGCPCCDREDETQLHLFYRCPMSLKLWEELGCHILLPGVEDEAMCDTLVR--WSEMDATV  1054

Query  633   ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVDDQQRRSQHQYI  457
                   + WN+W  RN KV++    PA  V +       D+      +    R       
Sbjct  1055  VQKGCYLLWNVWVERNRKVFEYTSHPATIVGQRIMRQVVDFNNYAVRIYGGVRSPAATSS  1114

Query  456   TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALA  277
             ++W  P  G  KLN DA+L      +GLG + R+  G    AA         P+ AE  A
Sbjct  1115  SRWSAPPVGAIKLNTDASL-AEEGWVGLGVIARDSEGKVCFAATRRVRAYWPPEVAECKA  1173

Query  276   IREALSWCKRQHIDYIHVESDSL  208
             I  A    K +    +  ESDSL
Sbjct  1174  IYMASRLAKARGYGDVIFESDSL  1196



>ref|XP_008222000.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=561

 Score =   241 bits (615),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 157/494 (32%), Positives = 238/494 (48%), Gaps = 27/494 (5%)
 Frame = -2

Query  1611  MNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNL  1432
             M++F LP GL  +IE  +  FWW   D  G+G+ WK W  +C  K  GG+GFR +  FN 
Sbjct  1     MSVFRLPVGLCREIESIIAKFWWSKND--GRGIHWKKWSFMCQHKSDGGLGFRELTSFNQ  58

Query  1431  ALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCR  1252
             ALL KQ WRL   P SL A+++KA+Y+PNS F  A  G  PSF W SLL  + +++   R
Sbjct  59    ALLCKQGWRLLEFPHSLIARMLKARYFPNSDFLAASSGSLPSFTWQSLLWGRDLLRLGLR  118

Query  1251  WRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNS  1072
             WRIG+G  V I+ D W+P   +   T    P L   S    L     GWD   V   F+ 
Sbjct  119   WRIGDGRLVNIYGDPWVP--YDRFFTIQSIPTLPATSRVCDLFTASGGWDVGKVFATFSF  176

Query  1071  RDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCY---------KAISLDLDSVP----  931
              +A+ ILSIP+  G   D+ IW   + G ++VKS Y         + +S    + P    
Sbjct  177   PEAEAILSIPL-MGDNLDRRIWNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSS  235

Query  930   IASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILA  751
             + SW  +W + +P +    +W+V    LP+ ++L  RRI    +C  C    E+  H L 
Sbjct  236   LKSWKHLWKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALV  295

Query  750   ECSFATQCWRLFE-----PLPATSQAQSCSEWITKCFESLQPPRASLFVIICWNIWRARN  586
              C    Q W   +      LP  +   +   W+   +  + P + SLF    W +W  RN
Sbjct  296   GCVVCLQVWEALDFPRDFLLPTVADVGT---WMDAAWSIIPPDKQSLFAFTVWVLWNERN  352

Query  585   EKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDA  406
               ++ +   P+  +V+ +K    ++K  +  + +   S  + I KW  P    FKLNVD 
Sbjct  353   GVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSLSSLVRDI-KWRPPTGNCFKLNVDG  411

Query  405   ALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIH  226
             A D+ +   G G ++R+ HG    A        +S    E  A++  +S+     +  + 
Sbjct  412   ATDMETGARGAGAIVRDSHGNLVGALAMRAPSRISVLATELYALKVGISFALDVSLLPLE  471

Query  225   VESDSLVVVHGLSS  184
             +ESDSL  V  ++S
Sbjct  472   IESDSLQAVSMVNS  485



>gb|EPS72636.1| hypothetical protein M569_02121, partial [Genlisea aurea]
Length=1503

 Score =   250 bits (639),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 143/390 (37%), Positives = 221/390 (57%), Gaps = 20/390 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ WN +FLS+AG+ VL+K+V+QA+P+Y M+ F LP+  + D++  ++ +WW N +  G
Sbjct  1114  KIEGWNSKFLSQAGKLVLIKAVLQAIPAYTMSCFALPKSFLGDLQSAISRYWWRNRN--G  1171

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             KG+ WK+WD +    K GG+GFR + DFNLALL KQ WR+ + P S+ +++ +AKY+PN 
Sbjct  1172  KGIHWKSWDFISRSFKEGGLGFRDLHDFNLALLGKQVWRIASAPHSILSRVFRAKYFPNG  1231

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP-  1165
               + A+     S+VW  +++++ ++    R  IG+G SV IWHD W+P    P    P  
Sbjct  1232  DIWTARPCARGSYVWNGIMKSRDLVSKGIRHLIGDGSSVDIWHDPWIP---KPPTFKPTN  1288

Query  1164  -FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                    ASV +L+++    WD   +R+ F+  DA  I+SIP+ + P EDK++W   + G
Sbjct  1289  LLGERRRASVATLIDSRTKWWDVGRIREKFDPVDANHIISIPLSESPSEDKILWHYSKSG  1348

Query  987   VFTVKSCYKAI-SLDLD--------SVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TV+S Y  + SL ++         V    W  IW     P+   F+W++  GCLPT +
Sbjct  1349  TYTVRSAYHLVRSLRVEVSSSSSDSRVTPKVWDLIWKHACCPKIGLFMWRLAHGCLPTNE  1408

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATS---QAQSCSEWI  667
              L  RRI     C +CLN  ES  HIL EC  A Q W L + P  A +      S  +WI
Sbjct  1409  TLWRRRIPIDKECSICLNRTESDRHILLECPPAIQVWALSDLPWGAINTWRDGASAIDWI  1468

Query  666   TKCFESLQPPRASLFVIICWNIWRARNEKV  577
             +    +L+P   S  + I W +W  RN ++
Sbjct  1469  SSVSATLKPAAFSRLMTIAWFLWWKRNSRI  1498



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   250 bits (639),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 170/565 (30%), Positives = 268/565 (47%), Gaps = 36/565 (6%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             +  W  +FLS+AG+E+L+K+V  ALP+YAM+ F LP G+  D+ER +  +WW  G+ Q K
Sbjct  779   MSGWAEQFLSQAGKEILVKTVAMALPNYAMSCFKLPIGVCRDVERAIRNYWW-RGNEQRK  837

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             G+ W + D+L   KK GG+GF+ I+  NLA L+K  WR+  +P SL A +++ KY+P   
Sbjct  838   GIHWISXDRLMKQKKAGGLGFKDIQCVNLAFLAKIGWRITLNPMSLLASVLRDKYFPGKS  897

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFP  1159
             F +  KG N S  W  L E + ++    RWR+GNG S+ I  D W P     ++   P  
Sbjct  898   FGEXPKGKNTSXGWKGLFEARKVLNLGLRWRVGNGKSINIREDPWFPKPATFKVR--PRN  955

Query  1158  YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFT  979
              L    V+ L+++    W  +++ + F+  D   IL IP+      D+++W     G+++
Sbjct  956   NLVETMVSDLIDSDTKIWRTDLIANGFHRDDVSTILIIPLSHAGSNDRLVWHYATNGIYS  1015

Query  978   VKSCYKAISLDLDSVPIAS---------------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             VKS Y      +D   +                 W+ IW + +P + + FIW+ C+  L 
Sbjct  1016  VKSGYSMALKLMDDXALGRKXXGNPSESNKLKMVWNNIWRLQVPHKIRIFIWRCCNNALA  1075

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE---  673
                 L+ R +    +C +C  V E+  H+   C  +   W    PL   S      +   
Sbjct  1076  VRRNLKRRHMRVDNVCGVCXAVNETENHLFFRCEISHVFW-FCSPLHLNSHVLEGRDFLE  1134

Query  672   -WITKCFESLQPPRAS----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK  508
              W   C +      A      F    W +W+ RN+ V+K I      ++E  K    ++K
Sbjct  1135  SWCNFCDQVKDRIDADDIXHDFAFGLWRLWKNRNDVVFKGIYRQPLDILEAWKKSTGEYK  1194

Query  507   ACTEVDDQQRRSQ--------HQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
             A    D +    +         +  TKW RP  G  K+N DAA   ++ +MG+GW+ R+ 
Sbjct  1195  ASLAPDXEDHSLRMPKXIXVSDRICTKWKRPRFGTIKINTDAAWCKDTLRMGVGWLGRDF  1254

Query  351   HGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFV  172
              G+   A  +      S   AEA AIR AL  C     D I +ESD+  ++  L     V
Sbjct  1255  AGLLQXAGGSGTGFSHSAAAAEASAIRFALLSCIDHGFDDIIIESDASTIIXMLKKEILV  1314

Query  171   T-SFDLLLADIKDLLSTFCSLLYLF  100
               S + +L DI+ L     S+ + F
Sbjct  1315  DFSIECILDDIEXLAQKLRSVSFAF  1339



>ref|XP_010446251.1| PREDICTED: uncharacterized protein LOC104729051 [Camelina sativa]
Length=786

 Score =   245 bits (626),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 175/546 (32%), Positives = 261/546 (48%), Gaps = 31/546 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR   W  + LS+ G+EV++KSV  A+P++ M+ F LP+ + S +   +  FWW +G  Q
Sbjct  179   SRTNGWTAKQLSKGGKEVMIKSVATAVPTFVMSCFRLPKSVTSKLTSAVAKFWWSSG--Q  236

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AW+KLC  K+ GG+GF+ + DFN ALL KQ WRL   P+SL A + K +YY N
Sbjct  237   SGGMHWLAWEKLCGSKQLGGLGFKNVDDFNTALLVKQLWRLIESPDSLFAWVFKGRYYRN  296

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   D  +  +PS+ W S++  + ++      R+GNG S+ IW D W+P   +PR     
Sbjct  297   SNPMDPIRSYSPSYGWRSIVSARSLVNKGLIKRVGNGESISIWTDPWVP-AQSPRPAMSK  355

Query  1164  FPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P L ++   S L +H +  W  +++   F+  DA LI ++P+   PRED + W   + G
Sbjct  356   GPSLDSSLKISHLIDHQTNSWCIDLLLQHFSPEDAALIGALPLGSTPREDSLGWHFTKSG  415

Query  987   VFTVKSCYKAISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
              ++VKS Y  + L      +           + +W V  PP+ K F+WQV SGC+    +
Sbjct  416   KYSVKSGYDTVRLAKQESQVPRLGPDINPLLAGVWRVACPPKIKHFMWQVLSGCISVTAI  475

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW--ITKC  658
             LR   I C   C  C   EE+  H L  C  A Q W L + L  +    + S +  +   
Sbjct  476   LRRWGIACDAGCARCGADEETVNHALFRCPSARQTWALAQVLVGSVSFPTDSLYANVDHF  535

Query  657   FESLQP-PRASLFVIICWNIWRARNEKVWKNICLPAKAVVE---NSKALWRDWKACTEVD  490
               S  P  R   F  I W IW+ARN  V++NI      VV       A+W   +A  E D
Sbjct  536   LGSDNPGSRVEAFPWIMWYIWKARNAYVFENIRDKPDEVVRLALGEAAVWLQAQAEDEGD  595

Query  489   ----DQQRRSQHQYITKWIRPMQ-GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
                 +  R S  +     + P+    ++  VD +        G  WV  +      +   
Sbjct  596   NFISNPTRTSTQELGRVGLLPIDFSGYRCFVDGSWKAGDVFAGACWVCLSPQEASTTKGA  655

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVE----SDSLVVVHGLSSPAFVTSFDL  157
              ++   LSP  AE     EAL W  R  I + + E    +D   +V  +SSP    +F  
Sbjct  656   ANFRRSLSPLHAEV----EALVWAMRCMIGHDYREVTFYTDCSDLVKMVSSPHDWPAFKT  711

Query  156   LLADIK  139
              L DIK
Sbjct  712   YLDDIK  717



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   247 bits (631),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 166/543 (31%), Positives = 269/543 (50%), Gaps = 32/543 (6%)
 Frame = -2

Query  1701  RIKS--WNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
             ++KS  W+++FLS AG+ V+LKSV+  +PSY+M  F LP+ L   I+  +  FWW +G +
Sbjct  522   KVKSSGWSNKFLSTAGKMVMLKSVLTPVPSYSMTCFKLPRSLCKRIQSAVTRFWW-DGRS  580

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
               + + W +WDK+   K+ GG+GFR  + FN A L+K  WR+ N+P  L ++++  KY  
Sbjct  581   GNRKMAWVSWDKMTKSKQDGGLGFRDFESFNDAYLAKLGWRIHNNPSGLLSRVLTGKYCT  640

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
             ++ F         S  W  +L  + ++  N  W +GNG S+ IW D WL      R   P
Sbjct  641   DTPFLQVAHRSAESHGWRGVLIGRDLMMSNAGWALGNGESINIWSDPWLSHSEQARPMGP  700

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                   + +V  L+  +G+ W+ E+++ +F   +A+ ILS+   +    DK+IW+    G
Sbjct  701   APEQFIHWTVKKLMLPNGTDWNREIIQQVFPHEEAR-ILSLKPSKTDVADKLIWLGTTSG  759

Query  987   VFTVKSCY-KAISLDLDSVPIASWST-------IWNVHLPPRAKTFIWQVCSGCLPTADL  832
              +T KS Y KA+ L+ D+ PI   +        IWN+   P+ K F+W++  G LP  + 
Sbjct  760   EYTTKSGYLKALELN-DTNPIPPTTVEVDWKKGIWNLQTAPKIKLFLWKIFKGALPVGEA  818

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFE  652
             L  R I  +  C LC +  ES  H+   C FA   WRL  P      A+   +  T    
Sbjct  819   LAVRNIGSAQTCALC-DSNESINHLFLHCDFAYNVWRL-APFSTCIDARGLLDLSTAWLG  876

Query  651   SLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRS  472
              L      L   I W +W ARN++++ N     + V+  + A  ++W          R  
Sbjct  877   LLGISLGPLAPWILWALWLARNDRIFNNKGTTPEEVITKATAAAQEW---------LREQ  927

Query  471   QHQYITKWIRPMQ------GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
              ++ I +   P Q       +  L  DAA   +    GLGW++   H    S+  +    
Sbjct  928   GNEPIIRNNPPPQRPLDTAHYACLQSDAAWRSDLHLAGLGWMVTEGHQA--SSLMSHCFY  985

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLL  130
             V SP  AE LA+REA+ +C  + +  +  ESDSL ++  L+    ++    ++ADI +L+
Sbjct  986   VSSPLIAEGLALREAMFYCIAKGLRAVKCESDSLQLIRALNEETPISEIYGIIADILNLV  1045

Query  129   STF  121
               F
Sbjct  1046  VAF  1048



>ref|XP_009115910.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=869

 Score =   245 bits (626),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 156/527 (30%), Positives = 260/527 (49%), Gaps = 26/527 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S  + W+ ++LS  G+EVLLKS+  A+P ++MN+F LP+ +  +I   +  F WGN D  
Sbjct  274   SVTQGWSKKYLSHGGKEVLLKSIALAMPIFSMNVFRLPKEVCEEINGVLAKFGWGNTDK-  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W AW ++ VPK+ GG+GFR +++FN ALL KQ WR+  HP+ L A++++A+Y+ +
Sbjct  333   -KGMHWYAWKRVSVPKREGGLGFRDLQNFNQALLGKQVWRILQHPDCLMARVIRARYFAD  391

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
                 DA +    S+ W S+L  K +++   R+ IG+G    +W D WLP V+ PR     
Sbjct  392   GNILDAVQKRKASYAWKSILYGKELVKQGLRYVIGDGTLTNLWTDPWLP-VHPPRPPRAR  450

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                     V  L+ + G GW+++ + D+    D   IL + I    + D + W  +E G+
Sbjct  451   DGVPLVGKVKDLIRSDGRGWNEQKLHDVVVEEDIDKILGVKIFSKAQWDLLGWHYNEDGI  510

Query  984   FTVKSCY-KAISLDLDSV------PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             ++VKS Y  +  L  + +       +     IW   +PP+   F+W+  S  L T   L+
Sbjct  511   YSVKSGYWLSTHLPTNELIQPVYGDVNLKKKIWATKMPPKIHHFLWKTLSRSLATGSNLK  570

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--------LFEPLPATSQAQSCSEW  670
              R +     C  C   EES  HIL +C +A   WR        + +P  AT +A+     
Sbjct  571   RRHVTNMDQCLRCCQGEESEKHILFDCIYAQSIWRASGISNSIIMDP-NATLEAK-MEVC  628

Query  669   ITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
             +  C  S      +L + + W IW++RN  ++++  +  + ++  +    ++W       
Sbjct  629   LQCCSSSTLSHLQNLPLWVLWRIWKSRNILLFQHKHINWRIILMQAHKDAQEWMNNQATV  688

Query  489   DQQ------RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
             D +      R +      +W RP  GW K NVD +   ++     GWV+R+  G++  A 
Sbjct  689   DSRAGVSSARGTYRNRRNEWRRPDTGWIKCNVDGSFTNSNIPSRAGWVIRDSRGVYQGAG  748

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLS  187
                   V +P E+E  AI  A+  C       I +E D    +H L+
Sbjct  749   QGIGQVVRNPLESELQAIIMAMQNCWSHGYKKIIIEGDCQKAIHLLN  795



>ref|XP_009150027.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=583

 Score =   240 bits (613),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 165/558 (30%), Positives = 263/558 (47%), Gaps = 64/558 (11%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +RI SW  +FL++ G+E+L+KS+ QALP+Y M+ FLLPQ +++ ++  +  FWW   +  
Sbjct  28    NRINSWTAKFLTKGGKEILIKSIAQALPTYVMSCFLLPQDVLNKLKSAIAKFWWSTKE-H  86

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KGL W AWDK+C P + GG+GFR +K+FNLALL+KQ WRL +HP SL A++MK +YY +
Sbjct  87    NKGLHWMAWDKICKPAEKGGLGFRDLKNFNLALLAKQLWRLLHHPTSLLARVMKGRYYRH  146

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +     +PS+ W S+L  K +++   R  IG+G + R+W D W+P    PR+    
Sbjct  147   TNPLEISSSNSPSYGWKSMLAAKDLLKKGLRHTIGSGYNTRVWFDQWIP-TQTPRL----  201

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                                     V+D    RD +L +        + D   W   + G+
Sbjct  202   ------------------------VKDNGTWRDPKLNI--------KADGFCWTHTKSGL  229

Query  984   FTVKSCYKAISLD---------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TVKS Y+  +L+         L+       S +W +  P + K F+WQ  +GC+     
Sbjct  230   YTVKSGYELATLEKCESDDQQVLEPSINPLLSKVWKLKAPRKIKHFLWQCLTGCIAVCSR  289

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE--PLPATSQAQSCSE-----  673
             L  R       CP C   EE+   +L EC  A Q W L +   +P    ++S  E     
Sbjct  290   LAERHCGNERACPRCGGDEETINDLLFECPPAVQTWALSDIPSIPGQFPSKSLLENFDFL  349

Query  672   WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
                   + +   R   F  I W +W++RN+K++  + +     ++N+     +W    +V
Sbjct  350   LFRATAKGISTQRLIKFPWIAWYLWKSRNDKLFNGVEISPLDSLQNASQESDEWCVAQDV  409

Query  492   ---DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACN  322
                   + R+   Y  + +   +   +  VDA+  IN    G G+VL    G   S +  
Sbjct  410   VLAGKARERAATVYREEMMESHKP--RCQVDASWAINQATFGGGFVLDKEDGSSISGSFG  467

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADI  142
                 V+SP  AE  ++  A+    R   + +H ESD L +V  +    +  S    LA  
Sbjct  468   R-NQVISPIHAEFQSLLWAMGNSLRLGHESMHFESDCLQMVKLIEEEEYWPS----LASE  522

Query  141   KDLLSTFCSLLYLFC*TF  88
              D      SL  LF  +F
Sbjct  523   LDEFFHLRSLFTLFSLSF  540



>ref|XP_009119675.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1046

 Score =   246 bits (628),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/536 (31%), Positives = 257/536 (48%), Gaps = 37/536 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  +FLS  G+EVLLK+V  ALP+Y M  FLLP+  +  I   ++ FWW NG+ + 
Sbjct  440   RVHGWQTKFLSPGGKEVLLKAVAMALPTYTMACFLLPKTTIKQIMALISEFWWRNGN-ES  498

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+RWK+W+ LC PK  GG+GF+ ++ +NLALL KQ WR+  +P SL AKI K++Y+ NS
Sbjct  499   RGMRWKSWESLCKPKTCGGLGFKDLEAYNLALLGKQLWRMIKNPTSLMAKIFKSRYFKNS  558

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A  G  PS+ W S+   + +IQ   R  IGNG   ++W + WL       I +  +
Sbjct  559   DPLNATLGSRPSYAWRSIHAAQKLIQQGARVVIGNGKDTKLWQERWLGATPATMIQSMKW  618

Query  1161  -------PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
                        +  V+ LL++ G  W+ E +  +F       IL I       +D  +W 
Sbjct  619   VENQGHGRLSEDMRVSELLSSSGREWNYEKLDGMFTEEIRNKILEIRPAGKNSKDTYVWD  678

Query  1002  KDEKGVFTVKSCY----KAISLDLDSVPI------ASWSTIWNVHLPPRAKTFIWQVCSG  853
               + G +TVKS Y      +S+D +   +      + +  +W +   P+ K F+W+  + 
Sbjct  679   YTKTGHYTVKSGYWVQTSVVSVDKEQSEVLQPSLDSFYQQVWKLQSSPKIKHFLWRCLNN  738

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE  673
              LP A  + +R I     C  C  V ES  H+L +C +A   W +     A         
Sbjct  739   ALPVAANMVYRHIGKDKRCSRCDGVAESINHLLFQCPYARLVWAV-----AHVHIPPEGR  793

Query  672   WITKCFESL--------QPPRASL---FVI-ICWNIWRARNEKVWKNICLPAKAVVENSK  529
             W    F +L        + P   +   FV  + W +W+ RNE V++    PA   V  + 
Sbjct  794   WSDSLFANLYWVLNQKTKYPTEEVDEEFVPWLLWRLWKNRNEFVFRGRDFPAHITVRKAW  853

Query  528   ALWRDWKACTEVDDQQRRSQHQYI--TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRN  355
                 DWK+  EV ++  +         +WI P     K N D A    +   G+GW+LR+
Sbjct  854   EDVMDWKSRIEVQEEVAKEPAVVSPDKRWIPPAPMTLKCNTDGAWSKETGVGGVGWLLRD  913

Query  354   HHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLS  187
             H G    A       + S  E EA AIR A+        + + +E+DSL++ + L+
Sbjct  914   HQGTLLWAGAKKMAVMRSALETEAEAIRWAIQTLLGFGYNRVSIETDSLLLANMLN  969



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score =   249 bits (635),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 159/549 (29%), Positives = 267/549 (49%), Gaps = 26/549 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSRAG+E+L+K+V QA+P++AM  F L + L   I + +  +WW N +   
Sbjct  1004  RIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDN  1063

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL +PK  GG+GFR I  FNLA+L+KQ WRL   P+SL +++++AKY+P  
Sbjct  1064  K-MHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1122

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F  K+  N S+ W S+ +   ++Q    WR+G+G  + IW D W+P   + +  TP  
Sbjct  1123  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRMGDGSKINIWADPWIPRGWSRKPMTPRG  1182

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +    G+ WD++++   F   D   I SIP+     ED + W  D +G F
Sbjct  1183  ANLVTKVEELIDPYTGT-WDEDLLSQTFWEEDVAAIKSIPV-HVEMEDVLAWHFDARGCF  1240

Query  981   TVKSCYKAI-----SLDLDSVPIAS---------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TVKS YK           +  P  S         W  +W + +P + K F+W++C   L 
Sbjct  1241  TVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLA  1300

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEW  670
                 L+HR +D    C +C    E A H+  +C    + W+    E L +  + Q+  + 
Sbjct  1301  LRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVWQALNLEELRSMLEQQTSGKN  1360

Query  669   ITKCFESLQPPRASLFVIIC-WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             + +     +P       I+C W  W+ RNE     I    ++  E S  +         +
Sbjct  1361  VLQSI-YCRPEIERTSAIVCLWQWWKERNEVREGGI---PRSPAELSHLIMSQAGEFVRM  1416

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
             + +++  +      W RP   + K+N D A   N ++ G G+V+R+  G    A      
Sbjct  1417  NVKEKSPRTGECAVWRRPPLNFVKINTDGAYSSNMKQGGWGFVIRDQTGAVLQAGAGPAA  1476

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKD  136
              +     AE +A   A+     + +  I +E+DS+++ + +   +F ++S   ++ +IK 
Sbjct  1477  YLQDAFHAEVVACAAAIKTASERGMSRIELETDSMMLRYAIQDNSFNLSSLGGVILEIKH  1536

Query  135   -LLSTFCSL  112
              +LS F S 
Sbjct  1537  IILSCFHSF  1545



>ref|XP_009148188.1| PREDICTED: uncharacterized protein LOC103871664 [Brassica rapa]
Length=743

 Score =   243 bits (620),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/542 (30%), Positives = 260/542 (48%), Gaps = 24/542 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             + + W +++LS AG+ V+L+SV+ A+PSY M+ FL+P  L   ++     FWW   + + 
Sbjct  169   KARGWKNKYLSTAGKLVMLQSVLTAVPSYPMSNFLMPVSLCKRLQSAATRFWWDRDENER  228

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WD +  PK  GG+GFR  + FN+ALL+K  WRLF +P+ L  K++  KY  +S
Sbjct  229   K-MAWISWDSMAQPKANGGLGFRDFQSFNIALLAKIGWRLFQNPDCLLGKVLFGKYCHDS  287

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A +  + S  W S+L  + ++  N  W +GNG S+ IW+D WL      R   PP 
Sbjct  288   NILQATESSSMSHGWRSVLAGRNLLLENLGWVVGNGTSINIWNDPWLSLAYQERPMGPPN  347

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                +  +V+ L+N     WD   ++ I    + Q++   P   G   DK +W+  + G +
Sbjct  348   EPHSQFTVSDLINPATRDWDVSKIKLILPFYEEQILCFKPSLTGA-PDKQVWLATKSGDY  406

Query  981   TVKSCYKA------ISLDLDSVPIASW-STIWNVHLPPRAKTFIWQVCSGCLPTADLLRH  823
             T KS Y           D+ +     W S +WN+   P+ K F W++  G +P  + L  
Sbjct  407   TTKSGYYTAVTRVETRQDITTDHGFKWRSNVWNMQCAPKVKLFSWKLLKGAIPVGERLVQ  466

Query  822   RRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC----SEWITKCF  655
             R +   P C  C    ES  H+  +C F  + W+L  PL             S W T C 
Sbjct  467   RHVPADPRCKRC-GCSESIIHLFFQCGFTQRVWQL-APLNTDMDFSGIIDLMSSWETLCS  524

Query  654   ESLQPP----RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
                 PP      SL   + W+IW+ARN+ V++      +  +  +  L R+W   TEV  
Sbjct  525   LKCLPPAGIISGSLTPWLLWSIWKARNKFVFEGHSASPEETLSGAIVLAREWN--TEV-K  581

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGV  307
             ++  +  +++   I        +  DAA    S   GLGWVL +H G  + +       V
Sbjct  582   KEPLTGIRHLPAPILTHPEATVIRSDAAWAPGSNIAGLGWVLLSHSG--NQSFKVPLKSV  639

Query  306   LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLS  127
              SP  AE LA+REA+  C    ++Y+  ESDSL ++  +     +     ++ADI    S
Sbjct  640   ASPLLAEGLALREAVRSCATLGLNYVAFESDSLNLIKAVKLEVTIAELYSVIADITSFAS  699

Query  126   TF  121
              F
Sbjct  700   VF  701



>ref|XP_007214195.1| hypothetical protein PRUPE_ppa020989mg [Prunus persica]
 gb|EMJ15394.1| hypothetical protein PRUPE_ppa020989mg [Prunus persica]
Length=489

 Score =   237 bits (605),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/506 (31%), Positives = 246/506 (49%), Gaps = 39/506 (8%)
 Frame = -2

Query  1653  VLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKK  1474
             V LK V QA+P Y MN FL+P+ L ++I++ M  +WWG  D Q K + W +W+KLC+PK+
Sbjct  4     VALKVVAQAVPIYMMNCFLIPKCLCNEIQQVMARYWWGEQDGQRK-IHWLSWNKLCLPKQ  62

Query  1473  WGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWA  1294
              GG+GFR +  FN+ALL+KQ WRL   P +L A+I+KA+Y+ N    +A+ G +PS++W 
Sbjct  63    EGGLGFRNLYAFNMALLAKQLWRLIQTPNALVARILKARYFKNCSILEAQIGHSPSYIWQ  122

Query  1293  SLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHG  1114
             SL +                  VRIW D WLP+  + ++++P       A VN ++N   
Sbjct  123   SLAKH----------------VVRIWGDQWLPNSESFQVSSPQAEGFEEAKVNYVINPVT  166

Query  1113  SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKS-----CYKAISL  949
               W ++++   F+  +   I +IP+      D +IW  +  G +TV+S     C   +  
Sbjct  167   MQWREDLLHAWFSPEEVNCIRNIPLSFRHPPDTLIWHFERGGQYTVRSSHEVACRVLLQQ  226

Query  948   DLDSV-----PIAS----WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLC  796
             D D       PI +    W  IW   +PP+ + FIW      LPT D L H  I      
Sbjct  227   DRDDTNTNEGPIVAFEHVWKKIWKARVPPKVRIFIWHALLNILPTKDNLIHHVISELGGY  286

Query  795   PLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWIT--KCFESLQPPRASLF  622
               C   +E+  H+L  C      W LF P+ A     +  E+    + F +  P      
Sbjct  287   VFC-GADETVAHVLLRCPMTITSWSLF-PVWAHFNTDAIEEFKMWFQGFATDHPLHVLEK  344

Query  621   VIIC-WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYITKWI  445
             V++C W +W  RN+  W      A  +V  +    ++++   EV  + +    + I KW+
Sbjct  345   VMVCLWMLWYERNQMAWAGRQRSATEIVSGAMHYLQEFQ---EVHPRPKTHTSRAIAKWV  401

Query  444   RPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREA  265
             RP  G  K+NV+      S   G+G V+RN  G   +       G+ +P  A+ +A+RE 
Sbjct  402   RPPPGAIKINVNGVFHGESSFGGVGLVVRNSTGAILACKLVVLNGISNPMHAKLVALREG  461

Query  264   LSWCKRQHIDYIHVESDSLVVVHGLS  187
             L +  +      H+E DS   +H + 
Sbjct  462   LIYAAKWSNLECHIEEDSQGALHSIQ  487



>gb|EEE53388.1| hypothetical protein OsJ_36435 [Oryza sativa Japonica Group]
Length=740

 Score =   243 bits (619),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 155/472 (33%), Positives = 233/472 (49%), Gaps = 37/472 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+ SW+ +F+S   +EVL+KSV QA+P+Y M +F LP        + +  FWWG+ D   
Sbjct  217   RMNSWSEKFMSSGAKEVLIKSVAQAIPTYMMGVFKLPASTCDVYTKMIRDFWWGD-DENK  275

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W AW+ L +PK  GG+GFR ++ FN ALL +QAWRL  + ESL A+I+KAKYYPNS
Sbjct  276   RKVHWIAWENLVLPKGLGGLGFRDLRLFNQALLGRQAWRLIQYLESLCARILKAKYYPNS  335

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  DA    + S  W  +     +++    WRIG+G  V IW D W+P  +       P 
Sbjct  336   ELIDAVFPVDSSPSWKGIEHGLHLLKKGLVWRIGDGSKVNIWRDQWIPKES----AFKPM  391

Query  1161  PYlanas--vnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                      V+ L+      WD+E++R +    DA+ IL I I Q P ED   W  +  G
Sbjct  392   GRSRCRLRWVSQLMVPREKCWDEELIRHVCYPHDAEDILKIKIMQFPVEDFPAWHYERTG  451

Query  987   VFTVKSCYKAISLDLDSVPIAS------------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             V++V+S Y+ I+L   +   A             W  IWN+  PP+ K F W++   CL 
Sbjct  452   VYSVRSAYR-IALSCQASSTAGSSSSSPSGERRIWRNIWNLQAPPKVKIFAWRLARDCLA  510

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQAQSCS-  676
             T    + R++     C  C   EE  FH +  C+ A       R +  LPA  +  +   
Sbjct  511   TQRNRKSRKLVSDSTCRTCGGEEEDGFHAVISCTRAKALRKEMREYWRLPADEELTNYGP  570

Query  675   EWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAK--AVVENSKALWRDWKAC  502
             +W+    E L     + FV++ W  W  RN+   +N C   +  +V  + ++  ++ +A 
Sbjct  571   DWLLLILEKLGTEERAQFVLVLWRSWFLRNDNQTRNNCRHQRKSSVPVSLQSKLKEEEAP  630

Query  501   TEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
               V+            KW  P  GW K+NVD A    + K G G ++RNH G
Sbjct  631   VRVN-----------IKWKAPPIGWAKVNVDGAYVAATGKAGAGIIIRNHMG  671



>emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera]
Length=1793

 Score =   248 bits (634),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 195/325 (60%), Gaps = 19/325 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +RI++WN R LSRAG+E+ LK+V Q++P+Y M L LLP+ L  DIE  MN F+W + + Q
Sbjct  1329  NRIQNWNGRRLSRAGKEICLKTVAQSIPTYVMQLLLLPKDLCRDIESMMNXFFW-DSNPQ  1387

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + +RW +W K+C  KK GG+GFR+++DFNLALL+KQ  R   + +SL   I +A+Y+ N
Sbjct  1388  XRSIRWMSWXKMCKQKKDGGLGFRKLEDFNLALLAKQGXRFLQNLDSLVTIIFQARYFRN  1447

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F +A+ G NPS++W S+L  + +++  C W I +G  V++W D+WLP+ +N  I TP 
Sbjct  1448  SSFLNAELGSNPSYMWRSILAAQDLLKMGCYWSIASGTKVQVWGDSWLPNSSNRLIITPH  1507

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                     V+ L+      W ++ +RD F  RDA LILSIP+P   RED++ W  D +G 
Sbjct  1508  VADFDGIKVDELITK--GLWHEDFIRDKFMGRDADLILSIPLPMSSREDQISWSFDARGE  1565

Query  984   FTVKSCYKA----------ISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             +T +S Y A          ++ D+DS  +  W+ +W V  PP+   F W+V   CLP   
Sbjct  1566  YTARSGYGALRCFRQSAALVASDVDSNFV--WAQLWKVTTPPKILNFAWRVARNCLPRNG  1623

Query  834   LLRHRRIDCSPLCPLCLNVEESAFH  760
              +RH +     +   C  + ES FH
Sbjct  1624  RIRHSQ----QVVNSCFTMLESWFH  1644



>ref|XP_010430691.1| PREDICTED: uncharacterized protein LOC104714925 [Camelina sativa]
Length=1239

 Score =   247 bits (630),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 174/558 (31%), Positives = 267/558 (48%), Gaps = 35/558 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R   W+ + LS+ G+EV++KS+  A+P++ M+ F LP+ + S +   +  FWW + D +
Sbjct  660   GRTTGWSAKLLSKGGKEVMVKSIATAVPTFVMSCFRLPKTITSKLTSAVANFWWSS-DGR  718

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AWDKLC  K+ GG+GFR + DFN ALL+KQ WRL   P+SL A++ K +YY N
Sbjct  719   TGGMHWLAWDKLCCTKQMGGLGFRNVDDFNSALLAKQLWRLIEFPDSLFARVFKGRYYRN  778

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNW-LPDVNNPRITTP  1168
             S   +  +  +PS+ W S++    ++Q     R+G+G S+ IW D W L     P I+  
Sbjct  779   SNPMEPIRSYSPSYGWRSIVSACSLVQKGLIIRVGSGESISIWTDPWILAQFPRPAISKG  838

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
             PF    +  ++ L++     W  +V+ + F+  D +LI ++P+   P++D + W   + G
Sbjct  839   PFK-DPSLKISHLIDCRTRLWRMDVLSEHFDPVDVELIGALPLGSCPKDDTLGWHFTKNG  897

Query  987   VFTVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
              +TVKS Y A  L     P  +           +++WNV  PP+ + F+WQ  SGC+P +
Sbjct  898   RYTVKSGYHAARLTTQG-PFKAPGVGPEITSLLASVWNVRCPPKIQHFMWQALSGCMPVS  956

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKC  658
               LR R I C   C  C   EE+  H+L  C  A Q W L + +P  S            
Sbjct  957   RNLRRRGIACDLGCSRCGAEEETVNHVLFLCPPARQVWALSQ-VPVGSNCFPVESVFANM  1015

Query  657   FESLQP----PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEV  493
                L P       + F  I W +W+ARN KV+ NI    +  V  ++     W KA  E 
Sbjct  1016  DHFLDPKSPGSHVAAFPWILWFLWKARNAKVFDNITERPEETVRIAEGEALSWLKAQEEG  1075

Query  492   DD-----QQR--RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
             +D     Q R   S+ Q     +  +   ++  VD +   + R  G GW          +
Sbjct  1076  EDGVTLVQSRVAESRPQRPNGSLPLLFTGYRCFVDGSWKSDDRFAGAGWFCTQSQDQRPN  1135

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVE----SDSLVVVHGLSSPAFVTS  166
                 ++   LSP  AE     EA  W  R  I + + E    SD   +V  +SSP    +
Sbjct  1136  RGATNFRRSLSPLHAEV----EAFIWAMRCMIGHDYREVAFYSDCADLVKMVSSPLDWPA  1191

Query  165   FDLLLADIKDLLSTFCSL  112
             F   L DI+     F S 
Sbjct  1192  FSTYLDDIRMDREEFTSF  1209



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score =   248 bits (634),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 165/527 (31%), Positives = 267/527 (51%), Gaps = 31/527 (6%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             ++ W  R LS+AG+ +L+K+V QA+PSY M++F L +G+    +  +  +WWG+G  +  
Sbjct  780   LQGWQSRLLSKAGKTILIKAVAQAIPSYTMSVFKLSKGVCRIYQSKVANYWWGSGGKK-N  838

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             G+ W  WD LC  K  GG+GFR I+ FN ALL+K  WR+   P SLA ++++AKY     
Sbjct  839   GIHWCKWDLLCRNKMDGGLGFRDIECFNQALLAKTVWRIVMQPTSLANRVLQAKYVHGGD  898

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFP  1159
             +  A  G  PSF+W SL+  K ++    RWR+GNG ++RIW D WLP   + R+ TP F 
Sbjct  899   WAAAPIGPKPSFIWRSLVWGKKLLCAGIRWRVGNGTAIRIWEDKWLPSPWSFRVVTPRF-  957

Query  1158  YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFT  979
              + + +  S L    S WD   ++  F   DA  ILSIP+ +    D  IW     G +T
Sbjct  958   -MDSNTRVSTLMTSPSMWDVIFIQTHFLPVDADKILSIPVCERSGSDVAIWHYTNDGYYT  1016

Query  978   VKSCYKAISLDLDSVPIAS--------------WSTIWNVHLPPRAKTFIWQVCSGCLPT  841
             VKS Y  ++++L  V  ++              WS IW + +P + K F+W+ C   LP 
Sbjct  1017  VKSGY-WLAMELKQVGKSTSSSGEKGETNSNSVWSIIWGLSVPNKVKLFLWRACHAFLPC  1075

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWI  667
              + L  R++  S +C  C    ES  H L  C  A + W+      +    + QS S+ +
Sbjct  1076  VERLFKRKVCSSDICSRCGGASESVLHSLWACRIAQKVWKYSWLAGVVKLWKFQSFSDLL  1135

Query  666   TKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
              +           LF ++CW IW+ RN+ +     L    +V+  K    +W++      
Sbjct  1136  HRVAMEGTNKELDLFGLVCWWIWKCRNDTIHGKEGLKPDILVQRCK----EWQSELAQTQ  1191

Query  486   QQRRSQHQYITKWI-RPMQ----GWFKLNVDAALDINSRKMGLGWVLRN-HHGIFHSAAC  325
                +    ++ K I R  Q        L  D A+D  + ++G+G V+ N  HG+  + + 
Sbjct  1192  STNKPITGFVVKEIVRTPQVSNTSSSLLYFDGAVDKLNGRVGVGAVVLNPEHGLLGALSI  1251

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS  184
                +  L+PK  EALA+   + + K+  +  + +  D+L V++GL++
Sbjct  1252  PLPLS-LNPKATEALALWYGIEYGKKLGLLNVDIRGDALNVLNGLNT  1297



>gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana]
Length=1142

 Score =   246 bits (627),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 176/565 (31%), Positives = 277/565 (49%), Gaps = 47/565 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWG-NGDT  1528
             SRI  W+ +FLS+ G+EV++KSV   LP Y M+ F LP+ + S +   +  FWW  NGD+
Sbjct  558   SRINGWSAKFLSKGGKEVMIKSVAATLPRYVMSCFRLPKAITSKLTSAVAKFWWSSNGDS  617

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
               +G+ W AWDKLC  K  GG+GFR + DFN ALL+KQ WRL   P+SL AK+ K +Y+ 
Sbjct  618   --RGMHWMAWDKLCSSKSDGGLGFRNVDDFNSALLAKQLWRLITAPDSLFAKVFKGRYFR  675

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
              S   D+ K  +PS+ W S++  + ++      R+G+G S+ +W+D W+P    PR    
Sbjct  676   KSNPLDSIKSYSPSYGWRSMISARSLVYKGLIKRVGSGASISVWNDPWIP-AQFPR----  730

Query  1167  PFPYla-----nasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
             P  Y       +  V SL+++  + W+ ++++++F+  D  LI ++PI     ED + W 
Sbjct  731   PAKYGGSIVDPSLKVKSLIDSRSNFWNIDLLKELFDPEDVPLISALPIGNPNMEDTLGWH  790

Query  1002  KDEKGVFTVKSCYKAISLDL---------DSVPIASWSTIWNVHLPPRAKTFIWQVCSGC  850
               + G +TVKS Y    LDL         D   + ++  IW V  PP+ + F+WQ+ SGC
Sbjct  791   FTKAGNYTVKSGYHTARLDLNEGTTLIGPDLTTLKAY--IWKVQCPPKLRHFLWQILSGC  848

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE--PLPATSQAQSCS  676
             +P ++ LR R I C   C  C   EES  H L +C  A Q W L +    P    + S  
Sbjct  849   VPVSENLRKRGILCDKGCVSCGASEESINHTLFQCHPARQIWALSQIPTAPGIFPSNSIF  908

Query  675   EWITKCFESLQPPRASL-FVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
               +   F  +     S  +  I W IW+ARNEKV++N+      ++  +    + W+   
Sbjct  909   TNLDHLFWRIPSGVDSAPYPWIIWYIWKARNEKVFENVDKDPMEILLLAVKEAQSWQEA-  967

Query  498   EVDDQQRRSQHQYITKWIRPMQ-------GWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
             +V+    R     I   IR            F+  +D +   + +  G GW   +  G  
Sbjct  968   QVELHSERHGSLSIDSRIRVRDVSQDTTFSGFRCFIDGSWKASDQFSGTGWFCLSSLGES  1027

Query  339   HSAACNSWIGVLSPKEAEALAIREALSWCKR-------QHIDYIHVESDSLVVVHGLSS-  184
              +    +    LSP   E     EAL W  +       Q++ +    SD + +V   +  
Sbjct  1028  PTMGAANVRRSLSPLHTEM----EALLWAMKCMIGADNQNVAFFTDCSDLVKMVSSPTEW  1083

Query  183   PAFVTSFDLLLADIKDLLSTFCSLL  109
             PAF    + L +D ++  +   SL+
Sbjct  1084  PAFSVYLEELQSDREEFTNFSLSLI  1108



>ref|XP_010495286.1| PREDICTED: uncharacterized protein LOC104772356 [Camelina sativa]
Length=1158

 Score =   246 bits (628),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 168/552 (30%), Positives = 259/552 (47%), Gaps = 36/552 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR++ W  + LS  G+EVLLK+V  ALP YAM+ F L +     I   M  FWW N   +
Sbjct  562   SRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWW-NAVEE  620

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W +W+K+C  K  GG+GFR I  FN ALL+KQAWRL + P SL A++ KA+Y+P+
Sbjct  621   KQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARYFPS  680

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A  G  PS+ W S+L  + +++      IG+GL   +W D W+ D   PR     
Sbjct  681   ISFMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFD-ELPRRPCNK  739

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                +      S L  +   W+ + ++++F   D   I S P P    +D+++W     G 
Sbjct  740   EQMINLNLRVSELITNQGDWNLQALQELFPPCDVIKIRSFP-PDTRLQDRLVWAYTNNGH  798

Query  984   FTVKSCY----KAISL-----DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             ++VKS Y    KA+ +     +   V       +W V   P+ + F+W+V SG +  AD 
Sbjct  799   YSVKSGYWLSSKAMEVPGGESEGSRVLNELKQKVWTVETAPKIRMFLWRVLSGAIAVADC  858

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKCF  655
             +R+  +  +P+C +C + +E+  H L  C  A+  W     PLP    + S SE I  C 
Sbjct  859   MRNHGLQVNPICQVCRSADETVSHALFLCPVASTVWSATALPLPVQGFSTSVSENIGHCL  918

Query  654   ESLQP---PRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
               +     P +    I  I W IW+ARN  V+ N       ++  + A   +W    E+ 
Sbjct  919   RLITNTDLPSSLRLAIPWILWEIWKARNGMVFNNKLQDHHVLIAGAVADAEEWLKLNELQ  978

Query  489   DQQRRSQHQYI------TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG--IFHS  334
              Q++RS    +       +W +P  G  K N++A+   +    G  W+LRNH G  +FHS
Sbjct  979   KQEQRSVVGIMRGGMSQKRWTKPAFGILKCNINASWASSQHYAGGAWILRNHVGDVLFHS  1038

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQ----HIDYIHVESDSLVVVHGLSSPAFVTS  166
                        P      A  + L WC        I    V +D   V+  L  P     
Sbjct  1039  RHA------FLPTVNRIAAELQCLLWCLESLQILQILSFEVWTDCDAVIQALEKPQAWPK  1092

Query  165   FDLLLADIKDLL  130
             +  LL  I  ++
Sbjct  1093  YRSLLHKISQVM  1104



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   248 bits (633),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 158/549 (29%), Positives = 266/549 (48%), Gaps = 26/549 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSRAG+E+L+K+V QA+P++AM  F L + L   I + +  +WW N +   
Sbjct  1031  RIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDN  1090

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL +PK  GG+GFR I  FNLA+L+KQ WRL   P+SL +++++AKY+P  
Sbjct  1091  K-MHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1149

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F  K+  N S+ W S+ +   ++Q    WR+G+G  + IW D W+P   + +  TP  
Sbjct  1150  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRG  1209

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +    G+ WD++++   F   D   I SIP+     ED + W  D +G F
Sbjct  1210  ANLVTKVEELIDPYTGT-WDEDLLSQTFWEEDVAAIKSIPV-HVEMEDVLAWHFDARGCF  1267

Query  981   TVKSCYKAI-----SLDLDSVPIAS---------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TVKS YK           +  P  S         W  +W + +P + K F+W++C   L 
Sbjct  1268  TVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLA  1327

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEW  670
                 L HR +D    C +C    E A H+  +C    + W+    E L +  + Q+  + 
Sbjct  1328  LRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVWQALNLEELRSMLEQQTSGKN  1387

Query  669   ITKCFESLQPPRASLFVIIC-WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             + +     +P       I+C W  W+ RNE     I    ++  E S  +         +
Sbjct  1388  VLQSI-YCRPENERTSAIVCLWQWWKERNEVREGGI---PRSPAELSHLIMSQAGEFVRM  1443

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
             + +++  +      W RP   + K+N D A   N ++ G G+V+++  G    A      
Sbjct  1444  NVKEKSPRTGECAVWRRPPLNFVKINTDGAYSSNMKQGGWGFVIKDQTGAVLQAGAGPAA  1503

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDLLLADIKD  136
              +     AE +A   A+     + +  I +E+DS+++ + +   +F ++S   ++ +IK 
Sbjct  1504  YLQDAFHAEVVACAAAIKTASERGMSRIELETDSMMLRYAIQDNSFNLSSLGGVILEIKH  1563

Query  135   -LLSTFCSL  112
              +LS F S 
Sbjct  1564  IILSCFHSF  1572



>gb|EEC76169.1| hypothetical protein OsI_13484 [Oryza sativa Indica Group]
Length=1874

 Score =   248 bits (632),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 264/543 (49%), Gaps = 47/543 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  WN +++S   +EVL+KSV QALP+Y M +F +      D  R +  FWWG+ + + 
Sbjct  662   RMSDWNEKYMSSGAKEVLIKSVAQALPTYIMGVFKMTDKFCDDYTRMVRNFWWGHDNGER  721

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW+K+  PK  GG+GFR +K FN ALL++QAWRL   P+SL A++ KAKYYPN 
Sbjct  722   K-VHWIAWEKILYPKSHGGLGFRDMKCFNQALLARQAWRLLTSPDSLCARVFKAKYYPNG  780

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D       S VW  +     +++    WR+GNG +++IW   W+P   +  +     
Sbjct  781   NLVDTAFPTVSSSVWKGIQHGLDLLKQGTIWRVGNGHNIKIWRHKWVPHGEHINVLEKK-  839

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    VN L+N     W++ +VR +    DA  +L I +P    +D   W  ++ G+F
Sbjct  840   GRNRLIYVNELINEENRCWNETLVRHVLKEEDANEVLKIRLPNHQMDDFPAWHHEKSGLF  899

Query  981   TVKSCYK-AISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             TVKS YK A +L    V  +S           WS +WN  +  + K FIW++    LPT 
Sbjct  900   TVKSAYKLAWNLSGKGVVQSSSSTATSGERKIWSRVWNAKVQAKVKIFIWKLAQDKLPTW  959

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFA---TQCWRLFEPLPATSQAQ-SCSEW  670
             +  R R+I+ +  CP+C    E+++H   EC+ A    +  R    LP       +  +W
Sbjct  960   ENKRRRKIEMNGTCPVCGTKGENSYHATVECTKARALREALRAVWHLPGEDNFLWTGPDW  1019

Query  669   ITKCFESLQPPRASLFVIICWNIWRARNEKV-----------------WKNICLPAKAVV  541
             +    + +   + +  + + W  W  RN+ +                 ++ + LP + + 
Sbjct  1020  LLILLDGVNEEQRTHIMYMLWRAWYLRNDLIHGDGRCSIAGSVSFLTSYEEVLLPNRQMP  1079

Query  540   ENSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
             ++ K      K       +++    +  + WI P  G  K+NVDA   + + +   G V+
Sbjct  1080  DDIKGK----KPMYSEGQKEKHMAEKQSSGWIAPPDGAAKINVDAGFRMETGEASAGIVI  1135

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALA----IREALSWCKRQHIDYIHVESDSLVVVHG  193
             R+  G+   AAC +     S ++AEALA    IR AL W    H+  I +E+D+  VV  
Sbjct  1136  RDCRGLILLAACKTLHPCSSAEQAEALASLEGIRCALQWI---HMPVI-LETDNAEVVAR  1191

Query  192   LSS  184
             L +
Sbjct  1192  LKT  1194



>ref|XP_010451822.1| PREDICTED: uncharacterized protein LOC104734004 [Camelina sativa]
Length=1120

 Score =   245 bits (625),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/431 (33%), Positives = 223/431 (52%), Gaps = 17/431 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R   W+ R LS+ G+EV++KS+  A+P++ M+ F LP+ + S +   +  FWW + D +
Sbjct  660   GRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSS-DGR  718

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AW+KLC  K+ GG+GFR + DFN ALL+KQ WRL  +P+SL A+I+K +YY N
Sbjct  719   TGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRN  778

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   +  +  +PS+ W S++  + ++Q     R+G+G S+ IW D W+P   +PR     
Sbjct  779   SDPMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIP-AQSPRPALSK  837

Query  1164  FPYla-nasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P+   +  ++ L+++    W  +V+ D F+  D  LI ++P+   P++D + W   + G
Sbjct  838   GPFKDPSLKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHFTKNG  897

Query  987   VFTVKSCYKAISLD----LDSVPIAS-----WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TVKS Y    L       +V +        +++W V  PP+   F+WQV SGC+P + 
Sbjct  898   RYTVKSGYHVARLTKTGPFKAVGVGPEITSLLASVWKVRCPPKLHHFMWQVLSGCIPVSR  957

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              LR R I C   C  C   EE+  H+L  C  A Q W L + +P  SQ            
Sbjct  958   NLRKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQ-VPVGSQCFPVESVFANMD  1016

Query  654   ESLQP----PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
               L P       S F  I W +W+ARN KV++NI    +  V  ++     W    E  +
Sbjct  1017  HLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEGEAVSWHKAQEGGE  1076

Query  486   QQRRSQHQYIT  454
                 S    +T
Sbjct  1077  DGVNSDQPTVT  1087



>ref|XP_010490159.1| PREDICTED: uncharacterized protein LOC104767890 [Camelina sativa]
Length=1712

 Score =   247 bits (631),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 173/580 (30%), Positives = 269/580 (46%), Gaps = 54/580 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W   FLS  G+E+LLKS+  ALPS+ ++ F LP+ +   +   M  FWW N     
Sbjct  1105  KVSGWQTNFLSFGGKEILLKSIAMALPSHTISCFKLPKTVSQQLASVMADFWWRN-KQNS  1163

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             KG+ W+AW+ L  PK  GG+GF+ I+ +N+AL  KQ WR+  +P SL A++ K++Y+  S
Sbjct  1164  KGMHWRAWEHLSKPKSEGGLGFKEIEAYNIALFGKQLWRMLMNPNSLIARVFKSRYFSKS  1223

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLP-----DVNNPRI  1177
                 AK G  PSF W S+ E + +++   R  IGNG SV +W D WL       ++N  I
Sbjct  1224  SPLSAKLGSRPSFAWRSIHEAQELLKQGVRAIIGNGESVNLWQDPWLGSKPALSLHNVCI  1283

Query  1176  TTPPFPYlanasvnsllnNHGS--GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
                      +  +        S   W  +++  +F   D   I ++ +    R D   W 
Sbjct  1284  IPSDLHKSVSKLMKVKDIMEDSRRAWRQDLLDTLFTMEDRNSIGNLRLNGHNRSDSYTWD  1343

Query  1002  KDEKGVFTVKSCYKAIS--LDLDSVPIASW--------STIWNVHLPPRAKTFIWQVCSG  853
                 G ++VKS Y  ++  ++    P A          S +W     P+ + F+W+  S 
Sbjct  1344  YARTGQYSVKSGYWVLTQVINTQKGPQAVTQPSLNPLISQVWRTKASPKVQHFLWRCLSN  1403

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE  673
             CL  A  L HR +     C  C +  ES  H+L +C++A Q W L  P+PA S  +  + 
Sbjct  1404  CLSVAKNLSHRHLSRDNSCVRCPHEAESTNHLLFQCTYARQVWAL-SPIPAPSGGEWSNS  1462

Query  672   WITKCF-----ESLQPPRASLFVI---ICWNIWRARNEKVWKNICLPAKAVVENSKALWR  517
                  F      SL P R  L      + W +W++RNE ++K      +  VE +     
Sbjct  1463  LYANMFFVLNAASLYPQRDDLDKDVPWVLWRLWKSRNELIFKGKDFNPQNTVETALEDAE  1522

Query  516   DWKACTEVDDQQRRSQHQYIT------------KWIRPMQGWFKLNVDAALDINSRKMGL  373
             +W       DQ+++++H+ +T            KW  P + W K N D A        G 
Sbjct  1523  EW-------DQRKKNEHEKLTRGHPVPKRTEDAKWKLPPREWVKCNTDGAWRGEDTLSGT  1575

Query  372   GWVLRNHHG----IFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLV  205
             GWVLRN+ G    +   A   +++ +    EA   AI   L    R +   +  ESDSL 
Sbjct  1576  GWVLRNNTGDVLWMGAQAIRCAYLAMEVELEASGGAIHSML----RLNYTRVIFESDSLG  1631

Query  204   VVHGLSSPAFVTSFDLLLADIKDLLSTFCSLLYLFC*TFC  85
             +V+ L+S     +F  LL DIK L+S+F     ++    C
Sbjct  1632  LVNLLNSEEIWHAFAPLLYDIKCLISSFQDFKIVYVPRVC  1671



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score =   244 bits (622),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 172/565 (30%), Positives = 266/565 (47%), Gaps = 42/565 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W    LS AG+E+LLK+V  A+P+Y M+ F  P  + SDI   M  FWW NG+ +G
Sbjct  356   KIEGWKQSSLSLAGKEILLKAVATAIPAYPMSCFKFPASVCSDINGEMTRFWWKNGE-EG  414

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
               + WKAW+ LC  K  GG+GFR    FN+ALL+KQ+WR+  +P +   +I+KA+YYP+ 
Sbjct  415   SKIHWKAWESLCKSKDEGGLGFRHFSSFNIALLAKQSWRILQNPNASWVRILKARYYPDC  474

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F  AKKG   S+ W+SLLE +  +  + R +I +G +  IW D WLP  ++  I     
Sbjct  475   DFLKAKKGSRASWAWSSLLEGRDALIKDSRCQIFDGKNTNIWKDIWLPPPHDGIIKVREI  534

Query  1161  -PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P  A   V  ++      W  E+++     R  ++I    I    R+DKM+W     G 
Sbjct  535   VPPSAPQQVYEIMEKETHSWKLELIKPYVQPRTLEIIRCCTIANTERQDKMVWPWTTNGA  594

Query  984   FTVKSCYK-----------AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             ++VKS Y+           A      S+P   W  IW +   P+ K F+W+V S  + T 
Sbjct  595   YSVKSRYRRIHSRCSYLIHATGSTSHSIPKEVWVCIWKIESLPKIKMFLWRVLSNAISTR  654

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQ---SCSEWI  667
               L  R+I  SP+CP+C   EE+  H+L  C +    W    PL      +   S   W+
Sbjct  655   WNLYRRKILDSPVCPICGMEEETIEHLLFLCPWTNVVW-FGAPLNYKVDLRGFSSVDRWL  713

Query  666   TKC--FESLQPPRASLFV----IICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA  505
                  F+ +        +     ICW IW+ R   ++K+  +  +  ++      R  + 
Sbjct  714   KGVINFQGVSKREVQFLLTSISFICWEIWKTRCNFIFKSNHIDPRLTID------RAMQN  767

Query  504   CTEVDDQQRRSQHQY----------ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRN  355
             C E  D + +S   +             W  PM  + K+N D A   +S   GLG V R+
Sbjct  768   CREFLDAKVKSHVPFGDASVVPNILAQGWRPPMSNYVKINFDGAWKKDSHLAGLGVVARD  827

Query  354   HHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA-  178
               G F       +   L+   AEA A   AL +    +   I +E++S ++V G+     
Sbjct  828   AIGSFCGGLATPFHCNLA-LVAEAAAGLCALKFALNHNFTNIILETNSKILVEGVRGGGK  886

Query  177   -FVTSFDLLLADIKDLLSTFCSLLY  106
               V +   LL + K +   F S+L+
Sbjct  887   NGVWAIQPLLDEFKKISVCFRSVLW  911



>ref|XP_010468816.1| PREDICTED: uncharacterized protein LOC104748941 [Camelina sativa]
Length=988

 Score =   244 bits (622),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 270/545 (50%), Gaps = 18/545 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W+ + LS+ G+EV++KSV  ALP++ M+ + LP  L S +   +  FWW + D + 
Sbjct  279   RVNGWSAKILSKGGKEVMIKSVALALPTHVMSCYKLPTELTSRLTSVIAKFWWKSNDKE-  337

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +GL W AWD+LC  K  GG+GFR ++ FN A+L+KQ W+L ++P SL A++++ +Y+ NS
Sbjct  338   RGLHWVAWDRLCKDKSEGGLGFRALEQFNDAMLAKQYWQLIHYPSSLMARVLRGRYFWNS  397

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 AKK  +PSF W S+  TKG+++   RW IG G +V +W D W+PD+          
Sbjct  398   HPLQAKKPYSPSFAWWSIFSTKGLVEHGSRWAIGLGCNVSVWRDPWIPDIQPRSANGRGR  457

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L +  VN L+N +   W   ++ + F+  D Q+ILS+ + +  + DK+IW   + G +
Sbjct  458   QLLPSLMVNHLINPYTKEWHMPILEEFFDPVDIQIILSMEVSKSFKSDKLIWHFTKSGKY  517

Query  981   TVKSCYKAISLDLDSVPIASWST-----IWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             +VKS Y+     ++ V I    T     +W + +PP+ + F WQ+ SG LP  + L H+ 
Sbjct  518   SVKSGYRLARDLINEVEIGPTCTSLRAQVWKLQVPPKIQHFFWQIASGTLPVLERLAHQG  577

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF------  655
             + C PLC  C    E+  H L ECS   + W L      T      S +    F      
Sbjct  578   VRCDPLCTRCGLAVETINHALFECSRLRRIWDLSPVDLCTDGFPFASIYSNLDFLFWRAS  637

Query  654   -ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
              +S  P        I W+IW+ RN+KV++        V+ ++ +   D     E+  ++ 
Sbjct  638   SQSAVPDIGFHLPWIVWSIWKDRNKKVYQGFEAEPGDVLTHATS---DKLLWEELLWEEV  694

Query  477   RSQHQYITK--WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
             RS     T+   +       +  +D +   +    GLGW   N   +       S     
Sbjct  695   RSSLSTSTEPLTLEDQTPAPRCQIDGSWKASDPLEGLGWWFCNSEDVTQLLGARSQRRGP  754

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLST  124
             SP  ++  A+  A++      ++  + E+D   +V  + SP    +F  LL +   L S+
Sbjct  755   SPLHSDLHALIWAMASILASGVNCQYFETDCAELVAMVQSPDDWPAFSTLLDEFSLLRSS  814

Query  123   FCSLL  109
             F S +
Sbjct  815   FPSFM  819



>ref|XP_008367096.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=924

 Score =   243 bits (621),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 155/523 (30%), Positives = 257/523 (49%), Gaps = 27/523 (5%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
               +++ W    LS AG+EVL+K+VIQA+P+Y MN+F  P    ++++  ++ FWWG+   
Sbjct  320   LEKVQGWKQSTLSSAGKEVLIKAVIQAIPAYPMNIFKFPANFCNELDSIISNFWWGHNGN  379

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
             + + + W + + + +PK  GG+GFR  +DFN ALL+KQ WRL +   SL A++MKA+Y+P
Sbjct  380   KRR-IHWVSKNIMGLPKAEGGLGFRSFRDFNDALLAKQCWRLLHDKHSLWARVMKARYFP  438

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD--VNNPRIT  1174
             +  F DAK+GG  S+ W+SLL  + ++     W+I NG  VR+W D WLP   V +P + 
Sbjct  439   HCSFLDAKRGGRASWAWSSLLSGRDLLLBESHWQIFNGKXVRVWLDRWLPTLPVGHP-LP  497

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                     N  V+ LL+    GWD + ++   ++ +   I    I     +D+++W  D 
Sbjct  498   RGDVQVSRNTPVSXLLSPEXDGWDIDFLKPFISAXEFVAIQETQIGVPCLDDRLVWPFDR  557

Query  993   KGVFTVKSCYKAISLDLD-----------SVPIASWSTIWNVHLPPRAKTFIWQVCSGCL  847
              G++TVKS Y  +    +           +VP   W  IWN++ PP+ + F+W+     L
Sbjct  558   XGLYTVKSGYHCVHAKREQRVNFGSSSSVTVPGKLWKAIWNLNTPPKLRVFLWKTVHNAL  617

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSE  673
              T   L  R +  SPLCP+C   EE+  H+   C +    W   +       S   S   
Sbjct  618   ATLAGLFRRLVAPSPLCPICQIHEETIEHLFLLCPWVEVIWFGGMLSHRIIRSSISSWVN  677

Query  672   WITKCFESLQPPRASLFVII------CWNIWRARNEKVWKNICLPAK---AVVENSKALW  520
             W+     +    +A +  ++      CW+IW++R   +++N  +  +   A ++ S + +
Sbjct  678   WLVNITNTTLNSKAEMXRVLSYVAFTCWHIWKSRCNFLFQNGSINPRNVLAAIDTSVSAF  737

Query  519   RDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
              +      +         Q   +W  P   + K+NVDA+ +  +     G V+R+  G F
Sbjct  738   SEASRNKVIRPSMPNPAAQVPARWCLPPPPFVKINVDASWEXGTXSGFSGVVVRDSAGTF  797

Query  339   HSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDS  211
               AA        S    EA+AIR           + I +ESDS
Sbjct  798   -IAARRGCFAAHSAAVXEAIAIRHGCELGVAMGFNLIVIESDS  839



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/444 (32%), Positives = 223/444 (50%), Gaps = 23/444 (5%)
 Frame = -2

Query  1428  LLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRW  1249
             +L +Q WRL   P+SL A+I+KAKY+PN+ F  A  G NPS+ W S++    ++    R 
Sbjct  1     MLGRQCWRLLTRPDSLVARILKAKYHPNTNFSQASIGKNPSYSWRSIMAAHDLVLKGSRI  60

Query  1248  RIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSR  1069
             RIGNG    I +D WLPD++N  +++     L+ A+V +L  +    WD +++   F+ R
Sbjct  61    RIGNGTCTLIKNDPWLPDLSNGLVSSDLDDDLSVATVKTLFVDGRREWDVDLISSKFDER  120

Query  1068  DAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLDSVPIASWSTIWNVHLPP  889
             D  LIL+IP  +   ED   W+ +  GV++VKS Y+ +  ++  V    W  IW + +P 
Sbjct  121   DRNLILNIPPSKRNEEDVWYWLANTSGVYSVKSTYRLLLGEVSDVAGDMWRKIWKLEVPA  180

Query  888   RAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEP  709
             + + F+W+  S  LPTA  LR + +  + LC +    +E+  H+L +C FA  CW +   
Sbjct  181   KVRNFVWRAASNVLPTAVNLRSKHVSLNDLCLVGNFDKETVLHLLVDCPFARSCW-IKSK  239

Query  708   LPATSQAQSCSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSK  529
             +       S  +W+   F +    +  + V++CW +W  RN  VW+  C   K +V  + 
Sbjct  240   VGFFGIYSSFKDWLQALFRNCTNEQCWIAVMVCWKLWCNRNNLVWQGKCDTTKQIVNAAG  299

Query  528   ALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHH  349
                                       W  P  GW K N+DA +  N  ++GLG V+R+  
Sbjct  300   V---------------------GAVAWSPPRVGWLKCNIDATVFANEGRVGLGSVIRDES  338

Query  348   GIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL-SSPAFV  172
             G F +A C    G  SP++AE L+IREALS  K   +  + VE+D L   + L      +
Sbjct  339   GKFVAALCCHIRGNYSPRDAEVLSIREALSLLKSMKLSKVIVETDCLQAFNALVDRKCPL  398

Query  171   TSFDLLLADIKDLLSTFCSLLYLF  100
              SF  L+ D K +  +   + + F
Sbjct  399   NSFGSLVLDCKCIADSIGDIAFSF  422



>ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=950

 Score =   243 bits (620),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 155/554 (28%), Positives = 266/554 (48%), Gaps = 43/554 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W  + LS+AG+E L+K+V QA+PSYAM  F + + +  +I   +  FWW   + + 
Sbjct  350   RIHGWKEKLLSKAGKETLIKAVAQAIPSYAMACFDITKSVSDEISTMICRFWWAQMEKEN  409

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+ L   K  GG+G+R +  FNLA+L+KQAWR+  +PESL A+++ A+Y P+ 
Sbjct  410   K-VHWVSWEILSSRKDEGGLGYRNLHLFNLAMLAKQAWRILQNPESLCARLLTAQYCPSG  468

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                   +G   S+ W S++     ++    WRIG+G  VRIW D W+P   + +  TP  
Sbjct  469   DLLQVSEGSGISYTWRSIVRGFKALKNGLIWRIGDGSQVRIWDDPWIPTGISRQPRTPRG  528

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L +     +    G+ WD ++VR+IF   D   ILSIP+  G R+D + W  D KG+F
Sbjct  529   SVLLSKVEELIDPITGT-WDSQLVREIFWEEDVPNILSIPVRIG-RDDVIAWHHDRKGMF  586

Query  981   TVKSCY-----------------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSG  853
             +V+S Y                  ++           W  +W +  PP+ + FIW++   
Sbjct  587   SVRSAYHMLVDEERRQRKYQQGESSVCCREGDHETQKWKKLWKLPCPPKVRHFIWRLAHN  646

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE---PLPATSQAQS  682
              LP    ++ R +     CP+C+  +E   H   +C    +CWR+ E      A   ++S
Sbjct  647   SLPLKQNIKRRGVFLDTRCPVCMRFDEDGGHCFLKCKLIKRCWRILEMEQTRLALLSSKS  706

Query  681   CSEWITKCFESLQPPRASLFVIICWNIWRARNE-------KVWKNICLPAKAVVENSKAL  523
               +++    + L+   A    ++ W  W  RN+       +  +N+C    +V+E +  L
Sbjct  707   SKDFVWNVLQ-LEQSLACKVSLLLWKWWDVRNKVNAGDPIQNIQNVC---HSVLEMAGLL  762

Query  522   WRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
                     E+   + R   +   +W+RP QG  K+N D A    ++    G+++R++ G 
Sbjct  763   --------ELPTIKIRPTARLQQRWLRPPQGVLKINTDGAFVKATKHGAWGFIIRDYTGA  814

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
                A   +   +     AEA    +AL   +   I ++ +E DS V+   ++        
Sbjct  815   HVLAGAGNANLLHDALMAEAFGCLKALETAELYGISHVQLEVDSSVLKEAITCDTHDRGH  874

Query  162   -DLLLADIKDLLST  124
               ++  DI++LL+ 
Sbjct  875   CGVIFRDIRNLLAN  888



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   245 bits (626),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 169/570 (30%), Positives = 254/570 (45%), Gaps = 47/570 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W   FLS  G+E+LLK+V  ALP+Y M+ F +P+ +   IE  M  FWW N   +G
Sbjct  775   KVLGWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMAEFWWKN-KKEG  833

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +GL WKAW  L  PK  GG+GF+ I+ FN+ALL KQ WR+    +SL AK+ K++Y+  S
Sbjct  834   RGLHWKAWCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMITEKDSLMAKVFKSRYFSKS  893

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A  G  PSF W S+ E + +I+   R  IGNG ++ +W D W+     P       
Sbjct  894   DPLNAPLGSRPSFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWIGA--KPAKAAQAV  951

Query  1161  PYlanasvnsllnNH---------GSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMI  1009
                   S  +  + H         G  W+  +V  +F     + IL++        D+  
Sbjct  952   KRSHLVSQYAANSIHVVKDLLLPDGRDWNWNLVSLLFPDNTQENILALRPGGKETRDRFT  1011

Query  1008  WVKDEKGVFTVKSCY--------------KAISLDLDSVPIASWSTIWNVHLPPRAKTFI  871
             W     G ++VKS Y              + +   LD +    +  IW + +PP+   F+
Sbjct  1012  WEYSRSGHYSVKSGYWVMTEIINQRNNPQEVLQPSLDPI----FQQIWKLDVPPKIHHFL  1067

Query  870   WQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ  691
             W+  + CL  A  L +R +     C  C +  E+  H+L +C FA   W +  PLPA   
Sbjct  1068  WRCVNNCLSVASNLAYRHLAREKSCVRCPSHGETVNHLLFKCPFARLTWAI-SPLPAPPG  1126

Query  690   AQSCSEWITKCFESL---------QPPRASLFVI---ICWNIWRARNEKVWKNICLPAKA  547
                  EW    F ++         QP  +    +   I W +W+ RN+ V+K     A  
Sbjct  1127  G----EWAESLFRNMHHVLSVHKSQPEESDHHALIPWILWRLWKNRNDLVFKGREFTAPQ  1182

Query  546   VVENSKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGW  367
             V+  +      W    E   Q   S      KW  P  GW K N D A   +    G+GW
Sbjct  1183  VILKATEDMDAWNNRKEPQPQVTSSTRDRCVKWQPPSHGWVKCNTDGAWSKDLGNCGVGW  1242

Query  366   VLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLS  187
             VLRNH G        +     S  E E  A+R A+    R +   +  ESDS  +V  + 
Sbjct  1243  VLRNHTGRLLWLGLRALPSQQSVLETEVEALRWAVLSLSRFNYRRVIFESDSQYLVSLIQ  1302

Query  186   SPAFVTSFDLLLADIKDLLSTFCSLLYLFC  97
             +   + S    + DI++LL  F  + + F 
Sbjct  1303  NEMDIPSLAPRIQDIRNLLRHFEEVKFQFT  1332



>gb|ABF97084.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1184

 Score =   244 bits (623),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 160/517 (31%), Positives = 255/517 (49%), Gaps = 36/517 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +RI     + LS  G+EVL+KS+ QA+P +AM++F +P+ +   I   +  FWWG+ D  
Sbjct  592   NRINGRKEKMLSTGGKEVLIKSIAQAIPVFAMSVFRIPKKICDCISEAIARFWWGD-DEN  650

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + WKAW ++C+PK+ GG+GFR +  FN A+L+KQ WR    P+SL A++M+ KYYP+
Sbjct  651   HRRIHWKAWWRMCIPKQRGGLGFRDLYCFNRAMLAKQIWRFLCDPDSLCARVMRCKYYPD  710

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
                  A+     S+ W S+L      +G   WRIG+G  V IW D+ +P  +N ++ TP 
Sbjct  711   GNILRARPKKGSSYAWQSILSGSECFKGYI-WRIGDGSQVNIWEDSLIPSSSNGKVLTPR  769

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                +       +    G GWD++++  +F   DA  IL IPI  G RED + W     G+
Sbjct  770   GRNIITKVEELINPVSG-GWDEDLIDTLFWPIDANRILQIPISAG-REDFVAWHHTRSGI  827

Query  984   FTVKSCY----KAISLDLDSVPIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             F+V+S Y     A     + +P  +       W  +W + +PP+ K F W++  G +P  
Sbjct  828   FSVRSAYHCQWNAKFGSKERLPDGASSSSRPVWDNLWKLEIPPKIKIFAWRMLHGVIPCK  887

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLF------EPLPATSQAQS--  682
              +L  + I     CP+C +  E   H++  C  A   W+        +P+    ++ S  
Sbjct  888   GILADKHIAVQGGCPVCSSGVEDIKHMVFTCRRAKLIWKQLGIWSRIQPILGFDRSGSVL  947

Query  681   CSEWITKCFESLQPPRASLFVII---CWNIWRARNEKVW-KNICLPAKAVVENSKALWRD  514
               E I K  +        +  +I    W IW  R + V  + I  PA++ +  +      
Sbjct  948   VEEMIRKGGKVSHLNAIGMTELILTGAWYIWWERRQLVQGERIQNPARSAMSIA------  1001

Query  513   WKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
                 T      ++ + +    W +P +G   +NVDAA D +S   G+G VLR+H G   +
Sbjct  1002  -TLTTNYMLSNKKGKTKIQNGWKKPPEGMLMINVDAAFDFDSGSGGIGVVLRDHLGACVA  1060

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHV  223
             A+      VL    AEA A+R+ LS    QHI   +V
Sbjct  1061  ASQAFLPHVLDAPMAEAFALRDGLSLA--QHIGAKNV  1095



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score =   243 bits (619),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/340 (39%), Positives = 199/340 (59%), Gaps = 14/340 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS AG+EVLLK V Q++P Y MN FLLPQGL  +IE+ M  FWWG    + 
Sbjct  344   KLQGWREQTLSIAGKEVLLKVVAQSIPLYVMNCFLLPQGLCHEIEQMMARFWWGQ-QGEN  402

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W  W++LC  K  GGMGFR ++ FN+A+L+KQ WRL ++P SLA++++KAKY+P++
Sbjct  403   RKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPHT  462

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F++A  G  PS VW S+   + +++   R++IG+G SVRIW D W+P      + T P 
Sbjct  463   NFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPAAFVVITSPL  522

Query  1161  PYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               + N  V+ L+ N GS  WD + + ++F   D    + IP+      D+++W  D+ G+
Sbjct  523   DGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVDFVRIPLSIRAPPDRIVWNYDKHGL  582

Query  984   FTVKSCYKAISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             FTVKS Y+ ++L + S                W  IWN  +P + K F W+V    LPT 
Sbjct  583   FTVKSAYR-VALRVTSGDEDESSSSNSDTSMLWRHIWNATVPTKLKIFAWRVAHDILPTK  641

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL  718
               L  + +D   +C  C ++ ESA H+LA C FA   W +
Sbjct  642   ANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAVATWNI  681



>ref|XP_004305156.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=813

 Score =   241 bits (615),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 245/533 (46%), Gaps = 55/533 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LS AG+ +L++ V QALPSY+M+ FLLP+   + + +    FW G+   + 
Sbjct  276   KLEGWQGKLLSGAGKGILIRVVAQALPSYSMSCFLLPKSFYAALHQKCARFWLGS-KQED  334

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+KLC PK+ GGMGFR +   N+A+L+KQ WR+   P+SL A++ +A+Y+P+S
Sbjct  335   RKIHWLSWEKLCRPKERGGMGFRDLYAHNIAMLAKQGWRILQFPDSLVARLFRARYFPSS  394

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F+ A    + S  W  + E + ++    RW++G+G  V IW D WLP    P  +  P 
Sbjct  395   SFWSA-TATDGSACWKGIAEARSVLARGMRWQVGDGTRVCIWEDPWLP---RP-FSFKPL  449

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               +    V          W+  +V  +F++ DA+LILSIPI    R D+++W  D KG F
Sbjct  450   YRVNTHIVLVSELISDFVWNRNLVNILFDASDAELILSIPISSRGRADRLVWHHDAKGAF  509

Query  981   TVKSCYKAISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHR  820
             T KS Y   +  L S    S      W  IW  ++P + K   W+ C   LPT   LR +
Sbjct  510   TTKSAYWQAAQWLHSSASTSSQVEQIWHHIWRSNVPRKVKINAWKACGSILPTVSQLRTK  569

Query  819   RIDCSPLCPLCLNVEESAFHILAECSFATQ--CWRLFEPLPATSQAQSCSEWITKCFESL  646
              +    LC LC +  E   H++ +C +  +  C    E         SC +W+  C   +
Sbjct  570   HVYIDALCYLCNSAVEIVEHVVRDCPYVREVLCCSALEECFEVEPNISCLDWLELCHSQI  629

Query  645   QPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQH  466
                     +   W++W+ RN ++WKN                                QH
Sbjct  630   PKELFEKLLWGIWSVWKERNCRLWKNT------------------------------QQH  659

Query  465   QYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAE  286
                        G  K NVDAA D      GL    R+  G      C     V +    E
Sbjct  660   ----------VGQIKANVDAAFDSVLHCGGLDVAFRDSMGCLVGGCCVRVDFVHNAVMVE  709

Query  285   ALAIREALSWCKRQHIDYIHVESDSLVVVH-GLSSPAFVTSFDLLLADIKDLL  130
             AL  R A     +     +  ESD L VV    S  + ++ +  L+ADI+ LL
Sbjct  710   ALVARLACQVALQLQFSPVVFESDCLKVVKDAQSGVSDLSGYGTLIADIQSLL  762



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   245 bits (625),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 169/559 (30%), Positives = 263/559 (47%), Gaps = 35/559 (6%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LSRAG+EVL+K+V+QA+P+Y MN+F  P  L  +++  +  FWW +  
Sbjct  725   ILGKLQGWKQXMLSRAGKEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSG  784

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + K + W + + L +PK  GGMGFR  ++FN ALL+KQ WRL   P+SL A++MKA+Y+
Sbjct  785   VRRK-IHWVSMETLGLPKHLGGMGFRNFQEFNDALLAKQCWRLIAEPDSLWAQVMKARYF  843

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN  F DA KGG  S+ W+SLL  + +I     W+I  G  VR+W D WLP + +     
Sbjct  844   PNCSFLDASKGGRASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWLPALXSGH---  900

Query  1170  PPFPYlanasvnsllnN-----HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIW  1006
              P P    A   +   +         WD E +    ++ +   I   PI    R+D++IW
Sbjct  901   -PSPLGEVAVTRNTRVSXIICPSSRTWDLEFLLPFLSAGECAAICDTPIGNPRRKDRLIW  959

Query  1005  VKDEKGVFTVKSCY---KAISLDL--------DSVPIASWSTIWNVHLPPRAKTFIWQVC  859
                  G+++VK  Y   +  SL L         SVP   W  IW + +P + + F+W   
Sbjct  960   ASTRNGIYSVKXGYLWLQLHSLSLRBHCSPXSRSVPELLWKGIWRIKVPAKVRNFLWSSL  1019

Query  858   SGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQ  685
                L T  +L  RR   +P+ P+CL  EES  H+   C +    W     +         
Sbjct  1020  HNALATVAVLFQRRSSLTPIXPICLCQEESIVHLFLSCPWVISIWSGGALKYNILVGSLS  1079

Query  684   SCSEWITKCFESLQPPRAS------LFVIICWNIWRARNEKVWKNI-CLPAKAV--VENS  532
             S   W+   F S     AS           CW+IW++R + V+  +  +P+K +  ++  
Sbjct  1080  SWGAWLHDVFTSNLGSSASKEWVRTYVAFTCWHIWKSRCDYVFNQVHIIPSKILMGIDLX  1139

Query  531   KALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
              A +   ++  E+       + +   +W  P+  + KLNVDA+    S+        R+ 
Sbjct  1140  VAEFLIARSTPEISRAVDHGRVRQPCRWTPPVSPFVKLNVDASWSRVSKAGFAAVXARDA  1199

Query  351   HGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFV  172
              G F  AA    I       AE LA+          +I  + VESDSL  +  LS+    
Sbjct  1200  RGDF-IAAVRYPIFASCVAMAEVLALXRGCELAVSLNISSVIVESDSLESISCLSNSLLN  1258

Query  171   TSFDL--LLADIKDLLSTF  121
              + +    LA+  DL  +F
Sbjct  1259  GNXEAYPFLANAWDLGESF  1277



>gb|EEC69465.1| hypothetical protein OsI_38661 [Oryza sativa Indica Group]
Length=725

 Score =   240 bits (612),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 155/474 (33%), Positives = 234/474 (49%), Gaps = 41/474 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+ SW+ +F+S   +EVL+KSV QA+P+Y M +F LP        + +  FWWG+ D   
Sbjct  202   RMNSWSEKFMSSGAKEVLIKSVAQAIPTYMMGVFKLPASTCDVYTKMIRDFWWGD-DENK  260

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W AW+ L +PK  GG+GFR ++ FN ALL +QAWRL  + ESL A+I+KAKYYPNS
Sbjct  261   RKVHWIAWENLVLPKGLGGLGFRDLRLFNQALLGRQAWRLIQYLESLCARILKAKYYPNS  320

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  DA    + S  W  +     +++    WRIG+G  V IW D W+      R  +   
Sbjct  321   ELIDAVFPVDSSPSWKGIEHGLHLLKKGLVWRIGDGSKVNIWRDQWI------RKESAFK  374

Query  1161  PYlanas----vnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
             P   +      V+ L+      WD+E++R +    DA+ IL I I Q P ED   W  + 
Sbjct  375   PMGRSRCRLRWVSQLMVPREKCWDEELIRHVCYPHDAEDILKIKIMQFPVEDFPAWHYER  434

Query  993   KGVFTVKSCYKAISLDLDSVPIAS------------WSTIWNVHLPPRAKTFIWQVCSGC  850
              GV++V+S Y+ I+L   +   A             W  IWN+  PP+ K F W++   C
Sbjct  435   TGVYSVRSAYR-IALSCQASSTAGSSSSSPSGERRIWRNIWNLQAPPKVKIFAWRLARDC  493

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQAQSC  679
             L T    + R++     C  C   EE  FH +  C+ A       R +  LPA  +  + 
Sbjct  494   LATQRNRKSRKLVSDSTCRTCGGEEEDGFHAVISCTRAKALRKEMREYWRLPADEELTNY  553

Query  678   S-EWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAK--AVVENSKALWRDWK  508
               +W+    E L     + FV++ W  W  RN+   +N C   +  +V  + ++  ++ +
Sbjct  554   GPDWLLLILEKLGTEERAQFVLVLWRSWFLRNDNQTRNNCRHQRKSSVPVSLQSKLKEEE  613

Query  507   ACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
             A   V+            KW  P  GW K+NVD A    + K G G ++RNH G
Sbjct  614   APVRVN-----------IKWKAPPIGWAKVNVDGAYVAATGKAGAGIIIRNHMG  656



>ref|NP_001060259.1| Os07g0613900 [Oryza sativa Japonica Group]
 dbj|BAF22173.1| Os07g0613900 [Oryza sativa Japonica Group]
Length=1453

 Score =   245 bits (626),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 170/556 (31%), Positives = 271/556 (49%), Gaps = 31/556 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSR G+EVL+K+V QA+P++AM  F L + +   I + +  +WW N + + 
Sbjct  907   RIQGWKEK-LSRTGKEVLIKAVAQAIPTFAMGCFDLTKDICEQISKMIARYWWSNQEKEN  965

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL  PK  GG+GFR I  FNLA+L+KQ WRL  +PESL A+++KAKYYP+ 
Sbjct  966   K-MHWLSWEKLTEPKWAGGLGFRDIHAFNLAMLAKQGWRLIQNPESLCAQVLKAKYYPSG  1024

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F AKK  N S+ W S+      ++    WR+GNG ++ IW D W+P  +  R  TP  
Sbjct  1025  NIFSAKKCANMSYTWRSICRGLLTLRDGMIWRVGNGAAINIWSDPWIPSDHTRRPITPRG  1084

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +  + GS WD E++   F   D  +I +IP+     +D + W  DEKG+F
Sbjct  1085  RNLVTRVEELIDPSTGS-WDVELLTQTFWPEDVNMIRTIPV-HIEMDDMLAWHYDEKGLF  1142

Query  981   TVKSCYKAISLDLD-------SVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             +VKS YK +  D +       S  +++        W  +W + LP + K FIW+     L
Sbjct  1143  SVKSAYK-VQRDGELQRRKRGSAGLSNGSTEREMYWKKVWKMQLPGKVKHFIWRFSHNIL  1201

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPL-PATSQAQSCS  676
                  L+ R +D    C +C  + E A H+  +C    + W+    E L    ++ +S  
Sbjct  1202  ALRVNLQQRGMDLDSRCIICNRMNEDAGHLFFKCKKVKKVWQENNLEILRQELAEKRSGR  1261

Query  675   EWITKCFESLQPPRASLFV-IICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
             E +   F   +P +  L   I  W  W  RN             +     AL  ++    
Sbjct  1262  EVMETVFN--RPAKEILLASITLWQWWSERNRVQEGERGRSPSELGFIIAALAEEYMKLN  1319

Query  498   EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
             + D ++  S+++   KW R  QG  K+N D A D  +R  G G+ +R+H G    +    
Sbjct  1320  KKDSKRAPSRNE---KWSRTDQGVMKINTDGAFDPFTRTGGWGFAIRDHSGKVVKSGAGK  1376

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLLADI  142
                +++   AEALA    +       +  +  E+DS ++   L    F +S    ++ +I
Sbjct  1377  VQILMNAFHAEALACAAGIRAASECGMQRVTAETDSTMLKSALEKNTFASSALGGIICEI  1436

Query  141   KDLLS-TFCSLLYLFC  97
             K+ ++  F S    +C
Sbjct  1437  KNFVNFAFLSFNVSYC  1452



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score =   244 bits (622),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 158/531 (30%), Positives = 255/531 (48%), Gaps = 26/531 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  RFLS+AG+EV+LKSV  A+P YAM  F LP+   ++++  M  FWW   + + 
Sbjct  613   RMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWWQASEDKS  672

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WDKLC+ K+ GGMGF+ I+ FN ALL+KQAWR+  + +SL  + ++++Y+ N 
Sbjct  673   K-IHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSLLTRFLQSRYFSNG  731

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRI-TTPP  1165
              F  A  G  PS+ W S+L  + +++   R  +GNGLS+ +W   WL D    RI     
Sbjct  732   SFLSATLGSRPSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWLIDGERLRIPLMKN  791

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  N  V+ L+  +   WD + + ++F  +D ++IL I  P     D + W     G 
Sbjct  792   ILVDLNLKVSDLMIPNSDLWDHQKLENLFYDQDIEIILKIK-PAVSSPDFLCWNHTRSGE  850

Query  984   FTVKSCY--------KAISLDLDSVPIASW--STIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++VKS Y        K   +   ++P  +   S IW+++  P+ K F+W+V  G +  AD
Sbjct  851   YSVKSGYWFAEKEAKKEAYVSSQALPSLNGIKSHIWSLNTAPKIKVFLWKVIGGAISVAD  910

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              L  R +     C +C    ES  H+L  C+ A Q W +    PA       S   +  F
Sbjct  911   HLIERGMKVDSRCQICGLEGESMNHVLFNCTIARQSWAICH-FPAPVNGFDPSSIYSNIF  969

Query  654   ESLQPPRASLFVI--------ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
               L+      + +        I W IW+ RN  ++K   +       +       W    
Sbjct  970   YVLKMGNNQNWPVHIRRSGPWILWQIWKNRNSFLFKGSLIVGSKFATSLLQEADHWFLIK  1029

Query  498   EVDDQQR----RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
             E++ Q++      + + I  W  P   WFK ++    D N ++ G  W+LRN  G     
Sbjct  1030  EMEKQEQAIDLEKKKRIIFGWKPPPSSWFKCDIGFDWDKNRKESGAAWILRNAEGKVLLH  1089

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
                S+  + S  E+   +   AL   K  H D++   ++   +V+ +S PA
Sbjct  1090  GRRSFSNIRSKSESSFQSWLWALESMKSLHFDHVIFSAEDRDIVNAISKPA  1140



>ref|XP_010058710.1| PREDICTED: uncharacterized protein LOC104446568 [Eucalyptus grandis]
Length=1356

 Score =   244 bits (624),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 166/520 (32%), Positives = 244/520 (47%), Gaps = 24/520 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++  W  +FLS++G+E+LLKSVIQAL  YAM+LF LP  L   IER ++ FWW   ++ 
Sbjct  801   AKLAGWQEQFLSKSGKEILLKSVIQALLQYAMSLFKLPLSLCRLIERKISAFWWSKHNSH  860

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ WK W +L + K  GGMGFR + +FN A+L KQAWRL   P+++ +++ K  Y+  
Sbjct  861   S-GIHWKNWSELKLSKVSGGMGFRDLINFNTAMLGKQAWRLLQQPQAIWSQLFKGLYFRY  919

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F  A  G  PS+ W SLL+ +  I    RW +G+G  + I  DNWLP    P I   P
Sbjct  920   SSFQTAPSGHRPSWGWQSLLKGREAITPKLRWLVGDGSQIHIREDNWLPI--GP-IGGLP  976

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                      N +   H S W   +V   FN + +  IL+ PI      D+++W +   G 
Sbjct  977   EEGEPELVANLIDLQH-SEWKSSLVTAFFNVQVSAAILNTPINPSLLHDQLVWTETPSGT  1035

Query  984   FTVKSCYKAISLDLD----------SVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             + VKSCY  +SL             + P   W  IW++   P+ + F+W  C   + T  
Sbjct  1036  YIVKSCYYYLSLQYQQPTHKPSSSYTNPPLLWRKIWHMCTAPKIRVFLWLACKNAIATQH  1095

Query  834   LLRHRRIDCSPLCPLCLN-VEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKC  658
              L  R I   P C LC N V ES  H+   C +    W   E +       S S +    
Sbjct  1096  NLYQRHIIPHPYCSLCNNSVPESIEHLFFFCPWTNDIWN-HEEIRVKISPTSVSRFDAWI  1154

Query  657   FESLQPPRAS----LFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
              +    P+AS    +   I W IWR RN  V++ I      VV ++      +K      
Sbjct  1155  VDRASLPQASPEFEVVAHILWEIWRQRNNAVFRQIPPDPLQVVNDALTQTTIFKVLQPSP  1214

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
              + +        +W  P +G+ K N+D A    S    +  + R+  GI       S + 
Sbjct  1215  QKIKNKLVSLEQRWKPPAEGYIKCNIDGAYRKESETGTITCIYRDSKGILTDVHTRS-VP  1273

Query  309   VLSPKEAEALAIREALSWCKRQ--HIDYIHVESDSLVVVH  196
               S  +AE  A+  AL W  +Q   + Y  +ESD L +V 
Sbjct  1274  AQSAFQAEIYALISALQWLIQQGLQLQYFVIESDCLKLVE  1313



>ref|XP_009138123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=761

 Score =   240 bits (613),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 156/531 (29%), Positives = 254/531 (48%), Gaps = 26/531 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  RFLS+AG+EV+LKSV  A+P YAM  F LP+   ++++  M  FW  + + + 
Sbjct  169   RMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWGQDSEDKS  228

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WDKLC+ K+ GGMGF+ I+ FN ALL+KQAWR+ ++ +SL  + ++++Y+ N 
Sbjct  229   K-IHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILSNQDSLLTRFLQSRYFSNG  287

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F  A  G  PS+ W S+L  + +++   R  +GNGLS+ +W   WL D    RI     
Sbjct  288   SFLSATLGSRPSYAWRSILHGRELLKKGLRNAVGNGLSISVWSTPWLIDGERLRIPLMKN  347

Query  1161  PYlanasvnsllnN-HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +      S L   +   WD + + ++F  +D ++IL I  P     D + W     G 
Sbjct  348   TLVDLNLKVSDLMIPYSDLWDHQKLENLFYDQDIEIILKIK-PAVSSPDFLCWNHTRSGE  406

Query  984   FTVKSCY--------KAISLDLDSVPIASW--STIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++VKS Y        K   +   ++P  +   S IW+++  P+ K F+W+V  G +  AD
Sbjct  407   YSVKSGYWFAEKEAKKEAYVSSQALPSLNGIKSHIWSLNTAPKIKVFLWKVIGGAISVAD  466

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF  655
              L  R +     C +C    ES  H+L  C+ A Q W +    PA       S   +  F
Sbjct  467   HLIERGMKIDSRCQICGLEGESMNHVLFNCTIARQSWDICH-FPAPVNGFDPSSIYSNIF  525

Query  654   ESLQPPRASLFVI--------ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
               L+      + +        I W IW+ RN  ++K   +       +       W    
Sbjct  526   YVLKMGNNQNWPVHIRRSGPWILWQIWKNRNSFLFKGNLIVGSKFATSLFQEADHWFLIK  585

Query  498   EVDDQQR----RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
             E++ Q++      + + I  W  P   WFK ++    D N ++ G  W+LRN  G     
Sbjct  586   EMEKQEQAIDLEKKKRIIFGWKPPPSSWFKCDIGFDWDKNRKESGASWILRNFEGKVLLH  645

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
                S+  + S  E+   +   AL   K  H D++   ++   +V+ +S PA
Sbjct  646   GRRSFSNIRSKSESSFQSWLWALESMKSLHFDHVIFSAEDRDIVNAISKPA  696



>ref|XP_008353155.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=637

 Score =   238 bits (607),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 259/526 (49%), Gaps = 31/526 (6%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +I+ W    +S+AGREVL+K+V QA+P+Y MNLF  P+   +D++  ++ FWWG  D
Sbjct  32    LLGKIQGWKRSTISQAGREVLIKAVAQAVPAYPMNLFKFPKTFCNDLDALISKFWWGQND  91

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W + +++   K+ GG+G R   +FN ALL+KQ WRL + P SL A ++K +Y+
Sbjct  92    GENR-IHWVSKEQMGKSKEEGGLGLRCFTEFNNALLAKQCWRLLSEPNSLWASVIKGRYF  150

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN  FFDAK+GG  S+ W+SLL  + II+G   W+I NG  VR+W D WLP +  P    
Sbjct  151   PNCSFFDAKRGGRASWAWSSLLVGREIIRGGAHWQIMNGKDVRVWVDKWLPSI--PSGHP  208

Query  1170  PPF---PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVK  1000
              P    P   N  VNSLL+     W+ + ++      + + I           D+++W  
Sbjct  209   SPLGSVPVSLNLRVNSLLSTDYGSWEIDFLKPFLVEEEIKAIYETHSGDPSSNDRLVWPF  268

Query  999   DEKGVFTVKSCYK-AISLDLDS----------VPIASWSTIWNVHLPPRAKTFIWQVCSG  853
              + G+++VKS Y  A++ ++            +P   W  +W + + P+ ++F W+    
Sbjct  269   VKNGIYSVKSGYHWAMTRNIQQRIGNPHRSALIPKQVWKCVWKLEVQPKIRSFXWRSLQE  328

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW---RLFEPLPATSQAQS  682
              + T   L  RR   S LCP+C   EES  H+  +CS+  + W   RL   L   +   S
Sbjct  329   AVATXVNLFMRRSSSSTLCPICNRYEESLVHLFLQCSWVEEVWIGXRLIRGLRRDA-VTS  387

Query  681   CSEWITKCF------ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAK---AVVENSK  529
              + W+            ++    S     CW IW+AR   ++    +  +   AV+  S 
Sbjct  388   WAXWLGSIVGLANGQSGVRNDMLSYVATTCWFIWKARCXFLFNQQPIVPRQIIAVIXQSV  447

Query  528   ALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHH  349
             A ++++   T        +      +W  P  G+ K+NVDA+   +     +G V R+  
Sbjct  448   AAFKEYXQATVCSLPISVNGLXSDVQWSPPCVGFIKINVDASWLRSGAPGFVGVVARDDE  507

Query  348   GIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDS  211
             G F  AA    +   S   AEALA+       +    +++ VESDS
Sbjct  508   GRFM-AAIRRRVTASSVAVAEALAVLHGCELGRSMGWNFVIVESDS  552



>ref|XP_006487889.1| PREDICTED: uncharacterized protein LOC102617714 [Citrus sinensis]
Length=1238

 Score =   244 bits (622),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 164/552 (30%), Positives = 265/552 (48%), Gaps = 87/552 (16%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++ SW ++  S  GREVL+K+V QA+P+YAM++F LP  +  DI++ +  FWWG+   +
Sbjct  699   NKLSSWQNKLFSSGGREVLIKAVAQAVPAYAMSVFKLPASICEDIQKAIARFWWGSSSDR  758

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ W  W+KLC  K  GGMGFR    FN AL++KQ WR+  HPESL A+++K      
Sbjct  759   -RGIHWAKWEKLCQAKMRGGMGFRDFTSFNQALIAKQGWRIIQHPESLMARVLK------  811

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
                                                    V I+  NWLP     +  +PP
Sbjct  812   ---------------------------------------VCIYKSNWLPRPEAFKPFSPP  832

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V + L +    W  E++   F   DA +I+ I +P+ P+ D+ +W  D+ G 
Sbjct  833   --TLDIQPVVADLIDENQNWKKEMIYQHFMKEDAAMIVRIQLPKTPKPDQYLWHYDKYGQ  890

Query  984   FTVKSCYKAISLDLD--------SVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
             ++VKS Y+ I+L L            ++ W+ IW   LP + K F+W+     LPTA  L
Sbjct  891   YSVKSGYQ-IALKLKCPNSPCSSDSSLSQWNVIWAAELPEKIKIFMWRAVKNLLPTASNL  949

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFE-  652
               R+I  SP+C  C    E   H L +C  A + WR             C+E I K  + 
Sbjct  950   WRRKIVGSPICRRCGVKNEDVIHALLDCKVAKKVWR----------NAGCAEEIEKLVQQ  999

Query  651   -------SLQPPRA----SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKA----LWR  517
                     +Q  +      L V++CW IW ++N  +++N    ++  +  ++A      R
Sbjct  1000  DLMAVLVEIQRKKGKKELELIVVLCWTIWYSQNLFIFENKREDSQLSIARAEANMDSFKR  1059

Query  516   DWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
               K  +++ ++Q+R++ Q    W  P  GWFK+NVDAA+++  +  GLG ++RN +G   
Sbjct  1060  IKKPFSKILEKQQRNRKQV---WNPPPSGWFKINVDAAVNVKDQIAGLGVIIRNSNGEVV  1116

Query  336   SAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVH-GLSSPAFVTSFD  160
             +AA       LS    EA A+   +   +R     + +E+DS  VV   LS    +    
Sbjct  1117  AAAIQRSFFQLSSTHMEAEAVILGIKSAQRAGFSPMIIETDSQEVVDLTLSKKVRIIETS  1176

Query  159   LLLADIKDLLST  124
              ++ADI++ + +
Sbjct  1177  WIIADIQESIQS  1188



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score =   242 bits (617),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 169/574 (29%), Positives = 272/574 (47%), Gaps = 50/574 (9%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWW-GNGDT  1528
             SR+  W  +FLS+AG+E+L+K+V  A+P+YAM+ F LP G+  DIE+ +  +WW G+GD 
Sbjct  352   SRMVGWAEQFLSQAGKEILIKAVAMAMPNYAMSCFKLPIGVCKDIEKAVRNYWWRGSGDR  411

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
               KG+ W AW+K+   K+ GG+GF+ I+ FNLALL+K  WR+   P+SL A +++ KY+P
Sbjct  412   --KGIHWVAWEKIRSQKRNGGLGFKDIQCFNLALLAKIGWRITLQPBSLJANVLREKYFP  469

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP  1168
                F +A  G   S+ W  + E + ++    RWR+G+G  + I  D W P    P     
Sbjct  470   GKTFREASGGRGTSWGWKGIFEARKVLDKGIRWRVGDGNCINIREDPWFP---KPSTFKA  526

Query  1167  PFPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                    A +   L + GS  W  ++V+  F  +D   ILSIP+ +    D +IW     
Sbjct  527   RVXEGLQAIMVRDLIDPGSREWKTDMVKGGFLEKDVTSILSIPLSRYGMSDXLIWHHXRN  586

Query  990   GVFTVKSCYKAISLDL--------------DSVPIAS--WSTIWNVHLPPRAKTFIWQVC  859
             G +TV++ Y  ++L L               S P  S  W+ IWN+ +P + K F+W+ C
Sbjct  587   GEYTVRTGY-GVALGLMENGDMGKKGRGMPSSAPSLSHVWNKIWNLEVPNKMKFFVWKCC  645

Query  858   SGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC  679
             +  L     L+ R +     C  C+  +E+  H+   C  +   W    PL   S     
Sbjct  646   NNALAVRRNLKRRXLRVXNFCEGCMQPDETENHLFFRCEISHIFW-FCSPLQINSLELEG  704

Query  678   SE----WITKC----FESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKAL  523
             ++    W + C     +  +      FV   W++W+ RN+ ++K +      ++     L
Sbjct  705   NDFLASWGSFCGRVKGKENEXELMQEFVFGLWHLWKNRNDLIFKGVTHQPLDIL----GL  760

Query  522   W-RDWKACTEVDDQQRRSQHQYI-----------TKWIRPMQGWFKLNVDAALDINSRKM  379
             W R+     E   Q+       +            +W +P  G  K+N DAA    +   
Sbjct  761   WMRNLDEYREAGLQRTNDDQPTVGLASPAPAGRTGQWKKPGFGTIKVNTDAAWRKETSCA  820

Query  378   GLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
             G+GWV R+  G+  +A         S   AE LAIR AL +C R     + +ESD+  ++
Sbjct  821   GVGWVARDFAGLLQAAGGTGGRLCHSADAAEMLAIRSALDFCVRLGFKSVAIESDAKNII  880

Query  198   HGLSSPAFVT-SFDLLLADIKDLLSTFCSLLYLF  100
               + +   +  S +  L DI  L     S+ + F
Sbjct  881   QMIRNETTLDCSLECTLGDIATLARGLESVTFDF  914



>ref|XP_010418809.1| PREDICTED: uncharacterized protein LOC104704411 [Camelina sativa]
Length=792

 Score =   240 bits (613),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 182/568 (32%), Positives = 279/568 (49%), Gaps = 47/568 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR  SW  R LS+ G+EV++KSV  A+P++ M+ F LP+ +   +   ++ +WW +   Q
Sbjct  204   SRASSWPARLLSKGGKEVMIKSVATAVPTFVMSCFRLPKTITRKLTSAISNYWWSSSG-Q  262

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +GL W AWDKLC  K  GG+GFR + DFN ALL+KQ WRL +  +SL A++ K +YY +
Sbjct  263   SRGLHWVAWDKLCQDKTEGGLGFRGLDDFNTALLAKQLWRLISVLDSLFARVFKGRYYRH  322

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVN-NPRITTP  1168
             S   D  K  +PS+ W S++  + ++      R+G+G+S+ +WHD W+P  +  P I T 
Sbjct  323   SDPLDPIKSYSPSYGWRSIISARSLVNKGLIKRVGSGVSISVWHDPWIPAQSPRPAIGT-  381

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                     SV +L+N   + WD  ++   F   D  LI ++P+    + D + W   + G
Sbjct  382   GLSSDHLLSVQNLINRSSNSWDMALLSATFVPEDVALISALPLRLPDKPDSLGWHFTKSG  441

Query  987   VFTVKSCY------KAISLDL-----DSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              +TVKS Y       A S+ L     + VP+ ++  +W +  PP+ + F+WQV SGC+  
Sbjct  442   NYTVKSGYHLLQSSTAASVVLSVVGSNYVPLQAF--VWKIRCPPKLRHFMWQVISGCVAV  499

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITK  661
                LR R I C P+C LC   EE+  H L EC  A Q W L +  P T Q    SE I  
Sbjct  500   TANLRKRGISCDPVCGLCGFEEETINHALFECPPARQVWALSQ-FP-TVQGAFPSESILT  557

Query  660   CFESL-----QPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACT  499
               + L       P    F  I W IW+ARN+K++ N+     A++  ++     W  A T
Sbjct  558   NIDFLFWRFKDVPSQDRFPWILWYIWKARNDKLFSNLDSNPLAILRLAEDEANAWFLAQT  617

Query  498   EVDDQQR--------RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
             E  D +               ++++ RP        VD +     +  G GW   +  G 
Sbjct  618   EGVDSEEGHPLLGIPSDGGIRVSRFSRPTSSLLCF-VDGSWKATDQFSGRGWFCVSPGGD  676

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKR-------QHIDYIHVESDSLVVVHGLSS  184
               +   ++    LSP  AE     EAL W  R       Q + ++   SD + +V   S 
Sbjct  677   GPTMGASNLRRSLSPLHAEI----EALIWAMRCMIGADNQSVVFLTDCSDLVKMVSSPSK  732

Query  183   -PAFVTSFDLLLADIKDLLSTFCSLLYL  103
              PAF    + + AD ++  S   SL+Y+
Sbjct  733   WPAFTPYLEDVQADREEFTS--FSLVYV  758



>ref|XP_010513742.1| PREDICTED: uncharacterized protein LOC104789794 [Camelina sativa]
Length=1787

 Score =   245 bits (626),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 168/552 (30%), Positives = 265/552 (48%), Gaps = 36/552 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR++ W  + LS  G+EVLLK+V  ALP YAM+ F L +     I   M  FWW N   +
Sbjct  1191  SRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSVMANFWW-NAVEE  1249

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W +W+K+C  K  GG+GFR I  FN ALL+KQAWRL + P SL A++ KA+Y+P+
Sbjct  1250  KQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARYFPS  1309

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A  G  PS+ W S+L  + +++      IG+GL   +W D W+ D   PR     
Sbjct  1310  ISFMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFD-ELPRRPCNK  1368

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                +      S L  +   W+ + ++++F   D   I S P P    +D+++W     G 
Sbjct  1369  EQMINLNLRVSELITNQGDWNLQALQELFPPCDVIKIRSFP-PDTRLQDRLVWAYTNNGH  1427

Query  984   FTVKSCY----KAISL-----DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             ++VKS Y    KA+ +     +   V       +W V   P+ + F+W+V SG +  AD 
Sbjct  1428  YSVKSGYWLSSKAMEVPGGESEGSRVLNELKQKVWTVETAPKIRMFLWRVLSGAIAVADC  1487

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKCF  655
             +R+  +  +P+C +C + +E+  H L  C  A+  W     PLP    + S SE I  C 
Sbjct  1488  MRNHGLQVNPICQVCRSADETVSHALFLCPVASTVWSATALPLPVQGFSTSVSENIGHCL  1547

Query  654   ESLQP---PRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
               +     P +    I  I W IW+ARN  V+ N       ++  + A   +W    E+ 
Sbjct  1548  RLITNTDLPSSLRLAIPWILWEIWKARNGMVFNNKLQDHHVLIAGAVADAEEWLKLNELQ  1607

Query  489   DQQRRSQHQYI------TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG--IFHS  334
              Q++RS    +       +W +P  G  K N++A+   +    G  W+LRNH G  +FHS
Sbjct  1608  KQEQRSVVGIMRGGMSQKRWTKPAFGILKCNINASWASSQHYAGGAWILRNHVGDVLFHS  1667

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQ----HIDYIHVESDSLVVVHGLSSPAFVTS  166
                ++++  ++   AE     + L WC        I    V +D   V+  L  P     
Sbjct  1668  R--HAFLPTVNRIAAEL----QCLLWCLESLQILQILSFEVWTDCDAVIQALEKPQAWPK  1721

Query  165   FDLLLADIKDLL  130
             +  LL  I  ++
Sbjct  1722  YRSLLHKISQVM  1733



>ref|XP_010039376.1| PREDICTED: uncharacterized protein LOC104428079 [Eucalyptus grandis]
Length=1343

 Score =   244 bits (623),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 145/494 (29%), Positives = 242/494 (49%), Gaps = 20/494 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W  ++LS+AG+E+L+K+V+QALP YAM++F +P  +   IE+ +  FWW   D + 
Sbjct  741   KLAGWKEKYLSKAGKEILVKTVVQALPQYAMSIFKIPVSICKAIEKRIAAFWWRQNDAK-  799

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK W+ L   K  GG+GF+ +  FN+A+L KQAWRL   P +L ++++K  Y+P  
Sbjct  800   KSMHWKNWETLKSRKDRGGLGFKDLISFNVAMLGKQAWRLSQSPSALWSQLLKGLYFPQG  859

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               + A +G  PS+ W S+L  +  I  + +W +G+G S+ I  D+WL    +  I   P 
Sbjct  860   DLWKANRGPRPSWGWQSVLRGRDAILPDLKWTVGDGKSIHIRQDHWL----SQGILGGPE  915

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V  L++     W+  ++  +F+ +    IL++PI    ++DK+IW  +  G +
Sbjct  916   NRNDPHLVADLIDQERKEWNVPLLNQLFDQKIVNEILTLPIVHQQKDDKLIWTGNHSGQY  975

Query  981   TVKSCYKAI---SLDLD--------SVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             TVKS Y  I   SL  +          P + W+ +W++ +PP+ + F+W +C   LPT +
Sbjct  976   TVKSGYNMINDVSLPQECNRASSSYQPPRSLWTKLWHMSIPPKLRIFLWSLCQDALPTKE  1035

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITK  661
              L  R+I   PLCPLC    E+  HI   C    + W          TS A    +W+ +
Sbjct  1036  KLHQRKILPDPLCPLCSKYPETVEHIFLHCQQVKKIWSDPRLNISHVTSSATRMDKWVAE  1095

Query  660   -CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
                   Q     L V + W IW+ RN  +++      +A+++ + A  R  +        
Sbjct  1096  YLLVKTQASDPELIVEVLWQIWKNRNNFIFRKTHGQPQALIDTALAQNRVSQRWIPTKSS  1155

Query  483   QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
             + +        W  P     KLNVD++         +  +LR+ +G          +   
Sbjct  1156  KSKGNEHLPVTWKAPKTPDLKLNVDSSWIATDSACSVAGLLRDSNGSVIDGFAEE-VHAA  1214

Query  303   SPKEAEALAIREAL  262
             SP +AE LA+   L
Sbjct  1215  SPLQAETLALFHGL  1228



>gb|EEC68711.1| hypothetical protein OsI_37193 [Oryza sativa Indica Group]
Length=1546

 Score =   244 bits (624),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 162/555 (29%), Positives = 276/555 (50%), Gaps = 34/555 (6%)
 Frame = -2

Query  1692  SWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGL  1513
              W  + LS  G+E+L+KS+ QA+P YAM +F +P  +   I   ++ +WWG+ D   + +
Sbjct  423   GWKEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGD-DADHRRI  481

Query  1512  RWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFF  1333
              W+ W K+C+PK  GGMGFR ++ FNLALL+KQ WRL + P+SL A++++A+YY + +  
Sbjct  482   HWQEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLQSDPDSLCARVLRARYYLDGKLL  541

Query  1332  DAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYl  1153
             +A+     S+ W S+L      +    WR+G+G  ++IW DNW+P  +N +I T     L
Sbjct  542   NARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQTNRGNNL  601

Query  1152  anasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVK  973
                    +   + + W  ++++ IF   D   I+ IPI  G R+D + W  +  G F+VK
Sbjct  602   VATVDELIDPINFT-WGGDLLKTIFWPIDVCRIMQIPIRAG-RDDLVAWQYNRSGTFSVK  659

Query  972   SCY----------KAISLDLDSVPIAS-WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             S Y          ++  +   +   +  W  +WN+ +P + K F W+   G +P   +L 
Sbjct  660   SAYHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCRAILA  719

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLF------EPLPATSQAQSC--SEW  670
             +R +  S  CP+C N  E   H++  C+ A Q W         + L  T ++ S    E 
Sbjct  720   NRHVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVILEEI  779

Query  669   ITK--CFESLQPPRASLFVIICWNIWRARNEKV-WKNICLPAKAVVENSKALWRDWKACT  499
             + +    + LQ   A L +   W IW  R + V  + +  PA++ +  + AL +++K  T
Sbjct  780   LIREDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAVQRPARSGMAIA-ALTKNYKLAT  838

Query  498   EVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
             + D   R+        W +P +G   +NVDA  D       +G V+R+  G   +AA + 
Sbjct  839   KKDSVLRQG-------WKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAAHSF  891

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVT-SFDLLLADI  142
                ++    AEA A++E L   ++   + + ++SD + VV  ++   F   S   +  D 
Sbjct  892   VPHLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDC  951

Query  141   KDLLSTFCSLLYLFC  97
               L S F  +    C
Sbjct  952   NILWSGFADITIEHC  966



>ref|XP_009105552.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=590

 Score =   236 bits (602),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 162/529 (31%), Positives = 248/529 (47%), Gaps = 36/529 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  + LS  G+EVLLKS+  ALP YAM+ F L +     I   M+ FWW   + + 
Sbjct  45    RLNGWYTKMLSLGGKEVLLKSIAMALPVYAMSCFKLTKHHCQKIMSAMSAFWWNESEDKK  104

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWDKLC  K+ GG+GFR I+DFN ALL+KQAW+L N P+SL A+I K +YY  +
Sbjct  105   K-IHWIAWDKLCESKENGGLGFRDIEDFNQALLAKQAWKLMNEPQSLLAQIYKGRYYAKT  163

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A KG  PS+ W S++  + +++      IGNG    +W D W+ D    R      
Sbjct  164   SLLEAGKGFRPSYAWRSIVFGRELLKKGLITSIGNGKDSMVWLDKWIMDEEPRRPVNKQI  223

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +  N  V  LLN +G+ W+ E + ++F   +   I+++ I  G REDK+IW     G +
Sbjct  224   HFDGNLRVADLLNQNGT-WNLEELNNLFPVNEVSRIMALQI--GGREDKLIWAYTNHGAY  280

Query  981   TVKSCYKAISLDLDSVPIASWST-----------IWNVHLPPRAKTFIWQVCSGCLPTAD  835
             TVKS Y  + ++ ++   A  +            +W +   P+ + F+W+  SG L  AD
Sbjct  281   TVKSGY-GLLVNAEARRNAQMTVQEQRLLTLKRRVWKIACLPKIRMFLWRALSGALAVAD  339

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKC  658
              L+ R ++    CPLC +  E+  H+L  CS A + W L E P PA   +      I   
Sbjct  340   RLQSRGLNVQGRCPLCQSEAETINHMLFRCSKALELWDLTECPKPAQGFSNGLEANIAFL  399

Query  657   FESLQPPRASLFVI-----ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             F++L    A    +     + WN+W+ RN  ++          V N++     W    + 
Sbjct  400   FDALDGNGAGDSKVRSIPWVLWNVWKNRNALLYAETQTSPSFWVLNAEEEATLWFEANKQ  459

Query  492   DDQQRRSQHQY--ITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG--IFHSAAC  325
                     H+   + +W  P  G  K N+       +   G  W+ R+H G  +FH    
Sbjct  460   AQHIEAHSHRMGDMERWCPPSTGTVKCNIHVNWRSAALISGGAWIARDHTGNVLFHGR--  517

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQ----HIDYIHVESDSLVVVHGL  190
                  V +P     +A    + W  +     H   I + SD    V  L
Sbjct  518   ----DVFTPSSNRMIAELRGILWVMQSARDLHFHSICIASDHRDTVEAL  562



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score =   243 bits (621),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 156/483 (32%), Positives = 247/483 (51%), Gaps = 26/483 (5%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
               +I+ W    LS+AG+EV++K+V+QA+P+Y MN F  P  L S+++  +  FWWG    
Sbjct  762   LEKIQXWKQNTLSQAGKEVMIKAVLQAIPAYPMNXFKFPATLCSEMDSLIAAFWWGQKGG  821

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
             + K + W + D L +PK+ GGMGFR  K+FN ALL+KQ W L   P+SL AKI+KA+Y+P
Sbjct  822   E-KRIHWVSKDLLGLPKQAGGMGFRGFKEFNDALLAKQCWXLIQDPDSLWAKILKARYFP  880

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPR-ITT  1171
             N  F DA +GG  S+ W+SLL  + ++     W+I NG + R+W D W+P +     +  
Sbjct  881   NGSFLDAIRGGXASWGWSSLLVGREVLLQGAHWQIMNGRTTRVWMDMWIPSIPEGHPLPI  940

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                P   N  V +L+++    WD + ++   +  D   IL   I     ED+++W     
Sbjct  941   SAVPVSRNLRVGTLISDSSGTWDLDFLQPFISPEDFSAILDTCIGDPLLEDRLVWPGTRN  1000

Query  990   GVFTVKSCY---KAISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             G++TVKS Y   KA S+       +S        W  IW +  PP+ + F+W+     L 
Sbjct  1001  GIYTVKSGYHWKKACSMPFTGRGTSSSYLIHSKVWKAIWKLATPPKIRNFMWRALHRALA  1060

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE---  673
             T D+L  RR   SPLCP+C   EES  H+   C +    W     L      +S S    
Sbjct  1061  TMDVLFIRRCSPSPLCPICHAQEESVEHLFFLCPWVEPIW-FGGSLSYRVNRESFSSLXA  1119

Query  672   WITKCFESLQPPRASLFVII------CWNIWRARNEKVW-KNICLPAKAVVENSKALWRD  514
             W+   FE+    +  +  ++      CW+IW+AR   ++ +    P + ++  S ++   
Sbjct  1120  WLASFFEAQLGSKDEIMRLLSYAAFTCWHIWKARCALIFNQKKPSPQQLILAISNSVGSF  1179

Query  513   WKACTEVDDQQRRSQ--HQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
              +A        R S      + +W  P   ++K+NVDA+  + S++   G V+R+H G F
Sbjct  1180  LEASCAPMGLVRSSPPVSPSLDRWSPPYAPFWKVNVDASWTMLSKRGFXGXVIRDHXGCF  1239

Query  339   HSA  331
              +A
Sbjct  1240  VAA  1242



>ref|XP_010495131.1| PREDICTED: uncharacterized protein LOC104772187 [Camelina sativa]
Length=1814

 Score =   244 bits (624),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 167/552 (30%), Positives = 267/552 (48%), Gaps = 36/552 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR++ W  + LS  G+EVLLK+V  ALP YAM+ F L +     I   M  FWW N   +
Sbjct  1218  SRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWW-NAVEE  1276

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W +W+K+C  K  GG+GFR I  FN ALL+KQAW L + P SL A++ KA+Y+P+
Sbjct  1277  KQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWCLLDGPSSLLARVYKARYFPS  1336

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             + F +A  G  PS+ W S+L  + +++      IG+GL   +W D W+ D   PR     
Sbjct  1337  TSFMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFD-ELPRRPCNK  1395

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                +      S L  +   W+ + ++++F   D   I S P P    +D+++W     G 
Sbjct  1396  EQMINLNLRVSELITNQGDWNLQALQELFPPCDVIKIRSFP-PDTRLQDRLVWAYTNNGH  1454

Query  984   FTVKSCY----KAISL-----DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             ++VKS Y    KA+ +     +   V       +W V   P+ + F+W+V SG +  AD 
Sbjct  1455  YSVKSGYWLSSKAMEVPGGESEGSRVLNELKQKVWTVETAPKIRMFLWRVLSGAIAVADC  1514

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKCF  655
             +R+  +  +P+C +C + +E+  H L  C  A++ W     PLP    + S SE I  C 
Sbjct  1515  MRNHGLQVNPICQVCRSADETVSHALFLCPVASKVWSATALPLPVQGFSTSVSENIGYCL  1574

Query  654   ESLQ----PPRASLFVI-ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVD  490
               +     P    L ++ I W IW+ARN  V+ N       ++  + A   +W    E+ 
Sbjct  1575  RLITNTDLPSSLRLAILWILWEIWKARNGMVFNNKLQDHHVLIAGAVADAEEWLKLNELQ  1634

Query  489   DQQRRSQHQYI------TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG--IFHS  334
              Q++RS    +       +W +P  G  K N++A+   +    G  W+LRNH G  +FHS
Sbjct  1635  KQEQRSVVGIMRGGMSQKRWTKPAFGILKCNINASWASSQHYAGGAWILRNHVGDVLFHS  1694

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQ----HIDYIHVESDSLVVVHGLSSPAFVTS  166
                ++++  ++   AE     + L WC        I    V +D   V+  L  P     
Sbjct  1695  R--HAFLPTVNRIAAEL----QCLLWCLESLQILQILSFEVWTDCDAVIQALEKPQAWPK  1748

Query  165   FDLLLADIKDLL  130
             +  LL  I  ++
Sbjct  1749  YRSLLHKISQVM  1760



>ref|XP_010474601.1| PREDICTED: uncharacterized protein LOC104754160 [Camelina sativa]
Length=1368

 Score =   244 bits (622),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 174/572 (30%), Positives = 263/572 (46%), Gaps = 51/572 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W   FLS  G+EVLLK+V  ALP++ M+ F LP  +   +   M+ FWW N     
Sbjct  767   KVNGWQSLFLSPGGKEVLLKAVAMALPTHTMSCFKLPTAICKQLTSVMSDFWWQN-KQDS  825

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AW+KL  PK  GG+GFR I+DFNLALL KQ WR+  H +SL A++ K++Y+ +S
Sbjct  826   RGMHWTAWEKLSKPKAVGGLGFRDIEDFNLALLGKQLWRMITHKDSLLARVYKSRYFKHS  885

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD-----VNNPRI  1177
                 A  G  PSF W S+  ++ II+   R  IGNG SV IW   W+ +     ++  ++
Sbjct  886   DPLSASLGNRPSFAWRSIHASQKIIKQGARAVIGNGASVNIWQHQWVEEKPSRGISRMKV  945

Query  1176  TTPPFPYlanasvnsllnNHGSG--WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
               P F  +A++  +       SG  W++ ++  +F   D   I  +       +D   W 
Sbjct  946   IPPQFQRIASSVNSVQDLLLPSGKDWNETLLELLFEDADRVCIRGLRPGSATTKDVYAWD  1005

Query  1002  KDEKGVFTVKSCY----KAI------------SLDLDSVPIASWSTIWNVHLPPRAKTFI  871
                 G ++VKS Y    + I            SLDL       +  IW +  PP+   FI
Sbjct  1006  YSRSGHYSVKSGYWVATQVIKGKDQPQFVLQPSLDL------LYQQIWKLDAPPKLHHFI  1059

Query  870   WQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ  691
             W+  S  L  A  L H  I     C  C N  ES  H+L  C  +   W +  P+PA  +
Sbjct  1060  WRCISNNLSVAGNLYHPHISREASCIRCPNARESTNHLLFTCPLSRLVWAI-SPIPAPPE  1118

Query  690   AQSCSEWITKCFESL------------QPPRASLFVIICWNIWRARNEKVWKNICLPAKA  547
                  +W    + +L            Q   +SL   I W IW+ RN  ++K     A +
Sbjct  1119  G----DWSNSIYANLFWVFNYHKELPSQENLSSLSPWILWRIWKNRNNLIFKGREYEAIS  1174

Query  546   VVENSKALWRDWKACTEVDDQQRRSQHQYI--TKWIRPMQGWFKLNVDAALDINSRKMGL  373
             ++  +K    +W    E+   +  +    +   KWI+P Q W K N D A   +    GL
Sbjct  1175  LINKAKEDAEEWSQRLELRGIKHPNPPGSLNRNKWIKPSQDWVKCNSDGAWPHDGDTGGL  1234

Query  372   GWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHG  193
             GWVLR++ G    A         +  E EA A R A+    R     +  ESDS  +V  
Sbjct  1235  GWVLRDNRGKILWAGVRLVSKTRTVLEIEAEAFRWAVINLVRLQYPRVIFESDSQTLVDL  1294

Query  192   LSSPAFVTSFDLLLADIKDLLSTF--CSLLYL  103
             L+      + D ++ DI+  L  F  C ++++
Sbjct  1295  LNGEGSRPTIDPIVQDIRHHLPLFDQCKVVFI  1326



>ref|XP_009121250.1| PREDICTED: uncharacterized protein LOC103846083 [Brassica rapa]
Length=773

 Score =   239 bits (610),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 169/547 (31%), Positives = 258/547 (47%), Gaps = 17/547 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +  SW+ R LS AG+  +LKSV+ A P+Y+M+ FLLP GL + I+  +  FWW + D   
Sbjct  205   KAASWSSRRLSAAGKLTMLKSVLTATPTYSMSCFLLPVGLCNSIQSALTRFWW-DADPST  263

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +WD L   K   G+GFR I+ FN+A+L K AWRL   P+ L A+ +  KY    
Sbjct  264   RKICWVSWDTLSTSKDSCGLGFRDIQAFNIAMLGKLAWRLVTKPDCLLARTLLGKYCYKG  323

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F       + S  W  ++  + ++  + R  IGNG S ++W D+WL    + RI  PP 
Sbjct  324   SFLTVPCPSSTSHGWRGIIAGRDLLIRHLRKVIGNGNSTKVWSDSWLSSSEDMRILGPPR  383

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  L+    + W+   + +    + A LI  I       ED   W   + G++
Sbjct  384   EIDRDLVVADLMIRGSNEWNHTKI-EATCPQVAHLIYLIRPSAHNMEDIFCWHGSKDGIY  442

Query  981   TVKSCYKAISLD-------LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRH  823
             +V+S Y ++  D       L   P      IW V   P+ K F+W++  G LP    L+ 
Sbjct  443   SVRSGYYSLIEDTRGQAHQLLMAPFNWSKAIWAVDTSPKLKLFLWKLAQGALPLGANLQA  502

Query  822   RRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEP-LPATSQAQSCSEWITKCFE  652
             R +  +  CP C  + E+  H++ EC FA Q W L   +P L   S A   S        
Sbjct  503   RGMMSNTNCPHCGGI-ETGVHLIFECPFAQQVWALAPIKPNLDFISSASVHSALTAASRL  561

Query  651   SLQPPR---ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ  481
                PP    +  F  +CWNIW ARN  +++N   PA ++V N+    R+W    E     
Sbjct  562   VCLPPSGIASDFFSWLCWNIWTARNRLLFENRTSPAISIVTNALCNAREWMLAQEKKPDS  621

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
                   Y+     P +     N DAA    +++ GLGW+L +       +  ++   V S
Sbjct  622   PPPASPYLPAISFPPETAL-CNSDAAWTTTTKRAGLGWILGSTTTTPQVSGSSASPFVSS  680

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTF  121
             P  AEALA+REA+      ++  + + SDS V+V  ++S  F      +L DI+ L S F
Sbjct  681   PLLAEALALREAIRAAHAANLPNVWMRSDSQVLVRAVNSKKFPMELYGVLMDIEYLFSRF  740

Query  120   CSLLYLF  100
                L  F
Sbjct  741   MFFLLSF  747



>ref|XP_009107566.1| PREDICTED: uncharacterized protein LOC103833219 [Brassica rapa]
Length=1182

 Score =   242 bits (618),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 163/557 (29%), Positives = 269/557 (48%), Gaps = 39/557 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W+ R LS+AG+EV++K+V  ALP  AM++F +P+ + + +   +  FWW   + + 
Sbjct  579   RISGWHARTLSQAGKEVMIKAVASALPVSAMSVFKIPKTVTTSLSSALANFWWSAVEHKR  638

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+K+C+PK  GGMGF+ ++ FN ALL+KQAWRL N    L ++++K KY+  +
Sbjct  639   K-IHWISWEKMCLPKDLGGMGFKDLESFNKALLAKQAWRLINLESCLMSQVLKGKYFEGT  697

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F  A+ G  PS+ W S+LE K ++    +  +GNG  +++W D WL D N   I  PP 
Sbjct  698   CFVKAQLGKRPSYAWRSVLEGKDLLVQGLKVAVGNGSLLKVWTDPWLEDDNG--ICRPPL  755

Query  1161  P----YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  +     V+ L+N H   W    + ++F  RD  +IL    P     D  +W   +
Sbjct  756   RKQRFFNVELQVSELINYHTRRWSRRKLSELFVPRD-MMILEKNQPVISEHDSWVWRHTK  814

Query  993   KGVFTVKSCY------KAISLDLDSVPIASWS----TIWNVHLPPRAKTFIWQVCSGCLP  844
              G+++VKS Y      K + L  D   + S +     +WN+  P + K FIW+  SG L 
Sbjct  815   SGLYSVKSGYELAFTMKNVELIRDQQVLPSLNPLKDRVWNLLAPSKLKVFIWKALSGALS  874

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQS----  682
               D LR R + C   C  C    ES  H+L  C+FA Q W +  F   PA   + S    
Sbjct  875   VLDGLRDRGMKCDLECQTCGQTGESINHVLFSCTFARQVWAMTRFPSPPAGFDSFSIFAN  934

Query  681   ----CSEWITK--CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALW  520
                  S W TK   FE+ +      F  + W +W+ RN  +++     +  V   ++   
Sbjct  935   VNYLISFWETKKHVFEATRN-----FPWVLWYLWKNRNNLLFEGALFESVQVCTKAEEEA  989

Query  519   RDWKACTEVD----DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
               W A   ++    +  R    Q    W RP + + K N+    +   +  G  WV+R+ 
Sbjct  990   SQWYAAQSLERRSTNDNRNRLIQASAAWKRPPENFVKCNIGFKWEYKKKIAGAAWVVRDS  1049

Query  351   HGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFV  172
              G     +  S+  V S  +A+ L++  A+   +      ++   +  ++V  ++ P+  
Sbjct  1050  RGTVLLHSRRSFGNVESKDDAQFLSVAWAIESMRCHRFRMVYFAVEGRMLVDAINKPSDW  1109

Query  171   TSFDLLLADIKDLLSTF  121
              SF   + +I+ +L  F
Sbjct  1110  PSFKFKVFEIRSILRDF  1126



>ref|XP_008372910.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=574

 Score =   235 bits (599),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/538 (31%), Positives = 250/538 (46%), Gaps = 53/538 (10%)
 Frame = -2

Query  1611  MNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNL  1432
             M+ F LP  L  +IE+T+  FWW +  T+ KG+ W AW K+   K  GG+GF+ I +FNL
Sbjct  1     MSCFQLPIQLAKEIEQTIAHFWWRDQKTK-KGVHWLAWKKVAQRKISGGLGFKDIIEFNL  59

Query  1431  ALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCR  1252
             A+L+K  WRL   PESL AK++KAKYYP S F +A  G   S+ W  +L+ + I++   R
Sbjct  60    AMLAKIGWRLICAPESLLAKVLKAKYYPTSSFLEASVGRGTSWGWKGILQGRKILKSGIR  119

Query  1251  WRIGNGLSVRIWHDNWLPDVNNPRITT--PPFPYlanasvnsllnNHGSGWDDEVVRDIF  1078
             WR+G+G ++ +  D WLP     R  +  P  P +    V+         W+ E+V+  F
Sbjct  120   WRVGDGRNIXVIVDXWLPTPRTFRXLSRHPEMPQMVXDLVSV-----DGTWEREIVQRCF  174

Query  1077  NSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCY----------------KAISLD  946
                +AQLILS+P+ +    D++IW     GV++VKS Y                   S  
Sbjct  175   TGDEAQLILSMPLSRLGCVDRIIWHYXRNGVYSVKSXYLXAQEMNRNGELGRKGXGQSST  234

Query  945   LDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESA  766
              D++ +  W  +W++ +PP+ + FIW+ C   L     L+   +  S  CP C   EE+ 
Sbjct  235   XDTLALV-WRDLWSLKVPPKLRHFIWRGCRNILXXXTNLQRXXVRLSTDCPFCACEEETQ  293

Query  765   FHILAECSFATQCW-----RLFEPLPATSQAQSCSEWITKCFESLQPPRASLFVIIC--W  607
              H+   CSFA   W     +L   +        C  W+   +  L         ++C  W
Sbjct  294   VHLFFRCSFARVFWFGSPIQLDVNVVVGDDFMQCWTWLCTKYGKLDEACTFXRWVVCGLW  353

Query  606   NIWRARNEKVWKNICLPAKAVVENSKALW---RDWKACTEVDDQQRRSQH-------QYI  457
              IW+ RN  V++      K VVE + AL    + W    E D+                 
Sbjct  354   RIWKCRNSVVFE------KVVVEPTVALQLLRQXWMEIVEXDEDFSSDNSXGCIXDGTIA  407

Query  456   TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALA  277
               W++P  G  K+N D A    +   G GWV R+  GIF  A     +   S    EA A
Sbjct  408   NGWVKPPFGTIKINCDGAWCNRTSVGGYGWVARDFAGIFKGAGGVGKVFCXSSFMXEAEA  467

Query  276   IREALSWCKRQHIDYIHVESDSLV---VVHGLSSPAFVTSFDLLLADIKDLLSTFCSL  112
             +R A+     +    +HVE+DS V   +VHG   P    + D +L DI  L     SL
Sbjct  468   LRLAVMAAVDRGFHSVHVETDSKVLVDMVHGKLQPD--ATMDAILWDINLLQQQVVSL  523



>ref|XP_010424493.1| PREDICTED: uncharacterized protein LOC104709611 [Camelina sativa]
Length=777

 Score =   239 bits (609),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 167/552 (30%), Positives = 264/552 (48%), Gaps = 29/552 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR   W+ +  S+ G+EV++KSV  A+P++ M+ F LP+ + S +   +  FWW     Q
Sbjct  195   SRTTGWSAKLFSKGGKEVMIKSVAPAVPNFVMSCFRLPKTITSKLTSAVANFWWST-TGQ  253

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AWDKLC  K+ GG+GFR + DFN ALL+KQ WRL   P +L A++ K +YY N
Sbjct  254   AGGMHWLAWDKLCCSKQLGGLGFRHVDDFNSALLAKQLWRLIEAPNTLFARVFKGRYYRN  313

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   +  +  +PS+ W S++  + ++      R+G+G S+ IW D W+P   +PR     
Sbjct  314   SNPMEPIRSYSPSYGWRSIIFARYLVNKGLIIRVGSGESISIWTDPWVP-AQSPRRAFSK  372

Query  1164  FPYlanasvnsllnN-HGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              P   ++   S L + H + W  +++++ F   D  LI +IP+     +D + W   + G
Sbjct  373   GPLKDSSLQISHLIDCHMNTWRMDMLKEHFAPEDVDLIGAIPLESCRPQDSLGWHFTKSG  432

Query  987   VFTVKSCYKAISLDLDSVPIASWS---------TIWNVHLPPRAKTFIWQVCSGCLPTAD  835
              +TVKS Y         +   S S          +W  H PP+ K F+WQV +GC+  + 
Sbjct  433   KYTVKSRYDTELFAASRLSTVSRSGLEITPLLAGVWGAHCPPKIKRFMWQVLTGCILVSA  492

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PL-PATSQAQSCSEWITK  661
              LR R I C   C  C   EE+  H +  C  A Q W L + P+ P +   +S    +  
Sbjct  493   NLRRRGIACDSGCVRCGAEEETINHAIFCCPPARQVWALAQVPVGPDSLPTESVYANVDH  552

Query  660   CFESLQP-PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTEVDD  487
               +S  P  +   F  + W IW+ARN +V++++      VV  ++     W +A  EV+D
Sbjct  553   FLDSTNPGSQIKNFPWLMWYIWKARNARVFEDVMDNPLDVVRLAEGEANAWLQAQVEVED  612

Query  486   QQR-------RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
             + R        S+ +  T  +      ++  VD +        G GWV  +      +  
Sbjct  613   EDRPNPSLVPNSRQRESTSSLPNFFTGYRCFVDGSWKATDALAGAGWVCSSSQDSRSTMG  672

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLA  148
               ++   LSP  AE     EA  W  R  I + + +   LV +  +SSP    +F   L 
Sbjct  673   ATNFRRSLSPLHAEI----EAFIWAMRCMIGHDYTDCSDLVKM--VSSPHDWPAFTPYLD  726

Query  147   DIKDLLSTFCSL  112
             DIK   + F S 
Sbjct  727   DIKIDQAEFSSF  738



>ref|XP_010506904.1| PREDICTED: uncharacterized protein LOC104783445 [Camelina sativa]
Length=882

 Score =   240 bits (612),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/542 (31%), Positives = 258/542 (48%), Gaps = 29/542 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR  +W+ + LS+ G+EVLLKSV QA+P+Y M+ FLLPQ ++  +   ++ FWW   +  
Sbjct  215   SRTNAWSAKLLSKGGKEVLLKSVAQAIPTYVMSCFLLPQNVIGKLRGAISKFWWSTKNNN  274

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ W AWDK+CVP   GG+GFR +K+FNLALL+KQ WRL   P SL  +++K +Y+  
Sbjct  275   -RGIHWIAWDKICVPLSCGGLGFRDLKEFNLALLAKQLWRLLRFPNSLLCRVLKGRYFRY  333

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   D  +  +PSF W S++  K ++Q   R  I +G S R+W DNW+P V         
Sbjct  334   SNPIDVGRANSPSFGWRSIIAAKPLLQKGLRKNIRSGFSTRVWTDNWIPAVPPRPAKDNG  393

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P  +N  VN L++     W  + ++++ + +D  LIL +   +    D  +WV    G 
Sbjct  394   GPRDSNLYVNHLIDFETKEWKQDKLKEVVDPQDIPLILGLKPSKSFMVDDYLWVHTRSGQ  453

Query  984   FTVKSCYKAIS---LDLDSVPIASWSTI----WNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +TVK  Y   S    +  +V   S + +    W ++ P + K FIWQ  +GC+ +   L 
Sbjct  454   YTVKLGYLVASEGNTESQAVMEPSLTKLKGHAWKLNAPRKIKHFIWQAIAGCIASCSRLV  513

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL-FEPLPATSQAQSCSEWITKCFES  649
              R       CP C   EES  H+L EC  A Q W L   PLP       CS         
Sbjct  514   DRHCGTDRTCPRCGAAEESINHVLFECPPALQVWALSHTPLPPG--IFPCSSLYANLDFL  571

Query  648   LQPPRASLFVI--------ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
                 +   +V+        + W IW+ARN+KV+ N  + A    E + +    WK   E+
Sbjct  572   FWGAKDLGYVVSIVESFPWLLWYIWKARNDKVFNNHEILAPDTCEIAFSEATSWKLAQEL  631

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLN--VDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
               ++     Q     +R +Q    L   VDA+   +    GLG+ L+    + + A   +
Sbjct  632   GKEETEDIEQ--GGPVRTLQQGIGLVCCVDASWKDSDNIAGLGFELKGGPQMLYGARGTT  689

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS----PAFVTSFDLLL  151
                 LSP  AE   +  A+          +  E+D   +   L      P F T  + + 
Sbjct  690   --RQLSPLHAELDGLIWAMETLISSGFTQVRFETDCSSIPKILEEMEEWPVFATESNNVR  747

Query  150   AD  145
             AD
Sbjct  748   AD  749



>gb|EEE52627.1| hypothetical protein OsJ_34967 [Oryza sativa Japonica Group]
Length=1395

 Score =   243 bits (620),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/553 (29%), Positives = 275/553 (50%), Gaps = 34/553 (6%)
 Frame = -2

Query  1686  NHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRW  1507
               + LS  G+E+L+KS+ QA+P YAM +F +P  +   I   ++ +WWG+ D   + + W
Sbjct  274   KEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGD-DADHRRIHW  332

Query  1506  KAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDA  1327
             + W K+C+PK  GGMGFR ++ FNLALL+KQ WRL + P+SL A++++A+YY + +  +A
Sbjct  333   QEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLLSDPDSLCARVLRARYYRDGKLLNA  392

Query  1326  KKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlan  1147
             +     S+ W S+L      +    WR+G+G  ++IW DNW+P  +N +I T     L  
Sbjct  393   RMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQTNRGNNLVA  452

Query  1146  asvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSC  967
                  +   + + W  ++++ IF   D   I+ IPI  G R+D + W  +  G F+VKS 
Sbjct  453   TVDELIDPINFT-WGGDLLKTIFWPIDVCRIMQIPIRAG-RDDLVAWQYNRSGTFSVKSA  510

Query  966   Y----------KAISLDLDSVPIAS-WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHR  820
             Y          ++  +   +   +  W  +WN+ +P + K F W+   G +P   +L +R
Sbjct  511   YHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCRAILANR  570

Query  819   RIDCSPLCPLCLNVEESAFHILAECSFATQCWRLF------EPLPATSQAQSC--SEWIT  664
              +  S  CP+C N  E   H++  C+ A Q W         + L  T ++ S    E + 
Sbjct  571   HVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVILEEILI  630

Query  663   K--CFESLQPPRASLFVIICWNIWRARNEKV-WKNICLPAKAVVENSKALWRDWKACTEV  493
             +    + LQ   A L +   W IW  R + V  + +  PA++ +  + AL +++K  T+ 
Sbjct  631   REDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAVQRPARSGMAIA-ALTKNYKLATKK  689

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
             D   R+        W +P +G   +NVDA  D       +G V+R+  G   +AA +   
Sbjct  690   DSVLRQG-------WKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAAHSFVP  742

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVT-SFDLLLADIKD  136
              ++    AEA A++E L   ++   + + ++SD + VV  ++   F   S   +  D   
Sbjct  743   HLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNI  802

Query  135   LLSTFCSLLYLFC  97
             L S F  +    C
Sbjct  803   LWSGFADITIEHC  815



>emb|CDX68427.1| BnaC01g25050D [Brassica napus]
Length=683

 Score =   237 bits (604),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 168/535 (31%), Positives = 269/535 (50%), Gaps = 48/535 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  + LS+ G+E+L+KS+  ALP YAM+ F LP+   + +   +  FWW NG+ + 
Sbjct  76    RLNGWFAKSLSQGGKEILIKSICLALPIYAMSCFRLPKDTCARLRSALTEFWWNNGNNRK  135

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW KLC  K  GG+GF+ ++ FN ALL+KQA R+ N+P+SL A+++K +Y+ NS
Sbjct  136   K-IAWVAWQKLCKSKDQGGLGFKDLEKFNQALLAKQAARVLNNPDSLMAQVLKHRYFKNS  194

Query  1341  QFFDA----------KKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDV  1192
              F D+          + G  PSF W S++  + ++Q     +IG+G    +W D W+ D 
Sbjct  195   SFLDSGVGSRPSFAWRMGSRPSFAWRSIIHGRELLQQGLLKKIGSGSDTVVWWDRWILD-  253

Query  1191  NNPRITTPPF---PYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPR  1024
             + PR+  P +     +        L   G+G W+ E+V   F  +DA++I+ I  P+   
Sbjct  254   SIPRV--PDYRQGSVVDLTLRVEDLLIPGTGVWNQELVFRTFTRKDAEIIMKIK-PEISH  310

Query  1023  EDKMIWVKDEKGVFTVKSCYKAISL-------DLDSVPIAS---WSTIWNVHLPPRAKTF  874
              D ++W     G +T KS Y  + +        ++ +P      WST+W     P+ + F
Sbjct  311   TDSVVWGLSRNGSYTSKSGYALLEIIEEINTSQVEIIPPVEKKLWSTLWKTKTTPKLRHF  370

Query  873   IWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPAT  697
             +W++ SG L   + LR R I  +  C  C N  E   H+L  C FA + W L   P+P  
Sbjct  371   LWRILSGALAVKERLRSRGIQLNITCSSCNNGVEDIGHVLFHCPFAQEVWALSSIPMPP-  429

Query  696   SQAQSCSEWIT-----KCF--ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVE  538
             S A S S ++       C   +S  P    +F  I W+IW+ARN   +++  L +  V++
Sbjct  430   SGAWSHSIFLNLHHLINCGKRKSQAPETGQVFPWILWHIWKARNAFCFEHTRLYSAVVLD  489

Query  537   NSKALWRDWKACTEVDDQQRRSQ---HQYITKWIRPMQGWFKLNVDAALDINSRKMGLGW  367
              +      W+   +V   QR SQ    Q   KW +P  GW K N  ++    +   G  W
Sbjct  490   KALVEAEVWREL-QVPAPQRTSQVVVAQEARKWKKPPSGWVKCNFASSWLDPTSVCGGAW  548

Query  366   VLRNHHG--IFHS-AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDS  211
             ++R+ +G  IFHS  +C S   + +P EA+  ++   L       +D +  ES S
Sbjct  549   IVRDGYGKAIFHSRRSCPS---LPNPVEADLCSLLWTLEDMANLSVDKVIFESSS  600



>gb|ABA96203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1378

 Score =   243 bits (619),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/553 (29%), Positives = 275/553 (50%), Gaps = 34/553 (6%)
 Frame = -2

Query  1686  NHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRW  1507
               + LS  G+E+L+KS+ QA+P YAM +F +P  +   I   ++ +WWG+ D   + + W
Sbjct  244   KEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGD-DADHRRIHW  302

Query  1506  KAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDA  1327
             + W K+C+PK  GGMGFR ++ FNLALL+KQ WRL + P+SL A++++A+YY + +  +A
Sbjct  303   QEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLLSDPDSLCARVLRARYYRDGKLLNA  362

Query  1326  KKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlan  1147
             +     S+ W S+L      +    WR+G+G  ++IW DNW+P  +N +I T     L  
Sbjct  363   RMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQTNRGNNLVA  422

Query  1146  asvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSC  967
                  +   + + W  ++++ IF   D   I+ IPI  G R+D + W  +  G F+VKS 
Sbjct  423   TVDELIDPINFT-WGGDLLKTIFWPIDVCRIMQIPIRAG-RDDLVAWQYNRSGTFSVKSA  480

Query  966   Y----------KAISLDLDSVPIAS-WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHR  820
             Y          ++  +   +   +  W  +WN+ +P + K F W+   G +P   +L +R
Sbjct  481   YHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCRAILANR  540

Query  819   RIDCSPLCPLCLNVEESAFHILAECSFATQCWRLF------EPLPATSQAQSC--SEWIT  664
              +  S  CP+C N  E   H++  C+ A Q W         + L  T ++ S    E + 
Sbjct  541   HVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVILEEILI  600

Query  663   K--CFESLQPPRASLFVIICWNIWRARNEKV-WKNICLPAKAVVENSKALWRDWKACTEV  493
             +    + LQ   A L +   W IW  R + V  + +  PA++ +  + AL +++K  T+ 
Sbjct  601   REDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAVQRPARSGMAIA-ALTKNYKLATKK  659

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
             D   R+        W +P +G   +NVDA  D       +G V+R+  G   +AA +   
Sbjct  660   DSVLRQG-------WKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAAHSFVP  712

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVT-SFDLLLADIKD  136
              ++    AEA A++E L   ++   + + ++SD + VV  ++   F   S   +  D   
Sbjct  713   HLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNI  772

Query  135   LLSTFCSLLYLFC  97
             L S F  +    C
Sbjct  773   LWSGFADITIEHC  785



>ref|XP_009107571.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=692

 Score =   237 bits (604),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 158/557 (28%), Positives = 269/557 (48%), Gaps = 34/557 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R+ +W  R LS+ G+E+LLK+   ALP +AM++F LP+ + +++   M  FWWG+ D  
Sbjct  87    GRLNAWYLRKLSQGGKEILLKTSASALPVFAMSVFKLPKTICANMSSAMANFWWGS-DAH  145

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W AW+KLC+PK+ GGMGFR ++ FN ALL+KQAW++   P  L A+++K++Y+P 
Sbjct  146   IRKIHWIAWEKLCLPKESGGMGFRDLEAFNQALLAKQAWKVLTFPHCLLAQLLKSRYFPR  205

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F +AK G  PSF W SLL  + +I    + R+G+G S+ +W D W+ D  +      P
Sbjct  206   SNFLEAKLGDKPSFAWRSLLFGRELILKGLQKRVGDGNSIHVWTDKWVEDEADGYGMRAP  265

Query  1164  F----PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
             +     +  N  V  L++     W+ + + ++F   D Q +L    P   +ED  +W  +
Sbjct  266   WIKNCTFNVNLRVRELIDFQNRRWNIQALEEVFVPSDIQTLLKNQ-PVTSKEDFWVWKFN  324

Query  996   EKGVFTVKSCY--------KAISLDLDSVPIASW--STIWNVHLPPRAKTFIWQVCSGCL  847
             + G ++VKS Y        K I    +++P  +   S IW V   P+ +TF+W+  S  L
Sbjct  325   KSGAYSVKSGYWLAAQEKSKEIRQVAEALPSLNSLKSQIWKVQTAPKIRTFVWKAVSQAL  384

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATS-QAQSCSE  673
             P ADLL  R + C   C LC    ES  HIL  C    +CW +   P P       S  E
Sbjct  385   PVADLLMERGMKCDDRCQLCGFEGESVNHILFSCHLPRKCWAVSNIPSPRGGFSDHSIYE  444

Query  672   WITKCFESLQPPRASLFVI-----ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK  508
              I    +  +  R  +        + W +W+ RN  +++     A+ +++ +K     W 
Sbjct  445   NIAYLLKVCKDVRFDVETNRSWPWVLWYLWKNRNAFIFEGKLFEAEEIIKKAKEEADVWF  504

Query  507   ACTEVDDQQRRSQHQYITKWI-----RPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG-  346
                +V     + +   I K       +  +GW     D         MG  W++++  G 
Sbjct  505   VAQQVQSGMDQVEAGMIEKGGLGNAPKITKGWVLCEFDMDWSKGLGLMGAAWIVKDEKGS  564

Query  345   -IFHSAACNSWIGVLSPKEAEA-LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFV  172
              + HS    S +  ++  + +  L + E++   +++ + ++    D   +V  +  PA  
Sbjct  565   VLLHSRRAFSDVKSINEAKVQVWLWVVESMKSLRKKKVIFLSTFGD---IVEAIEKPAKW  621

Query  171   TSFDLLLADIKDLLSTF  121
              +      +IK  L + 
Sbjct  622   PNLQFEATEIKRELQSL  638



>ref|XP_009124968.1| PREDICTED: uncharacterized protein LOC103850017 [Brassica rapa]
Length=1053

 Score =   240 bits (612),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 161/540 (30%), Positives = 259/540 (48%), Gaps = 29/540 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             + + W+ RFLS AG+ V+L+SV+  +PS+AM+ F LP  L   IE  +  FWW +  T  
Sbjct  481   KAEGWSTRFLSPAGKLVMLQSVLTPIPSHAMSCFKLPVSLCQRIETALKRFWWDD-RTGK  539

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W KL +PK  GG+G R I+ FN A L+K +WRL   P  L  + + +KY P+ 
Sbjct  540   RKMAWISWPKLTLPKSNGGLGVRDIQAFNEAYLAKISWRLLEKPHGLLGRTLLSKYCPDG  599

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F       + S  W S+L  + ++  N  W IG+G S+ IW D WL  +++P     P 
Sbjct  600   NFLACSSPSSASHGWHSILAGRDLLNKNLGWVIGDGNSINIWEDQWL-SLDSPIRPMGPA  658

Query  1161  PYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                +   +   L   GSG WD   ++ I    + + IL +   +    D + W+    G 
Sbjct  659   TETSANLLVKDLILPGSGEWDRARIQQILPFEEER-ILCLQTSKNGAPDVLRWLGTSLGQ  717

Query  984   FTVKSCYKAISLD-----LDSVPIASWS---TIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
             ++VKS Y     +     L+   I ++    T+WN+ L P+ K F W+   G +P    L
Sbjct  718   YSVKSGYLVAMAEMTEEILEGEAIMNFDWKKTVWNLKLAPKVKMFTWKSLKGIIPVGVRL  777

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS----EWITK  661
             + R ++  P C  C  + ES  H+L  C FA   W L  PL         +    +W T 
Sbjct  778   QERHLNVDPKCKRC-GISESVNHLLFHCQFARDVWNL-SPLEGGFDISGLTDLREDWTTL  835

Query  660   CFESLQPPRASLFVI----ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
               +   PP    F      I W++W++RN+ V++N        +  +    R+W+    +
Sbjct  836   QAQKTLPPTGITFTPLVPWIMWSLWKSRNKFVFENFAGNPADTLSQAIVAAREWEKAQGL  895

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
              ++     HQ     I+  Q    +  DAA   NSR+ GLGW +R+          +S+I
Sbjct  896   VEKGLHVTHQ-----IQEAQTEVVMRSDAAWSNNSRRAGLGWSMRSRDQCDRGGRGSSFI  950

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDL  133
                SP  AE LA+REA+S+C+ + +  +  E+DS  +V  ++S         ++ DI+ L
Sbjct  951   S--SPLVAEGLALREAVSFCRSKGVTSVRFEADSAQLVKAINSKEPPLELYGIVEDIRYL  1008



>ref|XP_010480729.1| PREDICTED: uncharacterized protein LOC104759515 [Camelina sativa]
Length=1240

 Score =   241 bits (615),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 172/554 (31%), Positives = 266/554 (48%), Gaps = 37/554 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWW-GNGDTQ  1525
             R   W  R LSR G+EV++KSV  A+P++ M+ F LP+ +   +   ++ FWW  +GDT 
Sbjct  522   RTGGWPARLLSRGGKEVMIKSVAIAVPTFVMSCFRLPKTVTRKLTSAVSNFWWSASGDT-  580

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +GL W AWDKLCV K  GG+GFR + DFN ALL+KQ WRL + P++L AK+ K +YY +
Sbjct  581   -RGLHWIAWDKLCVDKIDGGLGFRCLDDFNTALLAKQLWRLISAPDALFAKVFKGRYYRH  639

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   D  K  +PS+ W S++  + ++      R+G+G S+ +W D W+P           
Sbjct  640   SNPLDPIKSYSPSYGWRSMVSARSLVNKGLIKRVGSGDSISVWSDPWIPAQPPRPALRSG  699

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              P      V +L++     W+  ++   F   D  +I ++PI +    D + W   + G+
Sbjct  700   SPIDPTLRVETLIDRSSRSWNLALLSASFKPEDVAIISALPIGKPDSPDMLGWHLTKTGL  759

Query  984   FTVKSCYKAISLD-LDSVP------IASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             +TVKS Y A+  + + S P      I   + +W +  PP+ + F+WQ  +GC+ T   LR
Sbjct  760   YTVKSGYNALRQNQVASAPAFGPNIIPLQAFVWKIRCPPKIRHFLWQAITGCIATTANLR  819

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKC----  658
              R + C P C  C   EE+  H L  C  A Q W L    P +          T      
Sbjct  820   RRGMTCDPECGRCGCPEETINHALFLCPPAWQVWAL-SSFPTSLDLFPTESIYTNMDYLF  878

Query  657   FESLQPPRASLFVIICWNIWRARNEKVWKNI---CLPAKAVVENSKALWRDWKACTEVDD  487
             + S + P A +F  I W IW+ARN+K+  N+    L    + E    LW   +A T V+ 
Sbjct  879   WRSQRNPSADIFPWILWYIWKARNDKILNNLDSNPLAILQLAEEEAKLWSSAQADT-VEL  937

Query  486   QQRRSQHQYITKWIRPM------QGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
               +   H      +  +         F+  VD +  +  +  G GW   +  G   +   
Sbjct  938   PHQIGPHPNTGPIVSGLLSANKYGSCFRCFVDGSWKVTDQYTGRGWYCISPEGESPTMGA  997

Query  324   NSWIGVLSPKEAEALAIREALSWCKR-------QHIDYIHVESDSLVVVHGLSS-PAFVT  169
             ++    LSP  AE     EAL W  R       +++ ++   SD + +V   S  PAF T
Sbjct  998   SNLRRSLSPLHAEV----EALIWAMRCMIGADNENVVFLTDCSDLVKMVSSPSEWPAFKT  1053

Query  168   SFDLLLADIKDLLS  127
               D + AD ++ LS
Sbjct  1054  YLDEIEADKEEFLS  1067



>ref|XP_008356436.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1089

 Score =   239 bits (611),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 167/567 (29%), Positives = 269/567 (47%), Gaps = 36/567 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  +FLS+ G+EVL+K+V  ALP+YAM+ F LP G+  D+E+ +  FW   G+ Q
Sbjct  480   ARLXGWTEQFLSQXGKEVLIKAVAMALPNYAMSCFKLPIGVCRDVEKAIXNFW-XKGNDQ  538

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              K + W +W+++   KK GG+GF+ I+ FNLA L+K  WRL  +P S  A + + KY+P 
Sbjct  539   RKXVHWVSWERVTKQKKSGGLGFKDIQCFNLAFLAKIGWRLSLNPSSJLASVFRDKYHPG  598

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A +G N S+ W  +     ++Q   RWR+GNG  + I  D W P  +  RI   P
Sbjct  599   RSFNEAGRGKNTSWGWKGIFXAXKVLQNGIRWRVGNGXCINIREDXWFPKPSTFRIR--P  656

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V+ L+    + W   ++   F+  DA  ILSI + Q   ED+++      GV
Sbjct  657   REDLDATMVSDLIXPGSNSWKANIISASFHREDAVTILSIXLSQFGXEDRLVXHHSXNGV  716

Query  984   FTVKSCYKAISLDLDSVPIAS---------------WSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VKS Y      L +  +                 WS IW + +  + K FIW+ CS  
Sbjct  717   YSVKSGYGVXXDLLVNGXLGKKGRGAXSEQQQLNQVWSRIWRLQVXNKIKXFIWRCCSNA  776

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             L     L+ R +    +C +C  ++E+   +   C F+   W    PL   S      ++
Sbjct  777   LAXRSNLQRRHMRVDNVCGVCNALDETENXLFFRCKFSHLFW-FCSPLHLNSHELEXVDF  835

Query  669   IT------KCFESLQPPRA--SLFVIICWNIWRARNEKVWKNICLPAKAVVE---NSKAL  523
             +       +C +  +        F    W +W+ RN+ V+  +      VV+    +   
Sbjct  836   LESWGXFHECVKGRENADEICQEFAFGLWRLWKNRNDXVFNGLHRQPLEVVDLWRKNINE  895

Query  522   WRDWKACTEVDDQQRR-----SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
             +RD  A  E DD  +      +  + I  W RP  G  K+N D A    +   G+GWV R
Sbjct  896   FRDALASVEGDDWXKEVGSFAAAARPIXXWQRPKYGTIKINTDVAXCKETHCAGVGWVGR  955

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
             +  G+  +A  +  +   S   AEA+AIR A + C     +++ VESD+ +++  +    
Sbjct  956   DFAGVLXAAGGSGTVLCHSAAAAEAIAIRTAXAXCITHRFNHVFVESDAKLIIQMIRKEV  1015

Query  177   FVT-SFDLLLADIKDLLSTFCSLLYLF  100
                 S D +L DI+ L     S+ + F
Sbjct  1016  SADFSLDCVLGDIEILARKLTSVTFAF  1042



>ref|XP_008232502.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=586

 Score =   233 bits (595),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 200/389 (51%), Gaps = 21/389 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W  +FLSRAGREVL+KSV  A+P+Y M+ FLLP  L   I   +  FWWG+    G
Sbjct  68    RIAGWKQKFLSRAGREVLIKSVATAVPAYPMSCFLLPITLCRAINADLANFWWGHNGEHG  127

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W KLC PK  GG+GFR +  FN +LL+KQ WRL  +P++L A+I+KA+Y+P+ 
Sbjct  128   K-IHWHSWMKLCTPKDAGGIGFRDLHAFNKSLLAKQGWRLLRNPDALWAQILKARYFPDC  186

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA+KGG  S+ W+SLL  + II    RW+IGNG SV +W D WL   ++ +++  P 
Sbjct  187   SFLDARKGGRASWAWSSLLIGREIIDSGARWQIGNGRSVDVWKDRWLTGKDSGKLSPFPT  246

Query  1161  PYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                    + S + +  SG WD   +     S DA  I + PI      D++IW   + G 
Sbjct  247   NNRFTPLLVSDIIDEDSGTWDISHIEPFIPSSDAASIRATPIGTLSTCDRLIWPVVKSGE  306

Query  984   FTVKSCY-----------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             +TV++ Y           +  +    +V    WS IW     P+ + F+W+  +G +PT 
Sbjct  307   YTVRTGYFQDIRGSPPVHRDRASTSHTVDKEIWSMIWVARTTPKIRNFMWRAITGSIPTG  366

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEWIT  664
               L  R++  SPLC LC    E+  H+L  C +    W    F   P  +   +   W+ 
Sbjct  367   ANLFRRKLSPSPLCRLCGLFPETVEHMLLLCPWTRAVWFGSPFGYSPDMASITTLDSWLI  426

Query  663   KCFESLQPPR------ASLFVIICWNIWR  595
                              SLF+   W IW+
Sbjct  427   GFLRGSGADSDQRNWGISLFMFCSWEIWK  455



>ref|NP_194638.1| ribonuclease H-like protein [Arabidopsis thaliana]
 emb|CAB43923.1| putative protein [Arabidopsis thaliana]
 emb|CAB79667.1| putative protein [Arabidopsis thaliana]
 gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis 
thaliana]
 gb|AEE85585.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=575

 Score =   233 bits (595),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 167/543 (31%), Positives = 260/543 (48%), Gaps = 41/543 (8%)
 Frame = -2

Query  1629  ALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRR  1450
             ALP+Y M  FLLP+ +   I   +  FWW N   + KG+ WKAWD L   K  GG+GF+ 
Sbjct  2     ALPTYTMACFLLPKTVCKQIISVLADFWWRN-KQEAKGMHWKAWDHLSCYKAEGGIGFKD  60

Query  1449  IKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGI  1270
             I+ FNLALL KQ WR+ + PESL AK+ K++Y+  S   +A  G  PSFVW S+  ++ I
Sbjct  61    IEAFNLALLGKQMWRMLSRPESLMAKVFKSRYFHKSDPLNAPLGSRPSFVWKSIHASQEI  120

Query  1269  IQGNCRWRIGNGLSVRIWHDNWL---PDVNNPRIT-TPPFPYlanasvnsll---nNHGS  1111
             ++   R  +GNG  + IW   WL   P     R+   PP  Y + +S+  +    +  G 
Sbjct  121   LRQGARAVVGNGEDIIIWRHKWLDSKPASAALRMQRVPPQEYASVSSILKVSDLIDESGR  180

Query  1110  GWDDEVVRDIFNSRDAQLILSIPIPQGPR-EDKMIWVKDEKGVFTVKSCYKAIS--LDLD  940
              W  +V+  +F   + +LI  +  P G R  D   W     G +TVKS Y  ++  ++  
Sbjct  181   EWRKDVIEMLFPEVERKLIGELR-PGGRRILDSYTWDYTSSGDYTVKSGYWVLTQIINKR  239

Query  939   SVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCL  784
             S P           +  IW     P+ + F+W+  S  LP A  L +R +     C  C 
Sbjct  240   SSPQEVSEPSLNPIYQKIWKSQTSPKIQHFLWKCLSNSLPVAGALAYRHLSKESACIRCP  299

Query  783   NVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKCFESL-----------QP  640
             + +E+  H+L +C+FA   W +   P+P         EW    + +L           Q 
Sbjct  300   SCKETVNHLLFKCTFARLTWAISSIPIPLG------GEWADSIYVNLYWVFNLGNGNPQW  353

Query  639   PRASLFVI-ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQ--  469
              +AS  V  + W +W+ RNE V++     A+ V+  ++    +W+  TE +    + Q  
Sbjct  354   EKASQLVPWLLWRLWKNRNELVFRGREFNAQEVLRRAEDDLEEWRIRTEAESCGTKPQVN  413

Query  468   HQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEA  289
                  +W  P   W K N DA  + ++ + G+GWVLRN  G        +   + S  EA
Sbjct  414   RSSCGRWRPPPHQWVKCNTDATWNRDNERCGIGWVLRNEKGEVKWMGARALPKLKSVLEA  473

Query  288   EALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTFCSLL  109
             E  A+R A+    R   +Y+  ESDS V++  L++     S    + D++ LLS F  + 
Sbjct  474   ELEAMRWAVLSLSRFQYNYVIFESDSQVLIEILNNDEIWPSLKPTIQDLQRLLSQFTEVK  533

Query  108   YLF  100
             ++F
Sbjct  534   FVF  536



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score =   239 bits (610),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 161/558 (29%), Positives = 274/558 (49%), Gaps = 50/558 (9%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  WN R LSRAG+E +LK+V+QA+P+Y M+ F +P  +   ++ +M   WWG  D + 
Sbjct  514   RVNGWNDRPLSRAGKETMLKAVVQAIPTYIMSCFQVPTTICDKMKSSMANHWWGYEDGRK  573

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W++                 +  FN A+L++Q WR+   P SL ++++K +Y+P+S
Sbjct  574   K-MHWRS----------------DLVIFNQAMLARQGWRILTDPNSLCSRVLKGRYFPDS  616

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F+ A K  + SF W S+L  + +++   RW +G+G +++I  D W+P V    + T  F
Sbjct  617   DFWSAPKPRSASFTWRSILFGRELLKKGVRWAVGDGSTIKITKDKWIPGVQAGMVNTR-F  675

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P   + +V+ L+N   + WD+E+V+ +FN   A+ +L +PI +   ED + W  D++G+F
Sbjct  676   PIPDDVTVDWLMNPERNAWDEEIVKAVFNDDIAREVLQVPISRHGGEDFVSWPHDKRGLF  735

Query  981   TVKSCYKAISLDLDSVPIAS---------------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             TV+S Y  +  +L  V  +S               W  +W ++ P +    +W+    CL
Sbjct  736   TVRSAYNLVRSNLFVVAQSSNGRGQHSGANVDSQFWKALWTINAPGKMLIHLWRSVHDCL  795

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS---  676
             PT   LR R +  +  C  C + ++   H+   C FA   W   + +    Q   C    
Sbjct  796   PTGFQLRRRHVPATEGCIFCGH-DDRIEHVFLVCPFAATVW---DAIKEKFQINLCRREL  851

Query  675   ----EWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-  511
                 +W+          + ++  +   +IW ARN      +    + V+    + + D  
Sbjct  852   CNIRQWVFDFLTRSSHIQKTVLAVTLRHIWEARNFSRNNPVTTHPRQVIHKIVS-YVDMI  910

Query  510   -KACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
              + C +  +         +TKW  P  G   +N DAAL   S + GL +V+R+H      
Sbjct  911   VQHCPKDRNASGCDLPLPVTKWKPPPPGMVLINSDAALFQASNQTGLAFVIRDHSATCLL  970

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF-VTSFDL  157
             AA     G+LSP+ AEALAIR AL   K +    + + SD L V+  + S A  ++   +
Sbjct  971   AANKRITGLLSPELAEALAIRFALEHAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGV  1030

Query  156   LLADIKDLLSTF--CSLL  109
             ++ DIK L + F  CS +
Sbjct  1031  IVRDIKKLETEFLECSFI  1048



>ref|XP_006494016.1| PREDICTED: uncharacterized protein LOC102608298 [Citrus sinensis]
Length=1570

 Score =   241 bits (616),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 166/551 (30%), Positives = 274/551 (50%), Gaps = 53/551 (10%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +++ SW H+F S  G+EVL+K+  QA+ +Y M++F +P G+  DI++ +  FWWG+ + +
Sbjct  709   NKVSSWQHKFFSAGGKEVLIKAAAQAILAYVMSVFKIPMGICDDIQQIIANFWWGSRNDK  768

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              K + W  W+KL   K   GMGFR    FN AL                     A+Y+ +
Sbjct  769   -KAIHWSRWNKLSQAKCREGMGFRDFSSFNQAL---------------------ARYFQH  806

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD-VNNPRITTP  1168
               F +A+ G NPSF+W S+L  + +I    RWRIGNG S+ +  +NWLP  +    I+ P
Sbjct  807   KDFMNARLGSNPSFIWRSILWGRQVISKGSRWRIGNGQSIMLHKENWLPRPLTFKPISKP  866

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
               P     ++ + L N    W++ ++   F   DA+ I+ I +P+ P +D++IW  D K 
Sbjct  867   SLP---ADALVAELINEEHTWNEGLIHRHFAKIDAEAIVRILLPRRPMKDEVIWHYDRKC  923

Query  987   VFTVKSCYK-AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
              ++VKS Y+ A++L   + P +S      W+ IW + LP + + F W+     LP+A+ L
Sbjct  924   QYSVKSGYQIALNLKFPAKPTSSATSENQWNAIWLLTLPEKIRIFAWRAAKNLLPSAENL  983

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCF  655
               R++   PLC  C    E+ FH L  C    + W++  FE     S  Q     + +  
Sbjct  984   WKRKVIQEPLCQFCNKKLETIFHALVGCKVVKKIWKITRFEDDLKDSVEQDMLSLLIELK  1043

Query  654   ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK-----ACTEVD  490
                      L V I W IW A+N  ++K +       V  ++A+   ++     A T +D
Sbjct  1044  LRRSKDDIELLVTILWMIWNAQNSWIFKGVKDSPHVTVSKAEAVLEAFRRTQLPAATHID  1103

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA--CNSW  316
              Q        +  W  P +G FK+NVDAA +   +   LG V+R+  G   +AA   + +
Sbjct  1104  IQSSSK----LKAWKPPQRGHFKVNVDAATNSEKQIASLGAVIRDEAGNVIAAAVKVSKF  1159

Query  315   IGVLSPKEAEAL--AIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL-LLAD  145
              G +   EAEA+   +R A + C    I    VESD+  VV  +++     S    ++++
Sbjct  1160  YGDVFIAEAEAIEWGLRLAGNACTESLI----VESDAQEVVKLVNNSQGCRSEIFWIISE  1215

Query  144   IKDLLSTFCSL  112
             ++ +L +F S+
Sbjct  1216  VQRVLKSFSSV  1226



>ref|XP_009146506.1| PREDICTED: uncharacterized protein LOC103870148 [Brassica rapa]
Length=1206

 Score =   239 bits (611),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 254/505 (50%), Gaps = 45/505 (9%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+ SW  R +S  G+E+LLKS +  +P +AM++F LP+ + + I   M  +WWG+ D+ 
Sbjct  606   ARLDSWYLRQISPGGKEILLKSTVGGMPVFAMSVFRLPKTVTAKISSMMANYWWGD-DSN  664

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W AWDKLC+PK  GG+GFR ++ FN ALL+KQ W++ N P+ L ++ +K+ Y+ N
Sbjct  665   KRKIHWIAWDKLCLPKDRGGIGFRDLECFNQALLAKQGWKILNAPDCLLSRFLKSIYFNN  724

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD-VNNPRIT-T  1171
               F  A  G  PS+ W S+L  + ++Q   R R+GNG + ++W D W+ D V   R    
Sbjct  725   GDFLSATLGSRPSYAWRSILFGRELLQEGIRHRVGNGSATKVWLDKWIEDPVEGLRAPWI  784

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
               + +  N     L+N     WD   + +IF   D ++I+    P   +ED + W  ++ 
Sbjct  785   KNYSFDVNLRAADLINVESRRWDVNKLAEIFVPADVEIIMKNQ-PVVNKEDFVSWRFNKS  843

Query  990   GVFTVKSCY-KAISLDL-----DSVPIASWSTI----WNVHLPPRAKTFIWQVCSGCLPT  841
             G  +VKS Y  A  + +      +  + S + +    W V   P+ + FIW+  S  LP 
Sbjct  844   GQISVKSAYWLATDMKMRMALPQAFALPSLNGLIEKAWKVQTSPKLRIFIWRALSDALPV  903

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITK  661
             +DL+  R +     C  C +  ES  H++  C FA Q W +  P+P   +  S S  +  
Sbjct  904   SDLIIGRGMKIDGRCQTCGDEGESINHLIFLCPFARQVW-VLSPIPYPREGFSTSS-VFA  961

Query  660   CFESLQPPRASLFVI---------ICWNIWRARNEKVWKNIC-----LPAKAVVEN----  535
              FE L   R S  V          + WNIW+ RN  +++N C     + AKAV +     
Sbjct  962   NFEFLFNIRKSRNVQSEEGRVWPWVVWNIWKRRNGFLFENRCYNPLEVSAKAVRDAEEWF  1021

Query  534   -SKALWRDWKACTEVDD--QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWV  364
              ++++ ++WK   ++     +RR        W  P  GW   NV    D N +  G GWV
Sbjct  1022  VAQSIEKEWKELDKITPPVPERR--------WFPPKPGWKMCNVGFTFDGNKKIAGGGWV  1073

Query  363   LRNHHGIFHSAACNSWIGVLSPKEA  289
             LRN  G+    +  S+ G+ +  EA
Sbjct  1074  LRNERGVVLLHSRRSFAGIKTKDEA  1098



>ref|XP_008245249.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=601

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/476 (31%), Positives = 234/476 (49%), Gaps = 28/476 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             ++  W H  LS+AG+EVL+K+VIQA+P+Y M++F  P    S+++ ++  FWWG      
Sbjct  115   KMHGWKHLLLSQAGKEVLIKAVIQAIPAYPMSVFKFPTTFCSELDSSIGKFWWGQSMDSD  174

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+ + + K  GGMGFR   +FN ALL+ Q WRL  +P SL AKI++ KY+P+ 
Sbjct  175   K-IHWLSWENMGLAKIEGGMGFRNFSEFNNALLASQGWRLLMYPNSLWAKILRDKYFPDG  233

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTP-P  1165
                +AKKG   S+ W+S+LE   II+   +W++ NG ++ +WHD WL      R   P  
Sbjct  234   DVLNAKKGARASWGWSSILEGIKIIRWGAQWQVVNGQNISLWHDRWLHPTLGARPLCPLN  293

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                     V ++++     W+ E +R + +      I S  I      D++IW  +  G 
Sbjct  294   HEMRKEVRVATIIDPDTRSWNLESIRHLISPTIEAAICSTSIGNSAGLDRVIWPLNRHGQ  353

Query  984   FTVKSCYKAI-SLD-LDSVPIASWS---------TIWNVHLPPRAKTFIWQVCSGCLPTA  838
             ++VKS Y  + S++ + SV   S S          IWN    P+ + F+W+    CL T 
Sbjct  354   YSVKSGYHFLRSMETMRSVSRPSGSRFVDKKISKLIWNAKTLPKIRHFMWRAVRNCLATK  413

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE---WI  667
               L  RRI CS +CP+C    E+  H L  C +    W    PL      Q  +    WI
Sbjct  414   ANLTSRRIPCSSICPICEENPETIEHALLTCPWVMGVW-FGSPLGFIGDRQHVTSLDCWI  472

Query  666   TKCFESLQPPR------ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA  505
                       +       ++   + W+IW+AR + +++        V++ +   W D++ 
Sbjct  473   LSLTSLAGSSKDEVNRVITVLSFLMWSIWKARCKAIFEQQLPNPGLVIKGAMEAWTDFQN  532

Query  504   CTEVDDQQRRSQHQ-----YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
                      R  ++       T W  P+  + KLNVDAA   NS + G+G ++RNH
Sbjct  533   SAPSLGASNRDANEESGVVRCTVWQAPLAPYLKLNVDAAWHSNSGQTGIGIIIRNH  588



>ref|XP_008225175.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=583

 Score =   233 bits (593),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 163/530 (31%), Positives = 253/530 (48%), Gaps = 33/530 (6%)
 Frame = -2

Query  1611  MNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNL  1432
             M  F  P+G  ++I   +  FWWGN  T+G GL WK+W KL V KK GG+GFR +  FNL
Sbjct  1     MTCFRFPEGTCNEINSDLANFWWGNS-TEGNGLHWKSWKKLGVSKKSGGLGFRDLSSFNL  59

Query  1431  ALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCR  1252
             ALL+KQAWR+  +P+S+ A+I++A+Y+P+  F  AKKG   S+ WASL+E +  +    +
Sbjct  60    ALLAKQAWRIVQNPQSIWAQILQARYFPHCNFLQAKKGSRSSWAWASLIEGRDALLMEAK  119

Query  1251  WRIGNGLSVRIWHDNWLPDVNNPRIT-TPPFPYlanasvnsllnNHGSGWDDEVVRDIFN  1075
             ++I NG +  IW DNW+   N+  I  T P P  A   V  +++     W+ +++ D  +
Sbjct  120   FQIFNGATTNIWKDNWISASNSGVIKPTCPVPITAPQLVCEIMDKPNHSWNLDLIADCLD  179

Query  1074  SRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAI-----------SLDLDSVPI  928
                  LI S PI   PR D+++W  +  G F+V+S Y              +    SV  
Sbjct  180   RETINLIRSTPISLSPRPDRLVWPWNPDGSFSVRSGYHRFHTSKNGPLLQHTYSSHSVDA  239

Query  927   ASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAE  748
               W  IWN+   P+ K F+W+  SG + +   L  R++  +PLCP+C   EES  HIL  
Sbjct  240   KVWKVIWNIKTLPKIKHFLWRAISGAISSRLALFRRKLVTNPLCPICNCFEESVEHILFL  299

Query  747   CSFATQCW--RLFEPLPATSQAQSCSEWITKCFESLQPP------RASLFVIICWNIWRA  592
             C +    W   +F      +   +   W+         P      R SL   +CW IW+A
Sbjct  300   CPWTHPVWFGSVFSYRIIPNAFTTLDRWLHDMLSIPDTPHEDFLHRFSLLSFLCWEIWKA  359

Query  591   RNEKVWKNICLPAKAVVENSKALWRD-WKACT---EVDDQQRRSQHQYI--TKWIRPMQG  430
             R + V+K      + V++ +   + + W+A T    +   +      Y+   +W+ P   
Sbjct  360   RCDFVFKGTNPDPRLVIKRANDSYSEFWEANTCFSRLSGSRTSPSSPYVGRDRWLPPPAN  419

Query  429   WFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCK  250
               K+N D A    +    +G + R+  G +     +  I   S   AEA A   A+S+  
Sbjct  420   AIKINFDGAWSPGTSHGSIGVIARDDCGTWRGGTASP-ISCNSALVAEAAAALYAVSYAI  478

Query  249   RQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTFCSLLYLF  100
              +    +  ESDS V V  +       S+ +L      +L   CSL   F
Sbjct  479   TRDFSKVVFESDSKVFVDSILGNHGNYSWTIL-----PILDEICSLSQHF  523



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score =   241 bits (615),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 157/540 (29%), Positives = 257/540 (48%), Gaps = 72/540 (13%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I SW+ + LS+AGRE L+KSV+Q++P Y M++F +P+ ++ DIE+              
Sbjct  1199  KINSWSSKCLSQAGRETLIKSVLQSIPFYIMSIFAIPKSIIVDIEKM-------------  1245

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
                       L + KK GG+GF+ ++ FN  +L KQAW+    P ++  ++ KAKY+   
Sbjct  1246  ----------LSIHKKEGGLGFKNLRAFNEGMLGKQAWKFMTEPHNIVTRLFKAKYFNKC  1295

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD---VNNPRITT  1171
              F D+K G NPS+VW ++   K ++    +W IG+G  + +W   WL D   +  P    
Sbjct  1296  DFLDSKIGHNPSYVWRNIWGAKRVVSEGYKWSIGSGTDICVWDQRWLVDGGVLQKPESLP  1355

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
               F  L  A +          W+  ++R++ ++ D   IL+ PI                
Sbjct  1356  EEFKELTVADLFISQTRF---WNVGLLRNLVSNEDTNRILNTPI----------------  1396

Query  990   GVFTVKSCYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRID  811
               F      + + L        +W  +WN+ +PP+ KTF+W+ C   LPT   L+ R ++
Sbjct  1397  --FEPNHLSQHVDLSTHRCD-GNWVLLWNLKVPPKVKTFLWRSCRNALPTRVRLQDRGVN  1453

Query  810   CSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQ-AQSCSEWITKCFESLQPPR  634
             C+  C LC N +E + H+   C+ + QCW+         Q AQ    +    FE LQ   
Sbjct  1454  CTKTCALCENEDEDSMHLFFYCTKSRQCWQQLGLWSKVQQKAQLNLSFGVTMFEILQELD  1513

Query  633   ASLFVI---ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQ  463
             +S  VI   + W+IW+ RN+ +W+N  +   AV +    L   W+   ++          
Sbjct  1514  SSQRVIWACVMWSIWKQRNDCIWRNEVMTTAAVRDRGLNLLTGWQNAQDI----------  1563

Query  462   YITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEA  283
                 W +P +G FK NVDAA    S ++G+G  +R+  G    A  +    +L   E EA
Sbjct  1564  ----WRKPDEGHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKARTSWSTLLLDVPEGEA  1619

Query  282   LAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL--LLADIKDLLSTFCSLL  109
             + +  A+ W K Q+++ I  E DS  VV+   +    T  D+  L A I++  +TF S  
Sbjct  1620  IGLLYAIRWAKEQNLNNITFELDSKRVVYSFHN----TRNDVSDLGAIIRECRTTFSSFF  1675



>ref|XP_009116203.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=820

 Score =   236 bits (603),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 162/529 (31%), Positives = 254/529 (48%), Gaps = 25/529 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R++ W  + LS+ G+EVLLKSV  ALP YAM+ F LP+ + S +   M  FWW +G T  
Sbjct  220   RLQGWFAKSLSQGGKEVLLKSVALALPIYAMSCFKLPKDVCSKLTSAMIEFWWSSG-TNR  278

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW K+C  K+ GG+GFR I+ FN +LLSKQAWR++++P SL A+I++ +Y+  S
Sbjct  279   KKIPWVAWKKMCKAKELGGLGFRDIEKFNQSLLSKQAWRIWSNPSSLVARILEQRYFARS  338

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNW-LPDVNNPRITTPP  1165
              F +   G  PS+ W S+L  + ++      +IG+G + R+W +NW L D   P      
Sbjct  339   SFMECGVGTRPSYAWRSILHGRELLSQGLLQKIGDGTTSRVWTENWLLSDTPRPPRYRQD  398

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                    +VN L++    GWD + +RDI +  D +L+L+        +D+ IW     G 
Sbjct  399   AIVDLTLTVNDLIDVQRGGWDIQRIRDIVHEEDVELVLNTSFNLS-EQDRRIWGFSRNGA  457

Query  984   FTVKSCYK-AISLDLDSVPIAS---------WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             +  KS YK A +L+    P            W  +W     P+ + F+W+  SG L    
Sbjct  458   YNSKSGYKLAETLEQHQAPSGPSLPPIEKRLWQDLWKTKTTPKIRHFMWRAISGALAVKQ  517

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWIT--  664
              L  R I     CP C    ES  H+L  C  A + W + + PLP    + + S W+   
Sbjct  518   GLSSRGILLDTTCPQCGLQPESICHVLFHCDTAKEAWSMAQIPLPPGGFSPN-SVWLNFY  576

Query  663   ---KCFESLQPPRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSK---ALWRDWK  508
                   +      AS+     I W IW+ARN  V++ +     ++   +    A W + +
Sbjct  577   HLLSLSKKANTDSASVLAFPWILWQIWKARNSLVFEKVQSSGFSIFSRASEEAATWLNLQ  636

Query  507   ACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
                           Q+  +W +P  G  K NV ++ D  S++ G  W+LR+  GI  S +
Sbjct  637   LLPPGSSLVMAPPAQHNQRWTKPPVGILKCNVASSWDNPSQRSGSAWILRDSSGIPLSHS  696

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSP  181
               ++    S  EA+   +  A+      HI  +  E  S  ++  + SP
Sbjct  697   RRAFSTTTSALEADLQTLWWAMEALHDIHIKRVIFEVSSDALMEAVFSP  745



>ref|XP_009108257.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=710

 Score =   234 bits (598),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 258/545 (47%), Gaps = 21/545 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  +F ++ G+EV++KSV+ ALP++ M  + +P+ ++  +   +  FWW  G + 
Sbjct  129   NRVNGWTFKFFTKGGKEVIIKSVVTALPNHVMGCYRIPKTVMKKLTSAVARFWWSPGGST  188

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ WK+WDKLC+PK  GG+GF+ + DFN A+L KQ WRL   P++L A++ K +Y+ N
Sbjct  189   -RGMHWKSWDKLCLPKTEGGLGFKDLTDFNTAMLGKQLWRLIQKPDTLFARVFKGRYFRN  247

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +  +    S+ W S++  + ++      R+G+G S+ +W+D WLP           
Sbjct  248   ASPLEPIRSYASSYGWRSIISARSLVSKGLIKRVGSGSSISVWNDPWLPSTRPRPANKNQ  307

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  + +V+SL++     W+ +V+R + +  D QLI SIP+ +    D+  W     G 
Sbjct  308   HNLYPDLTVDSLIDETSRTWNSQVIRTLVDPNDIQLIESIPLSRFRMADRDGWHFTHNGR  367

Query  984   FTVKSCYKAISLDLDSV-------PIASW--STIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TVKS Y+   +  D V       P  S   +  W V  PP+ K F+WQ+ +GC+     
Sbjct  368   YTVKSGYEVERVYPDKVRTLPEFGPSVSLLKAFCWKVRCPPKLKHFLWQLVTGCIAVKKN  427

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKC  658
             LR R I    +C  C   EES  H+  EC  A Q W L      P     QS    +   
Sbjct  428   LRSRGIQGDTICVRCGAPEESINHVFFECPPAIQVWALSRIPSNPDFFPMQSIFANMDHL  487

Query  657   FESLQPP-RASLFVIICWNIWRARNEKVWKNICLPAK---AVVENSKALWRDWKACTEVD  490
             F  + P      F  I W IW+ RN KV+ N+ +  +    + E   ALW    A  +++
Sbjct  488   FWRVDPAIEDHHFAWILWYIWKGRNSKVFSNLDIDPRDTLKLAETESALW----AEAQIN  543

Query  489   DQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIG  310
               Q   Q + +     P+        D +   N R  G GW            A N+ + 
Sbjct  544   HAQSTDQARSVVTETVPIIPGRWCFTDGSWKENDRFSGQGWCSTLDGSDNLLGARNTRVS  603

Query  309   VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLL  130
               SP  +E  A+  A+ + +      +   +D   +V  +S P    +F   L DIK L 
Sbjct  604   -QSPLHSEIAALIWAMEYMRNLRQFTVTFATDCSQLVKMVSEPEKWPAFASYLEDIKILK  662

Query  129   STFCS  115
              +F S
Sbjct  663   GSFHS  667



>ref|XP_008345114.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1067

 Score =   238 bits (607),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 172/569 (30%), Positives = 266/569 (47%), Gaps = 40/569 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  +FLS AG+E+L+K V  A+P++AM+ F LP G+  DIE+ +  +WW  G   
Sbjct  274   SRMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWW-RGSEX  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+   +WD+L   K  GG+GF+  + FNLA L K  WRL   P+SL A +M+ KYYP 
Sbjct  333   RRGVHXTSWDRLIQKKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMRDKYYPE  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A  G   S+ W  +LE + +++    WR+G+G +++I  D W P  +  RI   P
Sbjct  393   KSFREATIGRGSSWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXSTFRIR--P  450

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V+ L+N     W  +++   F+S +A  ILSIPI      D+M W     G 
Sbjct  451   AVNLGALYVSBLINQESKTWKADLISACFSSEEANTILSIPISXFGSCDRMGWFHXXNGX  510

Query  984   FTVKSCYKAISLDL----------DSVPIAS------WSTIWNVHLPPRAKTFIWQVCSG  853
             ++VKS Y  I+L+L             P         W+ IW + +P + + FI +  + 
Sbjct  511   YSVKSGY-GIALELMXSGGLGKKGRGAPSXKTKYNKIWNAIWRLDVPRKMRFFIXKCXNH  569

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS----QAQ  685
              L     L+ R +    +C +C  V+E+  HI   C   +  +    PL   S     A 
Sbjct  570   ALAVRRNLKRRHMRVDNICGVCGXVDETENHIFFRCE-TSHLFXFCSPLQINSFDLEGAD  628

Query  684   SCSEWITKC--FESLQPPRASL--FVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR  517
                 W+  C     L      L  FV   W +W+ RN+ ++    LP   ++E  K    
Sbjct  629   FLQSWVNFCNRVADLANTNELLQEFVFGLWRLWKNRNDAIFSGSFLPPTEILEVWKRNVX  688

Query  516   DWKACTEVDDQQRR--------SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
             +++A  E  D   +           +    W++P  G  K+N DAA    S+K GLGWV 
Sbjct  689   EYRAANERVDSGSKVPASNGDLGVVRRQVGWMKPCFGMIKVNTDAAWCKESQKAGLGWVA  748

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSP  181
             R+  G+   A         S   AEA  IR AL +C  Q    + +ESD+  ++  +   
Sbjct  749   RDFXGVLQRAGGTGASRFHSAAAAEAAXIRGALDFCLLQGFVNVFIESDARDIIL-MIRK  807

Query  180   AFVTSFDL--LLADIKDLLSTFCSLLYLF  100
                  F +  LL DI+ L      + ++F
Sbjct  808   ELTQDFRIGCLLGDIETLARRMQVVSFVF  836



>ref|XP_007204004.1| hypothetical protein PRUPE_ppa025711mg, partial [Prunus persica]
 gb|EMJ05203.1| hypothetical protein PRUPE_ppa025711mg, partial [Prunus persica]
Length=534

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 155/494 (31%), Positives = 231/494 (47%), Gaps = 57/494 (12%)
 Frame = -2

Query  1653  VLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKK  1474
             VL+KSV QA+PSY M++FL P     +I+  +  FWWG      K + W +W  L +PK 
Sbjct  82    VLIKSVAQAVPSYPMSVFLFPNSFCQEIDSILANFWWGQSQQSNK-IHWISWKNLGMPKN  140

Query  1473  WGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWA  1294
              GGMGFR +KDFN+ALL+KQ WR+   P++  A+++K+KY+PN  F  A KG   S+ W+
Sbjct  141   EGGMGFRNLKDFNVALLAKQGWRMVMEPQAFWAQLLKSKYFPNGDFLRAGKGAKSSWAWS  200

Query  1293  SLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHG  1114
             SLL  + II    RW++ +G  V+IW D W+P  +   +                  +H 
Sbjct  201   SLLVGRNIIMRGARWQVLDGSHVKIWTDKWIPGCSEHALQL----------------SHH  244

Query  1113  SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLDSV  934
             S  D E    + +  +   +  +  P GP   ++                      LD  
Sbjct  245   SQVDLEAKLHVKSGYNMIHMAHLDTPVGPSSSRV----------------------LDK-  281

Query  933   PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHIL  754
               A W  +W   + P+   F W++  GCLPT D L  R +  SPLCP+C    ES  H+ 
Sbjct  282   --ALWKLVWGSQMVPKLMNFWWRMVRGCLPTRDALFRRHLGTSPLCPICGEFPESVEHLF  339

Query  753   AECSFATQCWRLFEPLPATSQAQSC---SEW---ITKCFESLQPPRA---SLFVIICWNI  601
               C++    W    PL      QS    SEW   + K  +SL   R    S  V  CW+I
Sbjct  340   LLCNWVQLVW-FGGPLNYKINRQSITSMSEWMMQVLKISQSLGYDRKWLISQIVYTCWSI  398

Query  600   WRARNEKVWKNICLPAKAVVENSKALWRDWKA--CTEVDD--QQRRSQHQYITKWIRPMQ  433
             W++R   V+ +I +     +  +K L  D+    C   D   ++     Q + +W  P  
Sbjct  399   WKSRCSAVFDDISVCPHRTLLVAKNLINDFNLVRCPPGDAILEEDTDDGQRVVRWFPPPI  458

Query  432   GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWC  253
               +K+N+DAA   ++ + GLG V+RN+   F    C S +   S  EAEA A  + +   
Sbjct  459   SVYKINIDAAWVSSTLQAGLGVVVRNYASNFMGGCCVSRLAS-SAIEAEAHAALKGVKLA  517

Query  252   KRQHIDYIHVESDS  211
                    +  ESDS
Sbjct  518   AEMGFPNVVFESDS  531



>ref|XP_009115101.1| PREDICTED: uncharacterized protein LOC103840357 [Brassica rapa]
Length=918

 Score =   237 bits (605),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/469 (32%), Positives = 234/469 (50%), Gaps = 23/469 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R  SW+ + LS+ G+EV +KS+ QA+PSY M+ +LLPQG+  ++   ++ +WW   D  
Sbjct  355   NRTNSWSTKLLSKGGKEVQIKSIAQAVPSYVMSCYLLPQGITQNLSGAVSRYWWSTKDN-  413

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ W AWDK+C+P   GG+GFR  +DFNLALL+KQ WRL  +P SL A+++K +YY +
Sbjct  414   NRGMHWVAWDKICIPLDEGGLGFRNFRDFNLALLAKQLWRLLKYPNSLLARVLKGRYYRH  473

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S    +    NPS+ W SL   + ++Q   R +IGNGL  ++W + WLP       T   
Sbjct  474   SNPMASGSANNPSYGWRSLTALRQVLQQGLRKKIGNGLDTKVWEEPWLPVTPARPPTRRS  533

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +  +  V+ L+N+    W+ E++ +  ++ D   I ++ I +  R D   W   + G+
Sbjct  534   NQFDQDLRVHHLINHQNQTWNVELLNEFISAGDIVHIKTLRISRTGRNDCYSWDLIKSGL  593

Query  984   FTVKSCYK---AISLDLDSVPIASWST------IWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TV+S Y+    +    +  PI   ST       W +  P + K FIWQ  SG L TA+ 
Sbjct  594   YTVRSGYETAHGLRTRANEPPILEPSTTALKKATWKLKAPRKLKHFIWQAISGFLATAEQ  653

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKC  658
             L+ R       C  C    ES  H L EC  A QCW L      P +    S  E I   
Sbjct  654   LKVRHCTQDSSCVRCGAEAESIHHTLFECPPALQCWALSSVPTSPGSFPRNSLFENINYL  713

Query  657   F-----ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK--ACT  499
             F     + +   +   F  + W IW+ARNEKV+ N  +     ++ +      WK   C 
Sbjct  714   FYQARLQGVNSQQLESFPWLMWYIWKARNEKVFSNKDISPLDTIQIATNEAESWKLAQCV  773

Query  498   EVDDQQRRSQHQYITKWIRP---MQGWFKLNVDAALDINSRKMGLGWVL  361
                 +    +H       RP    Q W +   DA+    +  +G+G+VL
Sbjct  774   PEIIEIVGEEHSLEASRSRPPSIPQRW-RCQTDASWTSATEAIGIGFVL  821



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score =   240 bits (612),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 198/343 (58%), Gaps = 16/343 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W  + LS AG+E+LLK V QA+P Y MN FL+P+ L ++I++ M  +WW   D Q 
Sbjct  1138  KIQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCNEIQQVMARYWWVEQDGQR  1197

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK+ GG+GFR +  FN+ALL+KQ WRL   P SL A I+KA+Y+ N 
Sbjct  1198  K-IHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVACILKARYFKNC  1256

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A+ G +PS++W SL + + +I+   RWRIGNG SVRIW D WLP+  + ++++P  
Sbjct  1257  SILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSPQV  1316

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                  A VNSL+N     W +++++  F++ +   I +IP+      D +IW  +  G +
Sbjct  1317  EGFEEAKVNSLINPVTLQWKEDLLQAWFSAEEVNCIRNIPLSFRHPPDILIWHFERDGQY  1376

Query  981   TVKSCYKAI----------SLDLDSVPIAS----WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TV+S +               +++  PI +    W  IW   +PP+ + FIW+     LP
Sbjct  1377  TVRSGHDVARRVLLQQDGDDTNMNGGPIVACEQVWKKIWKARVPPKVRIFIWRALLNILP  1436

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLF  715
             T D L HRRI     C  C   EE+  H+L  C  A   W LF
Sbjct  1437  TKDNLIHRRISELRGCVFC-GAEETVAHVLLRCPMAIASWSLF  1478



>ref|XP_009107610.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=836

 Score =   236 bits (602),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 155/543 (29%), Positives = 264/543 (49%), Gaps = 19/543 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  SW  +FLS AG+ V+L+SV+ ALP+++M+ F +P  L   I+  +  FWW +   + 
Sbjct  277   RAHSWTTKFLSGAGKHVMLQSVLTALPTFSMSSFKIPISLCRRIQSILTRFWWDSAPDKR  336

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW  +  PK  GG+GF+ I+++N +LL K +WR+ ++P SL ++I+K KY+P+ 
Sbjct  337   K-ISWVAWSIMAQPKCRGGLGFKNIEEYNDSLLGKLSWRILSNPNSLLSRILKGKYFPDC  395

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +++     S  W  ++  K +++    + +G G ++R+W D WL  +       PP 
Sbjct  396   DFMESRDKTGSSHGWTGIMAGKAVLEKGLGFLVGEGKNIRVWSDQWLSPLRPLAPIGPPT  455

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  LL++  + WD   +R      +  + L IP    P  DK++W+ D  GV+
Sbjct  456   LANKDLLVADLLDHQTNEWDLAKIRLHLPQYEDLIRLIIPGNSKPM-DKLVWLPDPSGVY  514

Query  981   TVKSCYKAISLDLDSVPIASW---STIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRID  811
             + KS YK I    +  P  ++     +W +   P+ + F+W++ +  LP   LL  R I 
Sbjct  515   STKSGYKKICEVEEPPPPEAFDWIKNVWKLRTSPKIQHFLWRMLNNALPVGSLLAIRGIQ  574

Query  810   CSPLCPLCLNVEESAFHILAECSFATQCWR---LFEPLPATSQAQSCSEW--ITKCFESL  646
                 C  C   +ES  H+   C FA + W    L      T++  S   W  I     +L
Sbjct  575   TELSCKRC-GAQESIEHLFTNCPFAAEFWTKAPLMSTPGITTEMVSLKNWLSINASMRAL  633

Query  645   QPPRASLFVII---CWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRR  475
              P   +  V++    WN+W+ARN  V++   +  + ++  + A  R W+A   +   + +
Sbjct  634   PPVGVADTVLVPWLLWNLWKARNGLVFEGKSVQVEDIITKAVAEARAWEAANVLTSTKEK  693

Query  474   SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPK  295
                        P+  W     D A    S+  G+GW++++  G       ++   V S  
Sbjct  694   KTPSSRPPLTGPV-CW----TDGAWREPSKLGGMGWIIKSREGEVICRGSSNRTHVGSAL  748

Query  294   EAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTFCS  115
              AEALA+REAL   K  ++  + + SDS V+V  L     +     +  DIK L + FC 
Sbjct  749   MAEALAVREALRKAKELNLQSLQIFSDSQVLVSALCQGLDLNEIAGVQQDIKSLATLFCP  808

Query  114   LLY  106
             L +
Sbjct  809   LSF  811



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score =   239 bits (610),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 177/530 (33%), Positives = 253/530 (48%), Gaps = 34/530 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              +I+ W    LS AG+EVLLK+V+QA+P+Y MNLF  P  +  D++    GF WG+    
Sbjct  748   GKIQGWKQSALSFAGKEVLLKAVVQAIPTYXMNLFKFPVAVCKDLDSMSAGFLWGDCGGH  807

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + + W  WD L  PK  GG+GFR  +DFN ALL KQ W L  +P SL A+ +KA+Y+ +
Sbjct  808   -RXIHWVNWDTLGRPKYEGGLGFRNFQDFNDALLVKQCWXLILNPNSLWAQTLKARYFXH  866

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD--VNNPRITT  1171
             S F DAK G    + WASL   + I++    W+I NG   R+W D WLP   + +P I +
Sbjct  867   SSFLDAKLGSRAXWAWASLPVGRDILKNGAHWQILNGXDTRLWVDRWLPSXPLGHP-IPS  925

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
              P     N  V+SL+      WD E +R   +  + + I  IP+    R D++IW     
Sbjct  926   SPTSVTLNTKVSSLICPSTKSWDIEFLRPFISEVEJKXIYDIPLGNCSRRDRLIWTSSXX  985

Query  990   GVFTVKSCYKAI--SLDLDSVP---------IASWSTIWNVHLPPRAKTFIWQVCSGCLP  844
             G + V+S Y  I  S +L   P          + W  IW+   PP+ + F+W+  S  L 
Sbjct  986   GNYXVRSGYHXIHSSXELTRAPASVVTSTLGTSFWKAIWHAKAPPKIRHFLWRAVSEALA  1045

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS---E  673
             T   L  RR   SP+CP+C   EES   +L  C +    W    PL      +  S    
Sbjct  1046  TVGGLFKRRSASSPMCPICKTQEESVLXLLLRCPWVEPIWX-GGPLGXRRVGEGVSSXHH  1104

Query  672   WITKCFE---SLQPPRASLFVII---CWNIWRARNEKVWKNICLPAKAVVENSKALWRDW  511
             W++       +LQ  R+ L  +I   C  IW+ R    +K   L    V+    ++    
Sbjct  1105  WLSVLINXTPNLQ-DRSRLLSVIXFSCXYIWKXRCNFXFKASALAXSQVLH---SISFSL  1160

Query  510   KACTEVDDQQRRSQHQYIT--KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
              +  EV     RS+   I   +W  P   + K+NVDA+         L  VLR+H+G+F 
Sbjct  1161  GSFLEVQVPLSRSRPSPILDPRWXPPSAPFIKVNVDASWCQFDGMARLAAVLRDHNGLF-  1219

Query  336   SAACNSW-IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
               A + W IG      AEALA+ +           +I   SDSL VV  L
Sbjct  1220  -VAAHKWSIGAPFVVFAEALAMLKGCELAAELGFRWIVAXSDSLEVVSSL  1268



>ref|XP_009140406.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=747

 Score =   234 bits (598),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 159/554 (29%), Positives = 269/554 (49%), Gaps = 29/554 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W+ R LS+ G+EVLLK+V  ALP +AM+++ +P+ ++S +   M  FWW N + + 
Sbjct  149   RVSGWHARTLSQGGKEVLLKAVGAALPVHAMSVYKIPKMVISSLHSVMASFWWSNVEYKR  208

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WDKLC+PK+ GGMGF+ ++ FN ALL++Q WR+  + +SL A++ K KY+ N 
Sbjct  209   K-IHWMSWDKLCLPKESGGMGFKDLECFNQALLARQGWRIIQYEDSLLAQVFKGKYFEND  267

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F +A+ G  PS+ W SL+  + +++   +  IG+G SV++W + W+ D     +   P 
Sbjct  268   SFINAQMGSKPSYAWRSLMYGRELLKKGLKHLIGDGRSVKVWSEPWIEDEEG--LCRAPV  325

Query  1161  P----YlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  +  N  V+ L++     W+ E + ++F S D  ++L +  P    +D  +W  ++
Sbjct  326   RKQRCFDVNLGVSELIDYQKRRWNRERLGELFISGDVNILL-LNQPAVSEKDSWVWRFNK  384

Query  993   KGVFTVKSCYKAISLDLDSVPIASWST----------IWNVHLPPRAKTFIWQVCSGCLP  844
              G ++V+S Y+    +L    I + +           +W +  PP+ K FIW+  SG L 
Sbjct  385   SGAYSVRSGYEVAFSNLHQELIKNQAELPSINPLKAKVWKLQAPPKIKIFIWKTLSGSLS  444

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLP-----ATSQAQS  682
               D LR R + C  +C +C    ES  H+L  C+ A Q W +   P P       S  Q+
Sbjct  445   VLDNLRSRGMKCDLVCQICGTEGESINHLLFSCTLARQVWAVSGFPTPQGGFHEDSVYQN  504

Query  681   CSEWITK-CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKA  505
              +  IT    +  Q     +F    W +W+ RN  +++      + + + +      W  
Sbjct  505   MNYLITTWSDDKDQCEITKIFPWTLWYLWKNRNSLLFEGFLFEGQQMYQTACEEANLWLL  564

Query  504   C--TEVDDQQRRSQH--QYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
                 EV D      H  QY  +W    +G FK N+        R     WVL+N  G   
Sbjct  565   AQNMEVSDTTENDIHIRQYEDRWKPQDEGEFKCNIGMRWKTKERIARAAWVLKNARGEVL  624

Query  336   SAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDL  157
               +  S+  V S  EA  L++  A+          ++   +   +V+ ++ P    SF  
Sbjct  625   LHSRRSFGAVGSKDEAYFLSLAWAIESMLSHKCWKVYFVLEGGNLVNAINRPKAWPSFMF  684

Query  156   LLADIKDLLSTFCS  115
              + +I+ LL  F S
Sbjct  685   KVTEIRRLLGVFLS  698



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score =   238 bits (606),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 145/470 (31%), Positives = 240/470 (51%), Gaps = 38/470 (8%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+E+LLKSVIQ +P+Y M ++ +P  ++  I+  M  FWWG+ ++Q 
Sbjct  700   KLQGWKEKLLSRAGKEILLKSVIQVIPTYLMGVYKIPCMIIQKIQSAMARFWWGSSNSQR  759

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + WK+WD LC PK  GGMGF+ +K FN ALL +QAWRL   P  L  ++MKAKY+P+ 
Sbjct  760   K-VHWKSWDSLCSPKCLGGMGFKDLKVFNDALLGRQAWRLIREPNLLFGRVMKAKYFPHC  818

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F DA  G + S+ W S+  +K +++    WR+GNG  +++W D W+ D N   +T+   
Sbjct  819   DFLDAPLGYSSSYSWRSIWSSKALVKEGVIWRVGNGTQIKLWDDPWVADENGRFLTSEKN  878

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P    + V+ L++     W  E+    FN RD + IL  P+   P +D++ W       +
Sbjct  879   P--NFSLVSDLIDLENMEWRTEIFDSSFNERDIRCILGTPLSSAPVKDELTWAFTRDAHY  936

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             +VK+ Y      +LD+    SW  IW + + P+ + F+W++C+  LP   L ++R +   
Sbjct  937   SVKTAYMIGKGGNLDNFH-QSWVDIWRLEVSPKVRHFLWRLCTDSLPVRSLFKYRHLTND  995

Query  804   PLCPLCLNVEESAFHILAECSFATQCW------RLFEPLPATSQAQSCSEWITKCFE-SL  646
               CP    ++E+  H +  C      W       L +  P        + W  + F+  +
Sbjct  996   DCCPWGCGLQETRNHAIFHCPILAALWSDIGCESLLDFDPEAFMCDILASW--RGFDKKM  1053

Query  645   QPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQH  466
             Q   A L     W +W  RN  V+ N    +  ++     L R ++    V++ ++ +  
Sbjct  1054  QITGAYL----AWVLWGERNNLVF-NTKTSSHGIL-----LARVYRY---VEENEKYAGS  1100

Query  465   QYITK----------WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
              Y ++          W+ P  G  K+NVDA L +    +GL  + R  +G
Sbjct  1101  IYTSRTASPCSSPRHWVPPPAGVTKINVDACLGVEGW-VGLSAIARKSNG  1149



>ref|XP_010446022.1| PREDICTED: uncharacterized protein LOC104728786 [Camelina sativa]
Length=1030

 Score =   236 bits (603),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 168/557 (30%), Positives = 262/557 (47%), Gaps = 32/557 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R   W  R LS+ G+EV++KSV  A+P++ M+ F LP+ +   +   ++ FWW + D Q
Sbjct  447   ARAGGWPARLLSKGGKEVMIKSVATAVPTFVMSYFRLPKTVTQKLTSAISNFWWSSSD-Q  505

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              + L W AWD+LC+ K  GG+GFR + D+N ALL+KQ WRL   PESL A++ K +YY +
Sbjct  506   SQELHWVAWDRLCLTKSEGGLGFRCLDDYNTALLAKQFWRLITVPESLFARVFKGRYYRH  565

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLP-DVNNPRITTP  1168
             S   D  K  +PS+ W S++  + ++      R+G+G S+ +W D W+P     P I++ 
Sbjct  566   SDPMDPIKSYSPSYGWRSMVSARSLVNKGLITRVGSGASISVWTDPWIPAQFPRPAISS-  624

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
               P   +  VNS +    + WD  ++   F  +D  +I +IP+      D + W   + G
Sbjct  625   GLPLTPSLRVNSFVERTTNSWDMALLSAAFVPKDVAIISAIPLGTPTSSDMLGWHFTKSG  684

Query  987   VFTVKSCYKAISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
              ++VKS Y  +     S  I         + +W +  PP+ + F WQ  +GC+     LR
Sbjct  685   TYSVKSGYHILRQATTSRTICGPDITLLQAFVWKIRCPPKIRHFFWQAITGCIAVTSNLR  744

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCF-  655
              R + C   C  C    E+  H+L ECS A Q W L  F   P      S    +   F 
Sbjct  745   KRGLSCDTTCAFCGFPVETINHVLFECSPARQVWALSSFPTGPDAFPTASIYANMDFLFW  804

Query  654   ESLQPPRASLFVIICWNIWRARNEKVWKNI----CLPAKAVVENSKALWR---DWKACTE  496
              + Q P   ++  I W IW+ARN+KV+ N+       ++   E S+A +R   D      
Sbjct  805   RAKQSPTPDVYPWILWYIWKARNDKVFSNLDSNPLALSRIAEEESQAWFRAQLDDPVDVP  864

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
             V  Q      +      RP  G     VD +     + +G GW   +      +    + 
Sbjct  865   VGAQHVTHSDRCRMVVARPALGCLCF-VDGSWKATDKYVGRGWFCTSSGEEAPTMGAANL  923

Query  315   IGVLSPKEAEALAIREALSWCKR-------QHIDYIHVESDSLVVVHGLSS-PAFVTSFD  160
                L+P  AE     EAL W  R       Q + ++   SD + +V   S  PAF   F+
Sbjct  924   RRSLTPLHAEM----EALIWAMRCMISADNQDVVFLTDCSDLVKMVSSPSEWPAFKPYFE  979

Query  159   LLLADIKDLLSTFCSLL  109
              + AD K+  S   +L+
Sbjct  980   EIQADRKEFHSFSLALV  996



>ref|XP_009149314.1| PREDICTED: uncharacterized protein LOC103872634 [Brassica rapa]
Length=954

 Score =   236 bits (601),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 250/527 (47%), Gaps = 44/527 (8%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  + LS  G+EVLLKSV  +LP YAM++F LP+ + + I   M  FWWG G+ +
Sbjct  405   SRLHGWFAKTLSLGGKEVLLKSVAMSLPVYAMSMFKLPKDVCAKITSAMTEFWWGGGNGK  464

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              K + W +W KLC  KK GG+GF  I  FN +LL KQAWR+ ++P SL A+++K+KY+PN
Sbjct  465   RK-IAWVSWKKLCKQKKEGGLGFHDIVKFNQSLLGKQAWRIMSNPNSLVARVLKSKYFPN  523

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F  +  G  PS+ W S+L  + ++       IGNG    +W  NW+ D   P   TP 
Sbjct  524   VDFLQSSLGSRPSYAWRSILHGRDVLSKGLVRDIGNGERSNVWSVNWIID---PIPRTPN  580

Query  1164  FPYlanasvnsll----nNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
             +   +   +   +        S WD   VR+ F   DA++IL +  P   +ED   W   
Sbjct  581   YRQDSIVDLTLRVSDLLLPLSSSWDAARVREAFTDHDAEIILRLK-PNRNKEDGYKWGFT  639

Query  996   EKGVFTVKSCYKAISLDLDSVPIAS--------------WSTIWNVHLPPRAKTFIWQVC  859
             + G ++ +S YK     LDS+P  +              WS++W +  P + K F+W+  
Sbjct  640   KNGEYSSRSGYKF----LDSLPDENGLIQPSLPPLEKKLWSSLWKIKAPAKIKHFLWKAL  695

Query  858   SGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW-RLFEPLPATSQAQS  682
             SG +   D LR R I     C +C +  E+  H+L  C  A   W R    LPA     S
Sbjct  696   SGAVAVMDRLRSRGIQVDTTCKVCNSGIETICHLLFTCPMAKDTWERSAITLPAA--GFS  753

Query  681   CSEWITKCFESLQPPR-------ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKAL  523
              +      +  L+  +        + F  I W++W+ARN   ++ I   +  VV  +K  
Sbjct  754   TNSVFLNIYHLLEQSKKFPKNLNVNSFPWILWHLWKARNGLAFERIQYSSVFVVTRAKEE  813

Query  522   WRDWKACTEVDDQQRRSQH---QYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
                W        +  +  H     ++ W +P  G+ K NV  +        G+ W+LR++
Sbjct  814   ANVWFEVNSPRTEASQVPHPTGDSVSSWAKPPTGFLKCNVGVSWVSQHVHCGVAWILRDN  873

Query  351   HG--IFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVES  217
              G  I HS    S   V S ++AE L ++ A+      H   I  +S
Sbjct  874   KGKAILHSRRAFS--NVKSQRDAELLGLQWAVKDMVNTHQHNIIFDS  918



>ref|XP_009135908.1| PREDICTED: uncharacterized protein LOC103860050 [Brassica rapa]
Length=1207

 Score =   237 bits (605),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 171/555 (31%), Positives = 268/555 (48%), Gaps = 39/555 (7%)
 Frame = -2

Query  1692  SWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGL  1513
             SW+ RFLS AG+ V+LK+V+ A+PS+AM  FLLP GL   I+  +  FWW + +T  K +
Sbjct  643   SWSTRFLSSAGKMVMLKAVLTAVPSFAMTCFLLPVGLCKMIQSALTRFWW-DSNTGKKKM  701

Query  1512  RWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFF  1333
              W +WDKL  PK  GG+GF+ I+ FN+ALL+K  WR+  +P  L ++++  KY   +   
Sbjct  702   CWLSWDKLTKPKSLGGLGFKDIQTFNIALLAKLPWRMLTNPNCLLSRVLLGKYCHKAPLL  761

Query  1332  DAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYl  1153
               +     S  W  +L  + ++  +    +G G  +++W D W+   +   I   P    
Sbjct  762   KVQLVKGASHGWTGILAGRDLLASHIGRAVGEGTEIKVWTDAWISTTSRI-IPYGPLKEG  820

Query  1152  anasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTV  976
              N    S L N G+  W+ E++  I      + IL+I   +    D  IW   + G+++ 
Sbjct  821   TNDLYVSDLINRGTCEWNIEMISRIL-PEFVEEILTIKPSKTKARDSYIWYPAKSGIYSA  879

Query  975   KSCYKAISLDLD----SVPIASWS---TIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             KS Y A   D +    S  + S+    ++W++   P+ + FIW+   G LPT   L+ R 
Sbjct  880   KSGYAAAIADKELLDSSAQLDSFDWHRSVWSISSTPKLQIFIWKAIQGALPTGGNLQKRG  939

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRL------FEP---LPATSQAQSCSEWIT  664
             +  +  C  C   E +  H+L  C +A Q W L      F+P   L  +  AQ+   W  
Sbjct  940   MLQNTNCIHCGQTETTE-HLLLHCPYAAQVWSLIPLAGSFDPGLCLSISEAAQTSRTWT-  997

Query  663   KCFESLQPP---RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW-KACTE  496
              C     PP    + +F  +CWN+W  RN+ ++++    A+A    S A  R+W +A   
Sbjct  998   -CL----PPSGISSDIFSWVCWNLWTTRNKLLFESRPTSAQATATKSLANAREWLQAQDP  1052

Query  495   VDDQQRRSQHQYITKWIRPMQ---GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAAC  325
                 Q+ +Q+Q      RP     G    N DAA    S   GL W+  +   +  S  C
Sbjct  1053  AKSSQKHTQNQ-----ARPPSIPVGTVTCNTDAAWKKESLTAGLAWIFDSASSLTRSDGC  1107

Query  324   NSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLAD  145
                  V S   AE LAIREALS  +   I  I + SDSL ++  ++S     +   +L+D
Sbjct  1108  QYQTWVSSALMAEGLAIREALSHAQHLGITKIWIRSDSLSLIRAINSVTKPVNLYGILSD  1167

Query  144   IKDLLSTFCSLLYLF  100
             I+ L S+F    + F
Sbjct  1168  IESLSSSFVFCCFSF  1182



>ref|XP_009113011.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=682

 Score =   233 bits (593),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 165/550 (30%), Positives = 259/550 (47%), Gaps = 40/550 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +   W++RFLS AG+  +LKSV+  +PS+AM  F LP  L   I+  +  FWW N D   
Sbjct  137   KAAGWSNRFLSTAGKMTMLKSVLTPIPSFAMTCFQLPVSLCMRIQAALTRFWWDNIDGTN  196

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW K+ +PK  GG+ FR I+  N A L+K +WRL  +P +L  + +  KY P+ 
Sbjct  197   K-MAWIAWSKMILPKDQGGLDFRDIQSINDAFLTKLSWRLIRNPTNLLGRTLLGKYCPSG  255

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F         S  W  ++  + +I  N  W +GNG  + +W   WL      R   P  
Sbjct  256   DFLTCPVSSACSHGWRGIMVGRDLIVENSGWAVGNGECLNVWESPWLSLTAQERPMGPAP  315

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L N SV  L       W+ ++++ +    + ++ +  P   G   DK++W+  E G +
Sbjct  316   EALVNLSVADLFLPEKREWNLDLIQQVLPFEEHKIRMLKPSLMGA-PDKLMWLLSESGEY  374

Query  981   TVKSCYKA-------ISLDLDSVPIASW-STIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             T K+ Y A       I+L    +   +W  ++WN+H  P+ K FIW++    LP  + LR
Sbjct  375   TTKTGYAATIPKHTDITLIPQEILDFNWRKSVWNLHTAPKIKLFIWKLFHRALPVGEQLR  434

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC---SEWITKCF  655
              R+I     C LC  + E+  H+   CSFA + W L    P+   A +    SEWI    
Sbjct  435   ARQIKVDGKCKLC-GLPETIDHLFLHCSFAKRVWALVPVWPSIEFAGTAELRSEWICMLT  493

Query  654   ESLQPP----RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
                 PP      SL   I W +W+ARN  V+ +    A  V+  + A  R+W        
Sbjct  494   RQALPPTGIATGSLAPWILWQLWKARNSLVFNDKGFNATEVITLASAAAREWN-------  546

Query  486   QQRRSQHQYITKWIRP------MQGWFKLNVDAALDINSRKMGLGWVLR--NHHGIFHSA  331
                +SQ Q +TK   P       +    +  DAA +   +  GLGW+++  N   +F   
Sbjct  547   ---QSQAQTLTKQKHPPVRASLPEDCVVVRSDAAWNEAKKVAGLGWIIKSQNRASVFSEP  603

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLL  151
             A   ++G  SP  AE +A+REA+  C+   +  +  ESD   ++  L+S    +    ++
Sbjct  604   A--RFVG--SPLVAEGMALREAVLKCRDLGLPRLRCESDCAQLIKALTSDQSFSELYGIV  659

Query  150   ADIKDLLSTF  121
              DIK +  +F
Sbjct  660   EDIKSVSFSF  669



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score =   239 bits (609),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 165/550 (30%), Positives = 258/550 (47%), Gaps = 27/550 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  R LS+ G+E+LLKSV  A+P +AM  F LP+    ++   M+ FWW + + + 
Sbjct  1241  RMSGWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKK  1300

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK  GG+GF+ I+ FN ALLSKQAWR+    + L A+  K++Y+P+S
Sbjct  1301  K-MHWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDS  1359

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD--VNNPRITTP  1168
              F  A  G  PS+ W S+L  + +++   R  IG+G S  +W   W+ D  +  P +   
Sbjct  1360  DFLSATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNI  1419

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              F                  WD   ++  F  RD +LIL I  P    ED +IW   + G
Sbjct  1420  LFDLDLMVKDLLDTTTQ--SWDLAKLQYHFYPRDVELILKIK-PVMSSEDYLIWEHTKSG  1476

Query  987   VFTVKS----CYKAISLDLDSVPIASWST------IWNVHLPPRAKTFIWQVCSGCLPTA  838
              ++VKS     Y+   +DL +  +   S       IW +    + + F+W+V SG +P A
Sbjct  1477  AYSVKSGYWAAYQREKIDLLTEALMQPSVLPIKNQIWKISTATKIRNFLWKVVSGAIPVA  1536

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLP-----ATSQAQSCS  676
             D +  R +     C  C    ES  H+L  C+ A Q W +F  P+P     + S  Q+  
Sbjct  1537  DKMLSRGMKVDSRCQSCGLEGESVNHVLFSCTVARQVWAMFNFPVPCNGFDSESVFQNIY  1596

Query  675   EWITKCFESLQPPRA-SLFVIICWNIWRARNEKVWKNICLPAK---AVVENSKALWRDWK  508
               +     S  P    + F  + W +W+ RN   ++     A    A + ++ + W   +
Sbjct  1597  YLLLVSKNSKYPVEVRTAFPWVVWQLWKNRNLFSFEGRSFCASRTVAKIRDNASQWFHAQ  1656

Query  507   ACTEVDDQQRRSQHQYITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
             + T  D    RS+     K W  P+QGW K N+ ++ D  +   G  WVLRN  G     
Sbjct  1657  SLTVADAIVERSKADLGKKGWYPPVQGWKKCNLGSSWDKETSTGGAAWVLRNEKGETLMH  1716

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLL  151
             +  S+  V S  +A  L    A+   K  + D I   S+   ++  +  P    SF    
Sbjct  1717  SRRSFASVFSKMDASLLCWLWAIESMKSLNFDKIVFASEDSALMGAVQRPPAWPSFKFQS  1776

Query  150   ADIKDLLSTF  121
               I + L +F
Sbjct  1777  RSIGNALGSF  1786



>gb|ABN07997.1| contains similarity to reverse trancriptase , related [Medicago 
truncatula]
Length=407

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 180/326 (55%), Gaps = 10/326 (3%)
 Frame = -2

Query  1674  LSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWD  1495
             LS  GR VL+K+V QA+P+Y M+ F+LP+GL + IE+ +  FWWG  D + K + W +  
Sbjct  64    LSFEGRGVLIKAVAQAIPTYYMSCFMLPKGLCTKIEKAICSFWWGTTD-KNKKMHWVSKK  122

Query  1494  KLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGG  1315
             KL   K  GG+GF+ ++DFNLA+L+K+  R + +P SL AK  KA YYP++    AK G 
Sbjct  123   KLFRSKHSGGLGFKTLRDFNLAMLAKKVRRFYTNPNSLIAKCFKANYYPHTDILQAKVGN  182

Query  1314  NPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvn  1135
              PS+ W S+     +I     WRIG+G S+ IW DNW+P     ++ T   P      V 
Sbjct  183   YPSYAWKSIQNAIWVISKGSCWRIGDGGSINIWEDNWVPTYKGLKVMTTKGPNHFVNRVK  242

Query  1134  sllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAI  955
              L+NN  S W+  ++ D F S +   I  IP+      D ++W+ +  G+++VKS Y  +
Sbjct  243   DLINNQESLWNKVILEDQFISINIDQISHIPLVNTTNPDSLMWMHNPTGIYSVKSGYNTL  302

Query  954   ----SLDLDSVPIAS-----WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSP  802
                 +  +++   +S     W  IW++H  PR K  +W++ +  LP    LR R I C P
Sbjct  303   RTWQTQQINNTSTSSDETLIWKKIWSLHTIPRHKVLLWRILNDSLPVRSSLRKRGIQCYP  362

Query  801   LCPLCLNVEESAFHILAECSFATQCW  724
             LCP C +  E+  H+   C  + + W
Sbjct  363   LCPRCHSKTETITHLFMSCPLSKRVW  388



>gb|EEC74955.1| hypothetical protein OsI_10942 [Oryza sativa Indica Group]
Length=961

 Score =   235 bits (599),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 138/407 (34%), Positives = 208/407 (51%), Gaps = 20/407 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
             F  R+  W  + LS  G+EVL+KSV+QALP+Y M++F LP  L  +  + +  FWWG  D
Sbjct  512   FEKRLSEWCEKNLSMGGKEVLIKSVLQALPTYVMSVFRLPASLCEEYMQLIRKFWWGE-D  570

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                + + W +W +L  PK  GG+GFR +K FN ALL++QAWRL  +P SL A+++KAKY+
Sbjct  571   QNNRKVHWISWQQLIKPKGQGGIGFRDLKLFNQALLARQAWRLIQYPSSLCAQVLKAKYF  630

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             P+    D     + S  W  ++    +++    WRI +G  V+IW DNW+P  +N ++  
Sbjct  631   PSGDLIDTAFPVDSSETWKGIMHGLELLKKGLIWRISDGSKVKIWRDNWIPREHNLKVIG  690

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                       V+ LL      W++E+VR++F   DA+ IL I +P  P ED + W  D+ 
Sbjct  691   RK-TRSRLKWVSDLLLPDRQQWNEELVRNMFYPPDAEGILRIQLPHSPGEDIVAWHYDKS  749

Query  990   GVFTVKSCYKAISLDL----------DSVPIAS---WSTIWNVHLPPRAKTFIWQVCSGC  850
             G+FTV+S YK ++LD            S P      W  IWN  +P + + F W++   C
Sbjct  750   GIFTVRSAYK-VALDALLRSDNTGESSSAPNGERTLWKNIWNTQVPQKVRIFAWRLARDC  808

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQ-AQS  682
             L T    + R I  SP+C +C   EE  FH    C+ A       R++  LP      Q+
Sbjct  809   LATQAKKKRRNIVKSPVCEICGKCEEDGFHATVACTKARALRSEMRIYWNLPLEEIFVQN  868

Query  681   CSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVV  541
               +W+    +   P   +  +++ W  W  RN  V  N     K  V
Sbjct  869   GPDWLLLLLQQADPHTRAETLLLLWRAWYLRNNVVHGNGQASVKGSV  915



>ref|XP_007219602.1| hypothetical protein PRUPE_ppa023113mg, partial [Prunus persica]
 gb|EMJ20801.1| hypothetical protein PRUPE_ppa023113mg, partial [Prunus persica]
Length=851

 Score =   234 bits (597),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/400 (35%), Positives = 211/400 (53%), Gaps = 21/400 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S+I  W  + LS+AGREVL+KSV  A+P+Y M+ FLL   + + I   +  FWWG+   Q
Sbjct  333   SKIAGWKLKLLSQAGREVLIKSVAAAIPAYPMSCFLLLATICNSINADLARFWWGHDGNQ  392

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             GK + W +W KLC PK  GGMGFR ++ FN +LL+KQ WR+  +P +L A+I+KA+Y+P 
Sbjct  393   GK-IHWHSWKKLCRPKAEGGMGFRDLQAFNWSLLAKQCWRILRNPTTLWARILKARYFPE  451

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F DAKKGG  S+ W+SLL  + II+   RW+IGNG  V +W D WL    + +I+  P
Sbjct  452   CSFLDAKKGGRASWAWSSLLVGRDIIEKGARWQIGNGHLVSVWKDRWLMGYGSEKISPLP  511

Query  1164  FPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
                     + + L + G+  W+   +    +  +A LI S PI      D+++W   + G
Sbjct  512   SCNRFTPLLVADLIDVGNRSWNISHIEPFIHPSEAMLIRSTPIGSLATRDRLVWPAVKNG  571

Query  987   VFTVKSC-YKAISL----------DLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              +TVKS  Y AI++             +V    W  IW  H+ P+ + F+W+  +  +PT
Sbjct  572   DYTVKSGYYHAINVSPPDPCDRASSSHAVNSDVWKVIWRAHITPKIRNFMWRALTNSIPT  631

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWI  667
                L  R++  SP C LC    E+  H+L  CS+    W    F   P  +   +   W+
Sbjct  632   CANLFGRKLARSPTCRLCGLFPETVEHLLLLCSWTRAVWFGCPFGYTPDLASITTLDSWL  691

Query  666   TKCFESLQPP------RASLFVIICWNIWRARNEKVWKNI  565
             +    S            SLF+   W IW+AR + ++ +I
Sbjct  692   SGFLRSSFADGDQRDWGISLFMFCSWEIWKARCKAIFNDI  731



>ref|XP_010480950.1| PREDICTED: uncharacterized protein LOC104759762 [Camelina sativa]
Length=1598

 Score =   238 bits (607),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 162/539 (30%), Positives = 260/539 (48%), Gaps = 24/539 (4%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  + LS+ G+EVLLKS+  ALP YAM+ + LP+G++  +   M  +WW N   +
Sbjct  993   SRLTGWYAKNLSQGGKEVLLKSIALALPVYAMSCYKLPKGIIKKMISVMMDYWWSNTQDK  1052

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              K + W +++K+ +PK  GG GF+ ++ FN ALL+KQAWRL +  + L ++  K++YY  
Sbjct  1053  KK-IHWLSYEKMTLPKSAGGFGFKDLEIFNQALLAKQAWRLLHDTDCLFSRFFKSRYYAT  1111

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A KG NPS+ W S++  + ++    +  IGNG +  +W DNWL D    R     
Sbjct  1112  DDFLNAAKGRNPSYGWRSIIFGRQLLSKGLKRVIGNGKNTLVWIDNWLFDNRAIRPIGLH  1171

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  N  V  L N+    W+D ++R +F+  +   I +I  P+   +D   W +   G+
Sbjct  1172  SLMNINLRVVDLFNHRTRIWNDFLLRSLFHHSEINTIKAIK-PRIGFDDSFCWGETRNGI  1230

Query  984   FTVKSCY----KAISLDLDSVPIASWST------IWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++V S Y    K    D+  V     ST       W V+  P+ + F+W+  +G L   D
Sbjct  1231  YSVSSGYALMFKLQKKDILGVAETRPSTNPVLQACWTVNTAPKIQVFLWKALNGALAVVD  1290

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSE-----  673
              LR R I     C  C    ES  HIL  C FA Q W L + P P     +S        
Sbjct  1291  RLRTRAIRIFDGCMFCNAEVESINHILFLCPFARQVWALSDIPSPHLGFGKSIFANMYYL  1350

Query  672   -WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
               + K  +S+   + S F  I W++W+ RN  ++  + LP   +V  +  + RDW +   
Sbjct  1351  FGLEKIIDSIDEVK-SAFACILWHLWKNRNSFLFDGVFLPPDVLVHKALDVTRDWSSVHR  1409

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
              D  Q  +  +    W  P QG  K N+  +        G  WV+R+H G     +  S+
Sbjct  1410  QDISQLNTLSKQTNTWQPPFQGEVKCNIGFSWSKRFSLSGASWVVRDHDGKVVLHSRRSF  1469

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS----PAFVTSFDLLL  151
               V+S  EA+  +   AL      H +++   + ++ ++  + +    PA V+S   LL
Sbjct  1470  ASVVSVFEAKIKSWEWALESMASLHFEHVTFGATTMEIIKAMHNPQQWPALVSSISPLL  1528



>ref|XP_010451225.1| PREDICTED: uncharacterized protein LOC104733339 [Camelina sativa]
Length=922

 Score =   234 bits (598),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 145/469 (31%), Positives = 241/469 (51%), Gaps = 29/469 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  WN ++LS+ G+E+++KSV  ALP++ M+ + LPQ L+S +   ++ FWW + D + 
Sbjct  342   RVNGWNAKYLSKGGKEIMIKSVALALPTHVMSCYKLPQELMSKLTSAISTFWWKSND-KA  400

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +GL W AWDKLC     GG+GFR ++ FN A+L+KQ WRL ++P SL A+++K +Y+ N 
Sbjct  401   RGLHWVAWDKLCKDNCEGGLGFRALEQFNDAMLAKQYWRLIHYPTSLMARVLKGRYFWNK  460

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A K  NPSF W S+  TK ++    RW +G+G S+ +W D W+PD           
Sbjct  461   HPLMATKPYNPSFAWRSIFSTKELVAQGARWAVGSGCSISVWRDPWIPDTRPRPANGQGR  520

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +L +  VN L+N     W    + +  +  D  +I  + + +  + D+++W   + G +
Sbjct  521   LWLPSLMVNHLINPVTKDWHLPTLEEFLDPEDVAIIRGMTVSKVLKPDRLVWHFTKSGKY  580

Query  981   TVKSCYK-----AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             TV+S Y+        ++     +A  +  W + +PP+ + F WQV SG LP  + L HR 
Sbjct  581   TVRSGYRLARDLMAEVEYGPTCMALRAHSWKLDVPPKIQHFFWQVASGSLPVLERLVHRG  640

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCF----  655
             + C PLC  C +  E+  H L EC  +   W L     +P      S    +   F    
Sbjct  641   VRCDPLCKRCESAPETINHALFECPRSRDVWALSSVSSVPDGFPYGSIYANLDFIFWRAT  700

Query  654   -ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVV---ENSKALWRDWKACTE---  496
              +S  P  AS    I W++W+ RN+KV++ +      ++    N K LW + K+ +E   
Sbjct  701   SQSGDPDIASRLPWILWSLWKDRNKKVFQGLAAEPVDILNQAHNDKLLWEEAKSFSESYL  760

Query  495   -----VDDQQRRSQHQYITKW--IRPMQG---WFKLNVDAALDINSRKM  379
                  ++D+    + Q    W  + P+QG   W   + D+ L + +R +
Sbjct  761   HPPAVLEDRGPFPRCQIDGSWKGLDPLQGLGWWCFSSEDSTLLLGARSI  809



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score =   238 bits (607),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 164/550 (30%), Positives = 258/550 (47%), Gaps = 27/550 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W  R LS+ G+E+LLKSV  A+P +AM  F LP+    ++   M+ FWW + + + 
Sbjct  1241  RMSGWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKK  1300

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK  GG+GF+ I+ FN ALLSKQAWR+    + L A+  K++Y+P+S
Sbjct  1301  K-MHWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDS  1359

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPD--VNNPRITTP  1168
              F  A  G  PS+ W S+L  + +++   R  IG+G S  +W   W+ D  +  P +   
Sbjct  1360  DFLSATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNI  1419

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
              F                  WD   ++  F  RD +LIL I  P    ED +IW   + G
Sbjct  1420  LFDLDLMVKDLLDTTTQ--SWDLAKLQYHFYPRDVELILKIK-PVMSSEDYLIWEHTKSG  1476

Query  987   VFTVKS----CYKAISLDLDSVPIASWST------IWNVHLPPRAKTFIWQVCSGCLPTA  838
              ++VKS     Y+   +DL +  +   S       IW +    + + F+W+V SG +P A
Sbjct  1477  AYSVKSGYWAAYQREKIDLLTEALMQPSVLPIKNQIWKISTATKIRNFLWKVVSGAIPVA  1536

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLP-----ATSQAQSCS  676
             D +  R +     C  C    ES  H+L  C+ A Q W +F  P+P     + S  Q+  
Sbjct  1537  DKMLSRGMKVDSRCQSCGLEGESVNHVLFSCTVARQVWAMFNFPVPCNGFDSESVFQNIY  1596

Query  675   EWITKCFESLQPPRA-SLFVIICWNIWRARNEKVWKNICLPAK---AVVENSKALWRDWK  508
               +     S  P    + F  + W +W+ RN   ++     A    A + ++ + W   +
Sbjct  1597  YLLLVSKNSKYPVEVRTAFPWVLWQLWKNRNLFSFEGRSFCASRTIAKIRDNASQWFHVQ  1656

Query  507   ACTEVDDQQRRSQHQYITK-WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
             + T  D    RS+     K W  P+QGW K N+ ++ D  +   G  WVLRN  G     
Sbjct  1657  SLTAADAIIERSKADLGKKGWYPPVQGWKKCNLGSSWDKETSTGGAAWVLRNKKGETLMH  1716

Query  330   ACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLL  151
             +  S+  V S  +A  L    A+   K  + D I   S+   ++  +  P    SF    
Sbjct  1717  SRRSFASVFSKMDASLLCWLWAIESMKSLNFDKIVFASEDSALMGAIQRPPAWPSFKFQS  1776

Query  150   ADIKDLLSTF  121
               + + L +F
Sbjct  1777  RSVGNALGSF  1786



>gb|EEC84753.1| hypothetical protein OsI_31756 [Oryza sativa Indica Group]
Length=1350

 Score =   237 bits (604),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/382 (36%), Positives = 199/382 (52%), Gaps = 24/382 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W   +LS  G+E+L+K++IQA+P Y M +F LP+ +  ++ R   GFWWG G+   
Sbjct  974   RLIQWGENYLSSGGKEILIKALIQAIPVYVMGIFKLPESVCDELTRITRGFWWG-GEKGA  1032

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   WKAWD L  PK  GG+GFR  + FN ALL++QAWRL + P+SL A ++KAKY+ N 
Sbjct  1033  RKTHWKAWDTLTKPKNCGGLGFRDFRLFNQALLARQAWRLIDSPDSLCAMVLKAKYFLNG  1092

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   GGN S  W ++     +++    WRIGNG SVRIW D W+P  ++ R  T   
Sbjct  1093  NLTDTSFGGNASPGWRAIEFGLELLKKGIIWRIGNGRSVRIWRDPWIPRDHSRRPITKKS  1152

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              Y       + L      WD   VR IF   DA++IL I +P     D + W  D  G F
Sbjct  1153  NY--KTKWVTDLLTDAGEWDVNRVRQIFWPIDAEVILKIRVPSQDVSDFVAWHPDRLGRF  1210

Query  981   TVKSCYK-AISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADLL  829
             +V+S Y  A+SL  ++   AS        W+ +W  ++P + K F W+V   CL T    
Sbjct  1211  SVRSAYSLAVSLASENAFSASSAVDRSKAWNMLWKCNVPQKVKIFAWKVALDCLATMVNK  1270

Query  828   RHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSC--------SE  673
             + R+++ + +C +C   EE + H L  C  A   W   +     SQ  SC        S 
Sbjct  1271  KRRKLEATDVCAICGTEEEDSAHALCRCPHAKSLWMAMK----ESQNISCIMDDGPFGSG  1326

Query  672   WITKCFESLQPPRASLFVIICW  607
             WI    E L  P  ++F+++ W
Sbjct  1327  WIFDRLEHLLEPERAMFLMVLW  1348



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 219/449 (49%), Gaps = 10/449 (2%)
 Frame = -2

Query  1419  KQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIG  1240
             ++AWRL  +P+ L  K+ KA+YYPN  F  +  G NPS++WASL + + +I    +W+IG
Sbjct  15    RRAWRLVENPDLLVGKLYKARYYPNGDFLSSLLGTNPSYIWASLQQVRDLICKGVQWKIG  74

Query  1239  NGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDA  1063
              G  V I    WL D +N  I T   P          L   G+  WD E++ D+F+ RD 
Sbjct  75    KGTEVSIGLHEWLLDASNGFIETN-LPDELRLQPVCSLLKPGTCDWDQEILNDLFSERDK  133

Query  1062  QLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLDSV---PIASWSTIWNVHLP  892
              LI SI +      D++ W KD KG F+VK  Y+    D   +    +  W  +W +++ 
Sbjct  134   NLINSIVLSPTVGTDQLFWFKDPKGKFSVKDVYRVQQPDFSVLYPSNVVVWRRLWKLNIA  193

Query  891   PRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE  712
              + K F+W+  +  LP    L  R++     CP C++  E+  HIL  C   TQ W+   
Sbjct  194   AKCKVFMWRALTNRLPVRTNLVMRKVTEDSSCPCCVSQPETIMHILVLCDVTTQSWKYVN  253

Query  711   PLPATSQAQSCSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENS  532
                  SQ  +  E     FE       + FV++ W++W   N+ VW    L  +AV   +
Sbjct  254   LYQFLSQVSNLLEGARSVFEHFDDSIVASFVVLWWSLWTNMNDVVWNGKKLSWRAVASRA  313

Query  531   KALWRDWKACTEVDDQQRRSQHQYITK--WIRPMQGWFKLNVDAALDINSRKMGLGWVLR  358
              +    W    ++ D  +  +H       W +P  G +KLNVDA+      K G  +VLR
Sbjct  314   SSFLFQWGKARKLTDYHQLGRHFAGGDCLWQKPATGKYKLNVDASSSAERGKSGASFVLR  373

Query  357   NHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
             ++ GI+ +        + +P  AEA A++EALSW   + ++ + +E+D L  +  L    
Sbjct  374   DNAGIWITGVLIIRPYIANPDVAEAWALKEALSWIHAKGMEEVQIETDCLRNIELLEEEL  433

Query  177   FVTSFDL-LLADIKDLLSTF--CSLLYLF  100
                S+ L LL D +DLL     C+L++++
Sbjct  434   HPNSYLLCLLKDCQDLLRVLNRCNLVFVY  462



>ref|XP_008382787.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=801

 Score =   233 bits (594),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 173/556 (31%), Positives = 267/556 (48%), Gaps = 29/556 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LSRAG+EVL+K+V+QA+P+Y M++F  P  +  +++  +  FWWGN D
Sbjct  196   ILEKMQGWKQSSLSRAGKEVLIKAVVQAIPAYPMSIFKFPAIVCKELDTLVAAFWWGNKD  255

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                K + W + D L +PK  G +GFR  ++FN ALL+KQ WRL + P SL A+++KA+Y+
Sbjct  256   GARK-MHWVSXDVLGLPKDLGXLGFRNFQEFNDALLAKQCWRLVSDPNSLWARVIKARYF  314

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDV--NNPRI  1177
             P    ++A KGG  S+ W+S+L  + +++    W+I  G  VR+W D WLP +   +P +
Sbjct  315   PRCNIWEATKGGRASWAWSSILTGRDLLKLGSHWQILGGQDVRVWVDKWLPSLPMGHP-M  373

Query  1176  TTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
                  P   N  V+SL+      WD   +    +  D Q I   PI    R+D++IW   
Sbjct  374   PLGSVPVTLNLRVSSLICPDSRRWDLNFLLPFLSDSDKQAIEDTPIGDLSRKDRIIWGSS  433

Query  996   EKGVFTVKSCYKAI-SLDLD----------SVPIASWSTIWNVHLPPRAKTFIWQVCSGC  850
             + G+++VKS Y+ I S  L            VP   W  IW + +PP+ + F+W     C
Sbjct  434   KNGIYSVKSGYRWIQSXSLARRDCRLSXARRVPSVLWKAIWKLEVPPKLRHFLWLTLHNC  493

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCS  676
             LPT + L  RR   S  CP CL+ +E+  H+   C +    W           +   S  
Sbjct  494   LPTCEALFRRRSSLSXTCPXCLSHDETIEHLFFTCPWVEPVWFGGALNYKIDRAAIHSWV  553

Query  675   EWITKCFESLQPPR------ASLFVIICWNIWRARNEKVWKNICL-PAKAVVENSKALWR  517
             EW+   + S   P        S     CW IW+ R + V+  + + P+K +   S A+  
Sbjct  554   EWLXAVWSSSLVPSNHADWMRSYIAYTCWVIWKTRCDFVFNKVPIYPSKVLFAISTAVGS  613

Query  516   DWKACTE--VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
                A     V            ++W  P     K+NVDA+    S+    G V+R   G 
Sbjct  614   FLAANVSLGVSRSAGAGGVDLGSRWCAPTSPLXKINVDASWSKVSKLGFAGVVIRAAEGR  673

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
             F +AA    I   S   AEALA+           I+ + +ESD    V+ LS    + S+
Sbjct  674   FVAAARYP-ISAPSAAAAEALALLRGCDLGVALGINEVIIESDCRDAVNCLSDSLEMGSW  732

Query  162   DL--LLADIKDLLSTF  121
             +   +LA +K L   F
Sbjct  733   EAFPVLAQVKQLREAF  748



>ref|XP_010451645.1| PREDICTED: uncharacterized protein LOC104733795 [Camelina sativa]
Length=1000

 Score =   234 bits (597),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 164/557 (29%), Positives = 258/557 (46%), Gaps = 27/557 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              R   W    LS+ G+EV++KSV  A+P++ M+ F LP+ + S +   +  FWW      
Sbjct  274   GRTNGWTANLLSKGGKEVMIKSVATAVPTFVMSCFRLPKTITSKLTSVVANFWWSTNGQT  333

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
             G G+ W AW+KLCV K+ GG+GFR + DFN ALL+KQ WRL + P+SL A++ K++YY N
Sbjct  334   G-GMHWLAWEKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPDSLFARVFKSRYYRN  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   D  +  +PS+ W S+   + ++      R+G+G ++ IW D W+P        +  
Sbjct  393   THPLDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPALSKG  452

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  +  +N L++   + W  +++ + F+  D  LI +IP+    R+D   W   + G 
Sbjct  453   LVKDLSLQMNQLIDCRTNTWCMDMLHEHFDPSDVALIQAIPLGGNQRDDPYGWHFTKTGR  512

Query  984   FTVKSCYKAISLDLDSVPIASWS---------TIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TVKS Y    LD++   +A  S          +W  H PP+ + F+WQV SGC+  +  
Sbjct  513   YTVKSGYHTARLDVNRTFLACGSGPEITPLLAGVWRAHCPPKIQHFMWQVLSGCISVSAN  572

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPATSQAQSCSEWITKCF  655
             L  R I C   C  C   EE+  H +  C  A Q W L   P+   S            F
Sbjct  573   LGRRGIACDIGCVRCGADEETVNHAIFTCPPARQVWALAHVPVGPISFPTDSVYANVDHF  632

Query  654   ESLQPPRASL--FVIICWNIWRARNEKVWKNICLPAKAVV---ENSKALWRDWKACTEVD  490
                Q P A +  F  + W IW+ARN +V++NI    + +V   E     W+  +A  ++D
Sbjct  633   LGQQNPGAHVAAFPWLMWYIWKARNARVFENIVEQPEDIVRVAEGEATGWQQAQAEEDLD  692

Query  489   DQQRRSQHQYITKWIRPMQGWF---KLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
                       +      +   F   +  +D +     +  G GW   +   +       +
Sbjct  693   IYHPIPVGLSVRADTNSLPTVFSGHRCFIDGSWKAEDQFAGAGWCCTSLQVLSPLMGART  752

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDY----IHVESDSLVVVHGLSSPAFVTSFDLLL  151
             +   LSP  AEA    EA  W  R  I +    +   +D   +V  +SSP+   +F   L
Sbjct  753   FRRSLSPLHAEA----EAFLWAMRCMIGHDFRDVAFYTDCSDLVKMMSSPSDWPAFSTYL  808

Query  150   ADIKDLLSTFCSLLYLF  100
              DIK     F S    F
Sbjct  809   DDIKIDREEFTSFSLSF  825



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score =   235 bits (600),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 140/460 (30%), Positives = 232/460 (50%), Gaps = 24/460 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  WN + LS+ G+E+++KSV  ALP++ M+ + LPQ L S +   ++ FWW + D + 
Sbjct  676   RVNGWNAKLLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAISTFWWKSND-KA  734

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
              GL W AWDKLC  K  GG+GFR ++ FN A+L+KQ WRL  HP SL A+++K +Y+ N 
Sbjct  735   HGLHWVAWDKLCKDKCDGGLGFRALEQFNDAMLAKQYWRLIQHPTSLMARVLKGRYFSNK  794

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 AKK  NPSF W S+  TK +++   RW +G+G S+ +W D W+PD+          
Sbjct  795   HPLMAKKPSNPSFAWRSIFSTKDLVEYGARWAVGSGSSISVWRDPWIPDIRPRPANGRGR  854

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +L +  VN L+N     W    + +  +  D  +I  + + +  + D+++W   + G +
Sbjct  855   LWLPSLMVNHLINPVTKDWHLPTLEEFLDPGDIPIIRRMSVSKVQQRDRLVWHFTKSGKY  914

Query  981   TVKSCYK-----AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             TVKS Y+        ++     +A  + +W + +PP+ + F WQ+ SG LP  + L +R 
Sbjct  915   TVKSGYRLARELMTEVEYGPTCMALRAQVWKLDVPPKVQHFFWQIASGTLPVLERLAYRG  974

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWITKCF----  655
             I C  LC  C    E+  H L EC  +   W   L   +P      S    +   F    
Sbjct  975   IRCDTLCKRCGAAPETINHALFECPRSLDVWELSLVSLVPDGFPFASIYANLDFIFWRAA  1034

Query  654   -ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVE---NSKALWRDWKACTEVDD  487
              +S     A+    I W +W+ RN+KV++ +      ++    N K LW + K+ ++   
Sbjct  1035  SQSGDSDVANRLPWILWTLWKDRNKKVFQGLQAEPTEILHQANNDKLLWEEAKSYSD---  1091

Query  486   QQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGW  367
                  ++ + T  +     + +  +D +   +    GLGW
Sbjct  1092  -----RYLHTTPLVEDRGAFPRCQIDGSWKGSDAMQGLGW  1126



>ref|XP_008352230.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=775

 Score =   232 bits (592),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 160/534 (30%), Positives = 252/534 (47%), Gaps = 26/534 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LS+AGRE+L+K+V QA+P+Y MNLF  P    ++++  +   WWG   
Sbjct  104   LLDKLQGWKKSTLSQAGREILIKAVAQAIPAYPMNLFKFPVSFCNEMDALIAKXWWGQKL  163

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + + + W + ++L   K+ GG+G R     N ALL+KQ WRL + P +L A ++KA+Y+
Sbjct  164   GENR-IHWVSXERLGRSKEEGGLGLRSFSIXNDALLAKQCWRLISEPNTLWALVLKARYF  222

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN  F DAKKGG  S+VWASLL  + I++    W+I +G   R+W D W+P +   R + 
Sbjct  223   PNCSFLDAKKGGRASWVWASLLAXREILRAGAHWQIMDGNDTRVWVDRWIPPIPLGRPSP  282

Query  1170  PPFPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  ++       L    SG WD + ++      + + IL +       +D+++W  ++
Sbjct  283   LGSVXVSKNLKVKSLICPVSGEWDLDFLKPFLADSEVEXILDLHTGDPTLKDRLVWPFEK  342

Query  993   KGVFTVKSCYK----------AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLP  844
             +G ++VKS Y             S+ L S+P   W T+W + +PP+ +TF+W+     L 
Sbjct  343   RGSYSVKSGYYWSLNRSQVRCQQSIRLVSIPSTLWKTVWKLKVPPKIRTFMWKTLHAALA  402

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSEW  670
             T   L  RR   SP C LC + +ES  H+   C      W        P   Q  S + W
Sbjct  403   TMKNLYIRRSSPSPTCXLCNSFDESIEHLFLFCPXVEVVWFGGRLNLRPNRQQVSSWASW  462

Query  669   ITKCFES------LQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK  508
             + +  E+      ++  R S     CW+ W++R E  + N  +    VV        D++
Sbjct  463   LVQMGEAENGSAEVRIDRISYIAFTCWHXWKSRCEFQFNNQVIYPSRVVAXVXRSVXDYQ  522

Query  507   ACTEVDDQQRRSQHQYI----TKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
               T      R   +Q        W  P  G  K+NV A+ +  S     G V R+  G F
Sbjct  523   G-TIFRXSSRSLLNQXSLGAGVXWSPPDHGVIKINVXASWEAKSGVGFTGVVARDEQGCF  581

Query  339   HSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPA  178
              +A+ +  I       AEALAI    +       + I VESDS   +  L  PA
Sbjct  582   LAASRHK-IKXTGAXMAEALAIMHGCNLGVSNGWNSICVESDSYDAISCLRDPA  634



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score =   233 bits (594),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 147/464 (32%), Positives = 225/464 (48%), Gaps = 34/464 (7%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LSRAG EVL+K+V+QA+P+Y MN+F  P  L  +++  +  FWW +  
Sbjct  358   ILGKLQGWKQSMLSRAGNEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSS  417

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + K   W + + L +PK  GGMGFR  +DFN ALL+KQ WRL   P+SL A++MKA+Y+
Sbjct  418   GRRK-THWVSMETLGLPKHLGGMGFRNFQDFNDALLAKQCWRLIVEPDSLWAQVMKARYF  476

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              N  F DA KG   S+ W+SLL  + +IQ    W+I  G  VR+W D W P +    +  
Sbjct  477   SNCSFLDATKGDRTSWAWSSLLVGRDLIQKGAHWQIMGGEEVRLWVDRWXPAL----LLG  532

Query  1170  PPFPYlanasvnsllnNH-----GSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIW  1006
              P P    A   +   +         WD E +    ++ +   I   PI    R+D+++W
Sbjct  533   HPSPSGDVAVTRNTRVSSIICPSSKTWDFEFLLPFLSAEECAAIRDTPIGNPRRKDRLVW  592

Query  1005  VKDEKGVFTVKSCYKAISLDLD-----------SVPIASWSTIWNVHLPPRAKTFIWQVC  859
               +  G ++VKS Y  + L              SVP   W  IW V +P + + F+W   
Sbjct  593   ASNRNGSYSVKSGYLWLQLQSLSLIDHRSPISRSVPELLWKGIWRVKVPAKVRLFLWSSL  652

Query  858   SGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQA---  688
                L T  +L  RR   +P+CP+CL  EES  H+L  C +    W     L    Q    
Sbjct  653   HNALVTVAVLFQRRSSPTPICPICLCQEESVEHLLLSCPWVFSIWS-GGALKYNIQVGIF  711

Query  687   QSCSEWITKCFESLQPPRAS------LFVIICWNIWRARNEKVWKNI-CLPAKAV--VEN  535
              S   W+   F S     AS           CW+IW++R + V+  +  +P+K +  +  
Sbjct  712   SSWGAWLHAVFTSNLGSLASKEWVQTYMAFTCWHIWKSRCDYVFNQVPIIPSKVIMGIGF  771

Query  534   SKALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAA  403
             S A + + ++         R   + + +W  P+  + KLNVDA+
Sbjct  772   SVAEFLNARSVPVNSQSVDRGLVRQLCRWTPPVSPFVKLNVDAS  815



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score =   234 bits (597),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/432 (32%), Positives = 224/432 (52%), Gaps = 20/432 (5%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
               SR+ SW+ + LS+ G+EVL+KSV QA+PSY M+ FLLPQ ++  +   +  FWW    
Sbjct  639   LMSRLNSWSAKLLSKGGKEVLIKSVAQAMPSYVMSCFLLPQDIIKKLTSAIARFWWST-K  697

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                +GL W AW+K+C+P + GG+GFR +K+FNLALL+KQ WRL  +P SL AK++K +Y+
Sbjct  698   QNNRGLHWVAWNKICLPTEKGGLGFRDLKNFNLALLAKQLWRLVQYPTSLLAKVLKERYF  757

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
              NS   D +K   PS+VW S++  K +++   R  IG+G + R+W + W+P    PR  T
Sbjct  758   RNSNPIDVEKASQPSYVWRSIMAAKPLLKSGLRKSIGSGYNTRVWDEPWIPST-PPRPPT  816

Query  1170  PPFPYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                P      +   L +  +  W+ E ++ +    D  LI S+ I +  + D   W+  +
Sbjct  817   GVAPIQKPNLLVYELIDRETKSWNVEALKAVIAPEDIPLISSLRISRSFKVDSFCWIHTK  876

Query  993   KGVFTVKSCYKAI---------SLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              G ++VK+ Y  I          L ++    +  + +W  +   + K F+WQ  S C+P 
Sbjct  877   SGAYSVKTGYDEICRSENEQNTELCIEPSVTSLINQVWATNTARKIKHFMWQALSNCVPV  936

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS-----  676
                L  R       C  C +V+E+  H+L EC  ATQ W L   L    +  S S     
Sbjct  937   CSRLTDRHCHSDRSCQRCGHVDETVNHMLFECPPATQTWALALHLSLQGEFPSPSIYSNF  996

Query  675   EWITKCFESLQPPRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
             +++    +    P   L  I  I W +W++RN KV++   L    +++++ +    W + 
Sbjct  997   DYLLNRIKKQDMPDDVLARIPWIIWFMWKSRNGKVFEGKDLTPLEILQSATSEADSW-SM  1055

Query  501   TEVDDQQRRSQH  466
               V  ++R  ++
Sbjct  1056  AHVTPERREEEY  1067



>ref|XP_010666711.1| PREDICTED: uncharacterized protein LOC104883845 [Beta vulgaris 
subsp. vulgaris]
Length=849

 Score =   233 bits (593),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 131/402 (33%), Positives = 215/402 (53%), Gaps = 12/402 (3%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +++ W  + LSRAG+EVL+K+VIQA+P+Y M ++  P  ++ +I   M  FWWG G  + 
Sbjct  336   KLRGWKEQLLSRAGKEVLIKAVIQAIPTYLMGVYKFPAAIIHEISSAMARFWWG-GKGEA  394

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             + + W +W+KLC PK  GGMGF+ +  FN ALL +Q WRL +   SL +++MKAKYYP  
Sbjct  395   RKMHWISWEKLCKPKCLGGMGFKDLAVFNDALLGRQVWRLIHFKNSLLSRVMKAKYYPRC  454

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
             +  +A+ G + S+ W S+   K +++    WR+G+G  + IW D W+ D     I +   
Sbjct  455   EMLNARLGFSNSYSWRSIWGAKSLVREGLMWRVGSGNDINIWSDPWVADERGRFIESE--  512

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                +   V  L+N     W  +++   F  RD   IL+IP+  G  +D ++W   + G +
Sbjct  513   EAGSLNRVAELINPDTMEWRSDLLNQYFTDRDRDCILAIPLSVGGGKDDLMWAYSQDGSY  572

Query  981   TVKSCYK-AISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCS  805
             TVK+ Y      +L+    A W  IW + + P+++ F+W++C+  LP    L+ R +   
Sbjct  573   TVKTTYMLGKGGNLEEFHEA-WVRIWKLEISPKSRHFMWRLCTNSLPVRAALKARHLLEV  631

Query  804   PLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWITKCFESLQPPRA  631
               CP C + EE+ FH L  C      W     E L   S+ +   E + + +  L+    
Sbjct  632   APCPWCPDKEETWFHALMGCERIRSLWSQCGCEALVQGSEDKDVKE-MVRDWSQLESKLV  690

Query  630   SLFVIICWNIWRARNEKVWKNICLP----AKAVVENSKALWR  517
                 ++ WNIW  RN+ V++N   P    A+ V  N++++ R
Sbjct  691   QRGCVLAWNIWFERNKFVFENTSTPLAIVAQLVFVNARSIIR  732



>ref|XP_009142123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=774

 Score =   231 bits (590),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 160/545 (29%), Positives = 264/545 (48%), Gaps = 21/545 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             + + W+ + LS AG+ V+L+SV+  +  Y+M  F LP  L   I+  +  FWW N +   
Sbjct  205   KARGWSTKLLSSAGKMVMLQSVLSPISLYSMTCFKLPVSLCKRIQTVLMRFWWDNNEN-A  263

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AWDK+  PK  GG+G R  + FN ALL+K  WRL N+P  L  K++K KY+ + 
Sbjct  264   KKMAWVAWDKITKPKSAGGLGMRDCQSFNDALLAKIGWRLLNNPNCLLGKLLKGKYFDDC  323

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A +    S  W S+L  + ++  N  W +G+G S+ IW D WL      R   P  
Sbjct  324   SILQATEASVMSHGWRSVLIGRDLLLKNLGWTVGDGSSINIWQDPWLCLTKQERPMGPSS  383

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  LL + G  WD + ++ +  + + +++   P   G  +DK+IW+  + G +
Sbjct  384   EQSVDLCVADLLVDGGKHWDRQKLQLLLPAYEEKILCIKPSLTGA-QDKLIWLGTKGGEY  442

Query  981   TVKSCYK-AISLDLDSV---PIASWS-TIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             +VKS Y  A+  + D+       +W   +W +   P+ K F W++  G +P  + L  R 
Sbjct  443   SVKSGYYVAVEEEPDTRRNDAGFNWKRNVWALDCAPKVKLFAWKLLKGAIPVGERLLERH  502

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCS---EWITKCFESL  646
             I+  P C  C +  ES  H+L +C FA + W+L   LP    +        W + C +  
Sbjct  503   IEVDPRCKRCGD-NESITHLLFQCQFAQKVWQLAPLLPGMDSSGMLDLMVVWPSICNQKS  561

Query  645   QPP----RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQR  478
              PP      S+   + W++W+ARN  V++      +  +  +  + R+W   ++ +    
Sbjct  562   LPPAGIVNGSVVPWVMWSLWKARNRLVFEGFSALPEDTLSTAIRMAREWSLKSKPEKPDS  621

Query  477   RSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSP  298
             RS+   I + I P+ G   +  DAA   +S   G GWV+ +            ++   SP
Sbjct  622   RSR---IPEMISPV-GSRIVRSDAAWSASSLTAGAGWVILSSPQNMTFKQHLEFVA--SP  675

Query  297   KEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKDLLSTFC  118
               AE LA+REA+  C+R  + +I  ESDS  ++  LSS         ++ DI  L   F 
Sbjct  676   LMAEGLALREAVLTCQRLKLQHIRFESDSAQLIKCLSSNETSAELHSVVFDILKLSECFD  735

Query  117   SLLYL  103
             S+ ++
Sbjct  736   SVSFV  740



>gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1505

 Score =   236 bits (601),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 242/517 (47%), Gaps = 54/517 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSRAG+E+L+K+V Q +P++AM  F L + L   I + +  +WW N +   
Sbjct  972   RIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDN  1031

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL +PK  GG+GFR I  FNLA+L+KQ WRL   P+SL +++++AKY+P  
Sbjct  1032  K-MHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1090

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F  K+  N S+ W S+ +   ++Q    WR+G+G  + IW D W+P   + +  TP  
Sbjct  1091  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRG  1150

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +    G+ WD++++   F   D   I SIP+     ED + W  D +G F
Sbjct  1151  ANLVTKVEELIDPYTGT-WDEDLLSQTFWEEDVAAIKSIPV-HVEMEDVLAWHFDARGCF  1208

Query  981   TVKSCYKAI-----SLDLDSVPIAS---------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TVKS YK           +  P  S         W  +W + +P + K F+W++C   L 
Sbjct  1209  TVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLA  1268

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEW  670
                 L HR +D    C +C    E A H+  +C    + W+    E L +  + Q+  + 
Sbjct  1269  LRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVWQALNLEELRSMLEQQTSGKN  1328

Query  669   ITKCFESLQPPRASLFVIIC-WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             + +     +P       I+C W  W+ RNE+         K+      A+WR        
Sbjct  1329  VLQSI-YCRPENERTSAIVCLWQWWKERNEE---------KSPRTGECAVWR--------  1370

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                             RP   + K+N D A   N ++ G G+V+R+  G    A      
Sbjct  1371  ----------------RPPLNFVKINTDGAYSSNMKQGGWGFVIRDQTGAVLQAGAGPAA  1414

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVV  202
              +     AE +A   A+     + +  I +E+DS+++
Sbjct  1415  YLQDAFHAEVVACAAAIKTASERGMSRIELETDSMML  1451



>gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1509

 Score =   236 bits (601),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 242/517 (47%), Gaps = 54/517 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI+ W  + LSRAG+E+L+K+V Q +P++AM  F L + L   I + +  +WW N +   
Sbjct  976   RIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDN  1035

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KL +PK  GG+GFR I  FNLA+L+KQ WRL   P+SL +++++AKY+P  
Sbjct  1036  K-MHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1094

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F  K+  N S+ W S+ +   ++Q    WR+G+G  + IW D W+P   + +  TP  
Sbjct  1095  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRG  1154

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
               L       +    G+ WD++++   F   D   I SIP+     ED + W  D +G F
Sbjct  1155  ANLVTKVEELIDPYTGT-WDEDLLSQTFWEEDVAAIKSIPV-HVEMEDVLAWHFDARGCF  1212

Query  981   TVKSCYKAI-----SLDLDSVPIAS---------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TVKS YK           +  P  S         W  +W + +P + K F+W++C   L 
Sbjct  1213  TVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLA  1272

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEW  670
                 L HR +D    C +C    E A H+  +C    + W+    E L +  + Q+  + 
Sbjct  1273  LRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVWQALNLEELRSMLEQQTSGKN  1332

Query  669   ITKCFESLQPPRASLFVIIC-WNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             + +     +P       I+C W  W+ RNE+         K+      A+WR        
Sbjct  1333  VLQSI-YCRPENERTSAIVCLWQWWKERNEE---------KSPRTGECAVWR--------  1374

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                             RP   + K+N D A   N ++ G G+V+R+  G    A      
Sbjct  1375  ----------------RPPLNFVKINTDGAYSSNMKQGGWGFVIRDQTGAVLQAGAGPAA  1418

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVV  202
              +     AE +A   A+     + +  I +E+DS+++
Sbjct  1419  YLQDAFHAEVVACAAAIKTASERGMSRIELETDSMML  1455



>emb|CDP09717.1| unnamed protein product [Coffea canephora]
Length=613

 Score =   228 bits (582),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 178/577 (31%), Positives = 267/577 (46%), Gaps = 61/577 (11%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+ SW ++ LS+ G+EVLLKSV  A+P Y M+ F LP  L  ++      +WWG  + + 
Sbjct  29    RMNSWKNKLLSQGGKEVLLKSVSMAMPVYTMSCFKLPNKLCKEVTSIFANYWWGESEGRN  88

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W +L   KK GG+GFR +++FN ALL+KQ WR+ + P  L +K+++AKY+   
Sbjct  89    K-MHWCSWGRLARDKKEGGLGFRELQNFNKALLAKQVWRVISKPNLLVSKVLRAKYFHKE  147

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
               F  K     S++W SL+  +  ++   R +IGNG +  IW DNW+P   + ++TT   
Sbjct  148   SIFKCKIPKCASWIWQSLMNVRDFVRKGTRRKIGNGKATNIWEDNWIPGNKDGKVTT-VM  206

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P   N      L + G  W   +V  IFN +DA+ IL IPI    RED   W+    G +
Sbjct  207   PQSCNIRRVEELIS-GFRWRIPLVSRIFNRKDAKEILDIPISIAGREDSNYWLHSGSGTY  265

Query  981   TVKSCYKAISLDL-------DSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             TV S YKA+  +        D+    S        W  +W + +  + K FIW+  +G L
Sbjct  266   TVNSGYKALCQETSQHKGRRDNEAGTSSANSNEKQWKWLWKLKVKSKIKHFIWRSLNGLL  325

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLP---ATSQAQSCS  676
             P  DL+  R     P+C  C   EES  H+  +CS A + W++  P+     T Q ++  
Sbjct  326   PVNDLVFKRIHQGDPICDGCGEQEESIEHLFFQCSRAQEVWKM-APIQWDGLTEQTRNIL  384

Query  675   EWITKCFESLQ----PPRASLFVIICWNIWRARNE--------KVWKNICLPAKAVVENS  532
              W     E+           L V I W IW+ RNE          W++I    +   E +
Sbjct  385   VWWNSMLEATNRIEGREHVELTVNILWQIWKRRNEWKFNAKRRHPWESIKKALQEWQEQA  444

Query  531   KALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
              A WR+ K+ T V+ ++ R   +        MQ   +L+       N    G+     NH
Sbjct  445   SA-WREEKS-TPVEAERDRETAETDEGGRDEMQ--IRLSTHVQEQTNRVGTGIIATNFNH  500

Query  351   HGIFHSAACNSWIG--VLSPKEAEALAIREA--LSWCKRQHIDYIHVESDSLVVVHGLSS  184
               +   A  + + G  + +  EA  +AI +A  L W K              + VH LS 
Sbjct  501   QLVSAWALTDRYAGSHLQTSAEAVKMAIIKARQLQWQK--------------ITVHLLSP  546

Query  183   PAFVTSFDLLLADIK--DLLSTFCSLLYLF--C*TFC  85
                    + L  DIK   L     SL  LF  C +FC
Sbjct  547   QLLKMITNGLAKDIKMATLTDDINSLRALFQKC-SFC  582



>ref|XP_010451741.1| PREDICTED: uncharacterized protein LOC104733916 [Camelina sativa]
Length=919

 Score =   232 bits (591),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 170/561 (30%), Positives = 269/561 (48%), Gaps = 54/561 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W+ + LS+ G+E+++KSV  ALP++ M+ + LPQ L S +   ++ FWW   D + 
Sbjct  29    RVNGWSAKHLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAISTFWWKFND-KA  87

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +GL W AWDKLC  K  GG+GFR ++ FN A+L+KQ WRL ++P SL A++++ +Y+ N 
Sbjct  88    RGLHWVAWDKLCKDKSEGGLGFRALEQFNDAMLAKQFWRLIHNPSSLMARVIRGRYFRNK  147

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 AKK  NPSF W S+  TKG+++   RW +G+G S+ +W D WLPD+  PR      
Sbjct  148   HPLMAKKPNNPSFAWRSIFSTKGLVEQGARWAVGSGCSISVWRDPWLPDI-RPRSANGRG  206

Query  1161  PYlanasvnsllnNHGS-GWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
              +L  + + + L N  +  W   ++ + F+  D  LI S+P+ +  + D+++W   + G 
Sbjct  207   RFLLPSLMVNHLINPVTKDWHLPILEEFFDPVDIPLIRSLPVSKTSQPDRLLWHYTKSGR  266

Query  984   FTVKSCYK---AISLDLDSVPIAS--WSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHR  820
             ++VKS Y+    +  +++  P  S   +  W + +PP+ + F WQ+ SG LP  + L +R
Sbjct  267   YSVKSGYRLAWELIAEVEYGPSCSSLRAQSWKLDVPPKIQHFFWQIASGTLPVLERLAYR  326

Query  819   RIDCSPLCPLC-LNVE-ESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF---  655
              + C  LC  C L  E E+  H L  CS +   W L   L         S +    F   
Sbjct  327   GVRCDVLCKRCGLATEMETINHALFVCSRSHSIWELVPMLLEPGGFPFASIYANLDFIFW  386

Query  654   ESLQPPRASLFVI----ICWNIWRARNEKVWKNICLPAKAVVENS---KALWRDWKACT-  499
              +    RAS  +     I W++W+ RN+KV+  I L    ++  +   K +W D K+ + 
Sbjct  387   RASSQGRASDIISSLPWILWSLWKDRNKKVFPGIELEPIEIINQAATDKLIWEDAKSYSV  446

Query  498   ---------EVDDQQRRSQHQYITKWIRPMQG---WFKLNVDAALDINSRKMGLGWVLRN  355
                      EV D     Q     K   P QG   W     D  L + +R +  G     
Sbjct  447   NNPLPPPIVEVRDFSIFCQVDGSWKGTDPFQGLSWWCCNGDDITLLLGARSLRRG-----  501

Query  354   HHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAF  175
                             L P   E  A+  A+       +     E+D   +V  + SP  
Sbjct  502   ----------------LCPLHTELQALIWAMESLLAAGVSCQAFETDCAELVAMVQSPDD  545

Query  174   VTSFDLLLADIKDLLSTFCSL  112
               +F  LL D   L S + S 
Sbjct  546   WPAFTNLLEDFSQLRSFYPSF  566



>ref|XP_009126322.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=593

 Score =   228 bits (580),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 234/500 (47%), Gaps = 20/500 (4%)
 Frame = -2

Query  1629  ALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRR  1450
             A+P+Y M+ FLLP+ +V +I + M  FWW + +    G+ W +W K+   +K GG+GFR 
Sbjct  2     AIPTYTMSCFLLPKTMVREITKAMRKFWW-SANKDKFGIHWISWKKIAASRKEGGLGFRD  60

Query  1449  IKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGI  1270
             +  FN ALL+KQAWRL   P SL A++ KAKY+  + F +AK     S+ W S+L+ K +
Sbjct  61    LLAFNKALLAKQAWRLITQPSSLLARVYKAKYFRRTTFMEAKSYQTSSYAWRSILQAKPL  120

Query  1269  IQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYlanasvnsllnNHGSGWDDEVV  1090
             I    RW IGNG +VR+W D WL +  +P  T P      N  V  L       WD   +
Sbjct  121   IHKGARWIIGNGENVRVWKDRWLTENQSPSPTGPGALLYPNLLVKDLFIPGTRSWDMHKI  180

Query  1089  RDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTVKSCYKAISLDLD----------  940
             + +F  + AQ IL +        D + W     GV+TVKS Y  I  ++D          
Sbjct  181   QSLFQDQVAQQILKVRPSWSGTRDVLYWPASRSGVYTVKSGY-YIQREIDREDLHEQVPS  239

Query  939   ----SVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEE  772
                  +  A  S +W + +PP+ + F W+V    LP AD L  R I    LC +C    E
Sbjct  240   SPHTQIQHALISKLWKLKIPPKLRLFWWKVLHNGLPVADNLNKRGIRNYSLCQVCGEELE  299

Query  771   SAFHILAECSFATQCWRL-FEPLPATSQAQSCSEWITKCFESLQPPRASLFVIICWNIWR  595
             +  H+L EC  A + W      +P    + + +    K        + +L   I W IW+
Sbjct  300   TVHHMLLECRVAREIWAFSLGEVPELQSSDTAALHFFKYLLDRAHSQNNLPFFIGWRIWK  359

Query  594   ARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ-RRSQH--QYITKWIRPMQGWF  424
              RN+ V++N        V  +   ++ WK  TE ++    RS H  QY    I   Q   
Sbjct  360   MRNKLVFENKRDHIIHTVHATITDYQVWKDATERNNATYERSLHTMQYPIADILQQQTHN  419

Query  423   KLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQ  244
                VDA+    + K G+GW L +  GI      ++     SP  AEA+A+  A+      
Sbjct  420   YCIVDASWKSPTEKAGIGWSLFSKEGISWLQGSSAIAPTNSPFIAEAMAMLLAVQQLHTL  479

Query  243   HIDYIHVESDSLVVVHGLSS  184
                 + +  D L ++  L +
Sbjct  480   AYKDVVILGDCLELIKSLQA  499



>ref|XP_009118884.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=570

 Score =   227 bits (578),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 147/493 (30%), Positives = 233/493 (47%), Gaps = 33/493 (7%)
 Frame = -2

Query  1611  MNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNL  1432
             M  F LP+ L+S +   +  +WWG  D+  K   W +WDK+C+PK  GGMGFR ++ FN 
Sbjct  1     MACFKLPKTLISKLTSIIADYWWGT-DSHKKKTHWVSWDKMCLPKHLGGMGFRDLECFNQ  59

Query  1431  ALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFFDAKKGGNPSFVWASLLETKGIIQGNCR  1252
             ALL+KQAW+  N P+SL ++ +K++Y+ +  F +A  G  PSF W SLL  + +++   R
Sbjct  60    ALLAKQAWKTLNQPQSLISRFLKSRYFKDGNFLEAAIGERPSFAWRSLLFGRDLLKKGLR  119

Query  1251  WRIGNGLSVRIWHDNWLPD----VNNPRITTPPFPYlanasvnsllnNHGSGWDDEVVRD  1084
              R+GNGL++R+W D WL D    +  P +    F      S           W+D  + +
Sbjct  120   LRVGNGLTIRVWTDKWLEDPVEGMRAPWVKNISFDVNLRVSSLIDPVTK--QWNDTKLAE  177

Query  1083  IFNSRDAQLILS-IPIPQGPREDKMIWVKDEKGVFTVKSCY--KAISLDLDSVPIASW--  919
             +F   D  LI+S  P+   P  D   W   + G  TVKS Y   + +   + +P A    
Sbjct  178   VFVKGDVDLIMSNQPVVDKP--DFYSWRYVKSGQLTVKSAYWLASTTKAEEKIPEAFMLP  235

Query  918   ------STIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHI  757
                     +W V   P+ + F+W+  S  LPT+DL+  R +     C  C +  ES  H+
Sbjct  236   SLNGLKEKVWKVKTVPKIRVFLWKALSCALPTSDLIYARGMRIDLRCQTCGDDRESINHV  295

Query  756   LAECSFATQCWRLFEPLPATSQ--------AQSCSEWITKCFESLQPPRASLFVIICWNI  601
             L  C FA Q W L  P+P+           A        + ++ L   +  ++  I WN+
Sbjct  296   LFSCCFARQVWAL-SPIPSKVNGFDHDSVFANMSYLLHGENWQLLTEEQRRVWPWIVWNL  354

Query  600   WRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQRRSQHQYIT----KWIRPMQ  433
             W+ RNE ++   CL    +V+ +     +W     V+++  + + Q       KW  P  
Sbjct  355   WKRRNEMLFGGSCLDPLDLVKKATTEANEWSLAQVVEEEGIKEERQRSISSNRKWKPPDS  414

Query  432   GWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWC  253
              W K N+   LD     +G  WVLRN  G+    +  ++ G+ +  EA  + +  AL   
Sbjct  415   NWVKCNIGMELDKGKSLVGGAWVLRNERGVVLCHSRRAFSGIKTRDEARLVVVLWALESM  474

Query  252   KRQHIDYIHVESD  214
             + Q    I  E +
Sbjct  475   RSQRQSRIVFEGE  487



>ref|XP_009114817.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=447

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/399 (34%), Positives = 208/399 (52%), Gaps = 30/399 (8%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             + SW+ R LS+ G+E  +KSV Q++P+Y+M+ + LP+G+V  ++  ++ FWW +     +
Sbjct  30    VTSWSARLLSKGGKEGQIKSVAQSVPTYSMSCYFLPKGIVEKLKSAISNFWWSSSQNN-R  88

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             GL W AWDK+CVP   GG+GF  + DFN+ALL+KQ WRL   P SL A+++K +YY  S 
Sbjct  89    GLHWIAWDKICVPHDQGGLGFLDLHDFNIALLAKQLWRLIQFPNSLLARVLKGRYYNRSC  148

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFP  1159
               + +K  +PS+ W S++  K +++   R  IG G +  +W + W+PD+       PP P
Sbjct  149   PLEDQKVYSPSYGWRSIMAAKPLLKSGLRKTIGAGQNTCVWSEPWIPDIE----ARPPRP  204

Query  1158  YlanasvnsllnNHG------SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
                    +  L  H         WD  ++ + F+  D  LIL +        D   W   
Sbjct  205   SDRITHRHPKLLVHSFIRRDTRDWDTNLLLEYFHPEDIPLILKLRPSNTGSMDGYAWNFT  264

Query  996   EKGVFTVKSCYKAIS---LDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             + G ++VKS Y ++    L  D   I         S +W++  P + K F+WQ  +GC+ 
Sbjct  265   KSGAYSVKSGYHSLQKAKLCDDEAHIVQPSITGLQSHVWSIPAPGKMKHFMWQALTGCIA  324

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLP-----ATSQAQ  685
             T + L +R +     CP C + EE+  H+L EC  A Q W L  +  LP     +TS  Q
Sbjct  325   TTERLAYRHLGTDRSCPRCGDPEETINHLLFECPPALQVWVLSDYPSLPGYFPTSTSIYQ  384

Query  684   SCS--EWITKCFESLQPPRASLFVIICWNIWRARNEKVW  574
             + S   W  K   S++ P    F  I W IW+ARN+K +
Sbjct  385   NVSFLFWKKKNVASME-PLIETFPWILWYIWKARNDKFF  422



>gb|EEE62189.1| hypothetical protein OsJ_16976 [Oryza sativa Japonica Group]
Length=653

 Score =   228 bits (582),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 162/544 (30%), Positives = 244/544 (45%), Gaps = 41/544 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                R+  W  +FLS  G+EVL+KSVIQALP+Y MN+F LP G   D  + +  FWWG   
Sbjct  42    LMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMNVFKLPSGFCEDYMKMIRKFWWGEEK  101

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + K   W +W +L  PK  GG+GF+ +K FN ALL++QAWRL    +SL AK+MKA+Y+
Sbjct  102   NRRK-THWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLMKARYF  160

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN    D     + S VW  +     +++    WRIG G  + IW DNW+P  +  R+T 
Sbjct  161   PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWIPRDHQLRVTG  220

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                       V  L++ +   WD+ ++R IF       IL I +P+ P +D + W  +  
Sbjct  221   KR-TRTCLKWVADLVSPNNQEWDEGLIRQIFYPPYVDEILKIKLPESPTDDFLAWHPERL  279

Query  990   GVFTVKSCYKAISLDLDSVPIAS------------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             GVFTV+S YK    +      A             W  IW+  +P +   F W++    L
Sbjct  280   GVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVPQKVCIFAWRLAVERL  339

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQ--AQS  682
             PT    + R I  S  C +C    E  FH    C+ A       R F P+P   +   Q 
Sbjct  340   PTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELRAFWPIPPEDKFVRQG  399

Query  681   CSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR-----  517
                 +          +A + +++ W  W  RN  V     L     +   ++  +     
Sbjct  400   PDWLLLLLDTLDMRNKAQMLLML-WRAWHLRNNSVHDTGTLTISGSIRFLQSYVQLLFPI  458

Query  516   ----DWKACTEVDDQQRRSQHQYITK------WIRPMQGWFKLNVDAALDINSRKMGLGW  367
                 D K         R +Q+  +TK      W  P +GW K+NVD A  +     G+G 
Sbjct  459   RQKEDPKGKCAAQVPGRLNQNPGVTKADCLQIWEPPPEGWAKINVDGAFSMTDNTGGIGV  518

Query  366   VLRNHHGIFHSAACNSWIGV---LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVH  196
             + R+  G    A  +SW  +      ++ E LA  E +          I +ESD + V+ 
Sbjct  519   IARDSEG---KALLSSWKYLHRCADAEQVEILACYEGMKLAAEWIRKPIILESDCVTVIG  575

Query  195   GLSS  184
              +++
Sbjct  576   RMTA  579



>gb|EEC81552.1| hypothetical protein OsI_24974 [Oryza sativa Indica Group]
Length=1015

 Score =   232 bits (592),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/387 (36%), Positives = 193/387 (50%), Gaps = 18/387 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W   +LS  G+E++LK+VIQA+P Y M++F LP+ +  D+ +    FWWG  D   
Sbjct  608   RIILWGENYLSSGGKEIMLKAVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWG-ADKGK  666

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W+AW  L  PK  GG+GFR  + FN ALL++QAWRL + P+SL A++MKAKYYPN 
Sbjct  667   RKTHWQAWSCLTKPKHNGGLGFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKYYPNG  726

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPR-ITTPP  1165
                D   GGN S  W ++     +++    WRIGNG SVRIW D W+P  ++ R ITT  
Sbjct  727   SLVDTAFGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWIPRDHSRRPITT--  784

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                       S L      WD + V  +F   DA  IL I       ED + W  D  G 
Sbjct  785   -KRNCRVKWVSDLLGQDGSWDVQNVSRVFLPIDADEILKIRTSVRLEEDFLAWHPDRLGQ  843

Query  984   FTVKSCYK-AISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             F+V+S YK AISLD      +S        W  IW  ++P + K F W+  + CL   + 
Sbjct  844   FSVRSAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKVKVFCWRAANNCLANQEN  903

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS----QAQSCSEWIT  664
              + R ++ S +C +C N  E   H L+ C  A   W   +   + S       +   W  
Sbjct  904   KKKRNLERSEICCICGNETEDVSHALSRCPHAVHLWEAMKAAGSLSLNVAGNATGGSWFF  963

Query  663   KCFESLQPPRASLFVIICWNIWRARNE  583
                E+       +  ++ W IW  RNE
Sbjct  964   DQIENTPAEERMMLCMMLWRIWFVRNE  990



>ref|XP_008367519.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=822

 Score =   231 bits (588),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 164/534 (31%), Positives = 251/534 (47%), Gaps = 37/534 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  +FLS AG+E+L+K V  A+P++AM+ F LP G+  DIE+ +  +WW  G   
Sbjct  274   SRMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWW-RGSEX  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+   +WD+L   K  GG+GF+  + FNLA L K  WRL   P+SL A +M+ KYYP 
Sbjct  333   RRGVHXTSWDRLIQKKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMRDKYYPE  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A  G   S+ W  +LE + +++    WR+G+G +++I  D W P  +  RI   P
Sbjct  393   KSFREATIGRGSSWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXSTFRIR--P  450

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V+ L+N     W  +++   F+S +A  ILSIPI      D+M W     G 
Sbjct  451   AVNLGALYVSBLINQESKTWKADLISACFSSEEANTILSIPISXFGSCDRMGWFHXXNGX  510

Query  984   FTVKSCYKAISLDL----------DSVPIAS------WSTIWNVHLPPRAKTFIWQVCSG  853
             ++VKS Y  I+L+L             P         W+ IW + +P + + FI +  + 
Sbjct  511   YSVKSGY-GIALELMXSGGLGKKGRGAPSXKTKYNKIWNAIWRLDVPRKMRFFIXKCXNH  569

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS----QAQ  685
              L     L+ R +    +C +C  V+E+  HI   C   +  +    PL   S     A 
Sbjct  570   ALAVRRNLKRRHMRVDNICGVCGXVDETENHIFFRCE-TSHLFXFCSPLQINSFDLEGAD  628

Query  684   SCSEWITKC--FESLQPPRASL--FVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR  517
                 W+  C     L      L  FV   W +W+ RN+ ++    LP   ++E  K    
Sbjct  629   FLQSWVNFCNRVADLANTNELLQEFVFGLWRLWKNRNDAIFSGSFLPPTEILEVWKXNVX  688

Query  516   DWKACTEVDDQQRR--------SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVL  361
             +++A  E  D   +           +    W +P  G  K+N DAA    S+K GLGWV 
Sbjct  689   EYRAANEXVDXGSKVPAXNGDLGVVRRQVXWXKPCFGMIKVNTDAAWCKESQKAGLGWVA  748

Query  360   RNHHGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
             R+  G+   A         S   AEA  I  AL +C  Q    + +ESD+  ++
Sbjct  749   RDFXGVLQXAGGTGAXRFHSXAAAEAAXIXGALDFCLLQGFVNVXIESDARDII  802



>ref|XP_010513536.1| PREDICTED: uncharacterized protein LOC104789557 [Camelina sativa]
Length=790

 Score =   230 bits (587),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 158/558 (28%), Positives = 261/558 (47%), Gaps = 29/558 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R   W  R LS+ G++V++KSV  A+P++ M+ F LP+ +   +   ++ FWW +   Q
Sbjct  204   ARASGWPARLLSKGGKKVMIKSVATAVPTFVMSCFRLPKTVTRKLTSAISNFWWSSSG-Q  262

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +GL W AWDKLC  K  GG+GFR + D+N ALL+KQ WRL   P+SL A++ K +YY +
Sbjct  263   SRGLHWVAWDKLCFGKDTGGLGFRNLDDYNTALLAKQLWRLITVPDSLFARVFKGRYYRH  322

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S   D  K  +PS+ W S++    ++      R+G+G S+ +W D W+P  +     +  
Sbjct  323   SDRLDPIKSYSPSYGWRSMISACSLVNKGLITRVGSGASISVWADPWIPAQSPRPALSTG  382

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +  +  V + ++   + WD   +   F   D  +I ++PI Q    D   W+  + G 
Sbjct  383   SSFDPSLRVINFIDRSSNSWDMAQLTATFVPEDVTIISALPIRQPDTLDLFGWLFTKSGK  442

Query  984   FTVKSCYKAISLDLDS-----------VPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTA  838
             ++VKS Y  +  ++ +           VP+ S+  +W +  PP+ + F+WQV SGC+   
Sbjct  443   YSVKSGYHFLCSNITTPSDSEVFGPSIVPLQSF--VWKIRCPPKLRHFMWQVLSGCVAVT  500

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEWIT  664
               LR R + C  +C LC + EE+  H L +C  A Q W L  F   P      S    + 
Sbjct  501   ANLRKRGMSCDAVCGLCGSPEETINHTLFQCPPARQVWALSQFPTTPGFFPMDSVLTNMD  560

Query  663   KCFESLQP-PRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDD  487
               F   +  P + +F  I W +W+ARN+K++ N+   + A++  ++   + W    E D 
Sbjct  561   SLFWRFKDVPDSDIFPWIMWYVWKARNDKLFGNLDSNSLAILRLAEDEAKSWVLAQEDDL  620

Query  486   QQRRSQHQYITKWIRPMQG---------WFKLNVDAALDINSRKMGLGWVLRNHHGIFHS  334
                 +    +    RP  G          +   VD +     R  G GW   +  G   +
Sbjct  621   VLVTTAPAEVR---RPGIGSVGVPRSLSSYTCFVDGSWKATDRFAGRGWFCTSPWGDAPT  677

Query  333   AACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLL  154
                 +    LSP  AE  A+  A+          +   +D   +V  +SSP+    F   
Sbjct  678   MGAANHRRSLSPLHAEIEALVWAMCCMIGADNQSVTFLTDCSDLVKMVSSPSEWPVFTPY  737

Query  153   LADIKDLLSTFCSLLYLF  100
             L DI+     F S   ++
Sbjct  738   LEDIQVDKEEFVSFSLVY  755



>emb|CDX80327.1| BnaC09g34150D [Brassica napus]
Length=559

 Score =   226 bits (576),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 161/494 (33%), Positives = 250/494 (51%), Gaps = 43/494 (9%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
             F  R+  W  + LS+ G+E+L+KS+  ALP YAM+ F LP+   + +   +  FWW N D
Sbjct  73    FQGRLNGWFAKSLSQGGKEILIKSICLALPIYAMSCFRLPKDTCARLRSALTEFWWSN-D  131

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                K + W AW KLC  K  GG+GF+ ++ FN ALL+KQA R+ N+P+SL A+++K +Y+
Sbjct  132   NNRKKIAWVAWQKLCKSKDQGGLGFKDLEKFNQALLAKQAARVLNNPDSLLAQVLKHRYF  191

Query  1350  PN--SQFFDAKK-----GGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDV  1192
              N   Q    KK     G  PSF W S++  + ++Q     +IG+G    +W D W+ D 
Sbjct  192   KNRPQQTHKTKKDRNGVGSRPSFAWRSIIHGRELLQQGLLKKIGSGSDTVVWWDRWILD-  250

Query  1191  NNPRITTPPF---PYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPR  1024
             + PR+  P +     +        L   G+G W+ E+V   F  +DA++I+ I  P+   
Sbjct  251   SIPRV--PDYRQGSVVDLTLRVEDLLIPGTGVWNQELVFRTFTRKDAEIIMKIK-PEISH  307

Query  1023  EDKMIWVKDEKGVFTVKSCYKAISL-------DLDSVPIAS---WSTIWNVHLPPRAKTF  874
              D ++W     G +T KS Y  + +        ++ +P      WST+W     P+ + F
Sbjct  308   TDSVVWGLSRNGSYTSKSGYALLEIIEEINTSQVEIIPPVEKKLWSTLWKTKTTPKLRHF  367

Query  873   IWQVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFE-PLPAT  697
             +W++ SG L   + LR R I  +  C  C N  E   H+L  C FA + W L   P+P  
Sbjct  368   LWRILSGALAVKERLRSRGIQLNITCSSCNNGVEDIGHVLFHCPFAQEVWALSSIPMPP-  426

Query  696   SQAQSCSEWIT-----KCF--ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVE  538
             S A S S ++       C   +S  P    +F  I W+IW+ARN   +++  L    V++
Sbjct  427   SGAWSHSIFLNLHHLINCGKRKSQAPETGQVFPWILWHIWKARNAFCFEHTRLYPAVVLD  486

Query  537   NSKALWRDWKACTEVDDQQRRSQ---HQYITKWIRPMQGWFKLNVDAALDINSRKMGLG-  370
              +      W+   +V   QR SQ    Q I  W +P  GW K N  ++  +NS  +  G 
Sbjct  487   KALVEAEVWREL-QVPTLQRTSQVVVAQAIQNWKKPPTGWVKCNYASSW-VNSTSVCSGA  544

Query  369   WVLRNHHG--IFHS  334
             W++R+ +G  IFHS
Sbjct  545   WIVRDGYGKAIFHS  558



>ref|XP_009115737.1| PREDICTED: uncharacterized protein LOC103840975 [Brassica rapa]
Length=863

 Score =   231 bits (588),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 167/557 (30%), Positives = 262/557 (47%), Gaps = 30/557 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+ SW+ + LS+ G+EVLLKSV QALP+Y M+ FLLPQ ++  +  +++ FWW +    
Sbjct  274   SRVNSWSAKLLSKGGKEVLLKSVAQALPTYVMSCFLLPQDIIRKLTSSISRFWWSSKQ-N  332

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +GL W AW K+C PK  GG+GFR +K+FNLALL+KQ WR+ +HP SL A+++K +Y+  
Sbjct  333   SRGLHWIAWHKICKPKDKGGLGFRDLKNFNLALLAKQLWRILHHPTSLLARVLKGRYFRA  392

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +    A K  +PS+VW SL+  K ++Q   R  I +G + ++   NWLP           
Sbjct  393   TDPILASKANSPSYVWRSLMAAKPLLQAGLRRTICSGANTKVCSANWLPTTPPRPPLCIR  452

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +  +  V  L   H   W+ + +R  F + D  LI SI      + D   W     G+
Sbjct  453   PSFNPDLKVAELFMPHSRTWNLDSLRSFFATEDISLICSIKPRPNSQNDDYCWSHTNNGI  512

Query  984   FTVKSCYKAISLDLDSVPIASWST----------IWNVHLPPRAKTFIWQVCSGCLPTAD  835
             ++VK+ Y  +++++  +   +  T          +W V  P + K F+WQ  S C+P  D
Sbjct  513   YSVKTGYD-LAMEMQDLSEETTYTEPSTTQLQEKVWKVKAPSKIKHFVWQALSNCVPVCD  571

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL----FEP--LPATSQAQSCSE  673
              L +R       C  C    E+  H+L EC  A Q W L    F P   P TS   +   
Sbjct  572   QLVNRHCGRDRSCARCGAEAETINHMLFECPPAVQTWALTDVPFTPGIFPCTSTFSNIDH  631

Query  672   WITKCFESLQPPRASLFVI-ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
              + +  E   P   +  V  I W +W+ARN+KV+    +     ++ + +    WK    
Sbjct  632   LLWRITEQSGPEPLTFRVPWILWYLWKARNDKVFNGKDVSPLDTLQLATSEADIWKLAQI  691

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
             V   Q             P     K  VDA+   ++   G G+ L++  G   S +  S 
Sbjct  692   VPTIQEEVATNRSPTEFEPTGPHCK--VDASWQKHALFFGGGFSLKDGEGRDFSGSFAS-  748

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS------PAFVTSFDLL  154
                +SP +AE   +  A++         +  ESD   +V  L++      PA +   D  
Sbjct  749   NQTISPIQAEFRTLLWAMNSTLLLGFQAMSFESDCHQLVKLLNNEEMEEWPALMAESDEF  808

Query  153   LADIKDLLSTFCSLLYL  103
             L         FCS+ ++
Sbjct  809   LQLFSKF--QFCSISFI  823



>ref|XP_006492749.1| PREDICTED: uncharacterized protein LOC102612946 [Citrus sinensis]
Length=589

 Score =   226 bits (577),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 151/514 (29%), Positives = 238/514 (46%), Gaps = 73/514 (14%)
 Frame = -2

Query  1707  FSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDT  1528
              S+I +W H+F S  G+E L+K+V QA+P+YAM++F +P GL +DI+R            
Sbjct  53    LSKISNWQHKFFSNGGKETLIKAVAQAIPAYAMSVFKIPIGLCNDIQRA-----------  101

Query  1527  QGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP  1348
                                                    WRL  +P+SL AK++KAKYY 
Sbjct  102   --------------------------------------GWRLIQNPDSLVAKVLKAKYYK  123

Query  1347  NSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPR-ITT  1171
              + F  AK G NPS++W S++  + ++Q   RWRIGNG  ++I   NW+P  +  + I  
Sbjct  124   QTDFLKAKIGSNPSYIWRSIVWGRHVLQKWIRWRIGNGEKIQIHSSNWIPKPSTFKPILV  183

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                P  +  S     N     W++ ++   F   DA++I +IP+P+ P+ED +IW  ++K
Sbjct  184   QSLPTESKVSELLDQNLQ---WNEIMINQNFAKEDAEIIRNIPLPRTPQEDMVIWHYNKK  240

Query  990   GVFTVKSCYK-AISLDLDSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             G+++VKS Y+ A+ +     P  S      W  IW ++LP + K F+W+     LP A+ 
Sbjct  241   GIYSVKSGYQLALKIKFSESPAGSTGAPQGWQHIWRLNLPEKIKIFVWKATKNLLPMAEN  300

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR---LFEPLPATSQAQSCSEWITK  661
             L  R++   P C LC    E  FH L EC  A + W+   L   + +  +    S  I  
Sbjct  301   LWRRKVLKEPTCHLCKAGCEDVFHALMECRVARKIWKCTHLENEVKSVIREDMLSVMIG-  359

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ  481
                +           I W  W ARN+ +++   L     V   K +   ++A       +
Sbjct  360   AMNNWAKSEVDYVATIWWVAWHARNKLLFQGKKLDPIGSVAKGKTVMEVYQA----QQVK  415

Query  480   RRSQHQYITK-----WIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
              R  H+   K     W  P     K+NVDAA+  + +  GLG V+RNH G   +AA  S 
Sbjct  416   ERESHRNTVKGKMQIWTPPPNNKVKVNVDAAVKEDRKSAGLGVVIRNHRGQVLAAAVKSM  475

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESD  214
                 +   AEA A++  +   K   +  + +E+D
Sbjct  476   NFQGNIAIAEAHAVKWGMEVAKDLSLSSVIIETD  509



>ref|XP_007220081.1| hypothetical protein PRUPE_ppa024663mg [Prunus persica]
 gb|EMJ21280.1| hypothetical protein PRUPE_ppa024663mg [Prunus persica]
Length=681

 Score =   228 bits (582),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 152/475 (32%), Positives = 220/475 (46%), Gaps = 58/475 (12%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                ++  W    LS AG+EVLLK+V  A+P++ M  F  P+G  + I   +  FWWGN +
Sbjct  153   ILKKMDGWKLNTLSLAGKEVLLKAVTTAVPAFPMACFRFPEGTCNQINSALASFWWGNNE  212

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              +  G+ WK+W KLC+ KK GG+GFR + +FNLALL+KQ+WR+  +PE+   KI+KA+Y+
Sbjct  213   -ENAGIHWKSWKKLCLAKKVGGLGFRDLSNFNLALLAKQSWRIILNPEAAWVKILKARYF  271

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVN-NPRIT  1174
             P + F  A KG  PS+ W SLLE    +    R++I  G ++  W+D W+P     P  T
Sbjct  272   PTTDFLHATKGSRPSWAWVSLLEGITAMMKEARFQIFIGANMNKWNDVWIPSCEPGPVQT  331

Query  1173  TPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
               P P+ A   V  L++     W  + +    N+   Q I  IPI    R D+++W  + 
Sbjct  332   LLPIPHQAPQLVQELMDKRNHTWKLDSISTFINNDFLQSIGCIPIGHSSRPDRLVWPWNS  391

Query  993   KGVFTVKSCYKAISLDLDS-----------VPIASWSTIWNVHLPPRAKTFIWQVCSGCL  847
              G +TVKS Y       ++           V    W TIW V   P+ K F+W+  S  +
Sbjct  392   SGSYTVKSGYHRFHARQNTNIASHNHTSHIVSERVWKTIWKVETLPKIKLFLWRALSRSI  451

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW-----RLFE---PLPATSQ  691
              T   L   +I   P+CP+C   EES  HIL  C      W     R  E    +P TS+
Sbjct  452   STRFALFKIKIATDPICPICEGFEESVEHILFLCPGTQLVWISTLDRWLEGIISIPGTSR  511

Query  690   AQSCSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDW  511
              +                  S    +CW IW+AR             +VV  + A     
Sbjct  512   TEG-------------KFLLSFLSFLCWEIWKAR-------------SVVSKNDAR----  541

Query  510   KACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
                + V   QR       T+W +P   + K N D +    + K   G V RN  G
Sbjct  542   GNLSPVHHVQR-------TRWSKPSPNYVKFNFDGSWLPGTMKGSFGIVSRNSSG  589



>ref|XP_009343973.1| PREDICTED: uncharacterized protein LOC103935882 [Pyrus x bretschneideri]
Length=1173

 Score =   233 bits (593),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 159/523 (30%), Positives = 246/523 (47%), Gaps = 43/523 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                +++ W    LS+AG+E+++K+VIQA+P+Y M+LF  P  +  + +  +  FWWG   
Sbjct  633   ILEKVQGWKQCTLSQAGKEIMIKAVIQAIPAYPMHLFKFPSTMCLEFDALIADFWWGKK-  691

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
                   R K     C+   WG                K+ WRL + P SL A+++KA+Y+
Sbjct  692   ------RGKRVSTGCLVGIWGTRN------------RKECWRLIHEPNSLWARLLKARYF  733

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             P   F DAK+GG  S+ W+SLL  + I+ G   W+I NG SVR+WHD W+P +   + + 
Sbjct  734   PQCSFLDAKQGGRASWGWSSLLVGREILLGGAHWQIMNGRSVRLWHDRWVPTIPGGKPSV  793

Query  1170  PPFPYlanasvnsllnNHGSG-WDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDE  994
                  ++     S +   GSG WD E ++ + +S D + IL   I    RED++IW    
Sbjct  794   IGDVRVSRNMKVSTVIKDGSGSWDIEAIKPLISSVDYEAILDTCIGDRLREDRIIWPATR  853

Query  993   KGVFTVKSCY-----------KAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCL  847
              GV++V+S Y            + SL    +P   W  +W++   P+ + F+W+  +  L
Sbjct  854   NGVYSVRSGYHWKNACSRPMNDSASLSSSIIPNQVWRCVWHLMTTPKVRNFMWRALNCAL  913

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCW--RLFEPLPATSQAQSCSE  673
              T + L  RR   S LCP+CL+  ES  H+   C +    W   L       +   +   
Sbjct  914   ATMENLFKRRCSPSSLCPICLDKVESLEHMFLLCPWVEPIWFGGLLNYRVIRANISNLPA  973

Query  672   WITKCFESLQPPRA------SLFVIICWNIWRARNEKVWKNICLPAKAV---VENSKALW  520
             WIT   ES   P+       S+  + CW IW++R   V++   +    V   + NS   +
Sbjct  974   WITSFTESNLGPKEEIDRILSIVALTCWQIWKSRCNFVYEQKRISPNQVIMAIGNSVNGF  1033

Query  519   RDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIF  340
             R      E   ++         +W  P   + K+NVDA+ + NS++   G V+RNH G F
Sbjct  1034  RVANGVHEGCPERGLVSSSQSVRWTPPCHPFMKVNVDASWEANSKRGFAGVVIRNHEGSF  1093

Query  339   HSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDS  211
               AA     G      AEA AI       K   ++ I VESDS
Sbjct  1094  -VAARREQFGAPCVAVAEASAILLGCGLAKVLGLEDIIVESDS  1135



>ref|XP_009146764.1| PREDICTED: uncharacterized protein LOC103870391 [Brassica rapa]
Length=985

 Score =   231 bits (588),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 165/560 (29%), Positives = 265/560 (47%), Gaps = 37/560 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  +W+ RFLSRAG+  +LK+V+ A+P+YAM+ F+LPQ L + I+ ++  FWW     + 
Sbjct  406   RAANWSTRFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWWDKSPDK-  464

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W AW KL  PKK GG+G R I+ FN ALL+K AWR+   P  L A+++  KY    
Sbjct  465   KNMCWVAWGKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVLTGKYCHKK  524

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F D +     S  W S+L  + ++Q +    IGNG + R+W D W+  +  P     P 
Sbjct  525   SFLDVQTPAVCSHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWI-SLQAPLKPYGPV  583

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L      W+ + +         Q+    P  +G  ED  +W+  E GV+
Sbjct  584   QEAGLDLRVSDLLTDDLQWNKDKIDKFLPDFTKQIQCLKPSKEGA-EDIYVWLPLESGVY  642

Query  981   TVKSCYKAISLDLDSVPIASWST-------------IWNVHLPPRAKTFIWQVCSGCLPT  841
             + KS Y + +       +   ++             +W++   P+ K F+W +  G LP 
Sbjct  643   STKSGYNSKTQLNAHTHLQQRTSNPPPNLEFDWLKDVWSIKTAPKLKLFLWSIIQGALPL  702

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPAT---SQAQSCSEW  670
                L+ R +  +  CP C   EESA HI  +C FA + WR   PL ++   + A++   +
Sbjct  703   GSELQRRGMINAAACPRC-KKEESATHIFFQCPFAKEVWRHI-PLNSSVHLADAETFESY  760

Query  669   ITKCFESL-QPP---RASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKAC  502
             + +   +L  PP   R+ +   ICW++W ARN+ ++ +       +     A   +W   
Sbjct  761   MGQFRSALCLPPTGIRSPVLPWICWSLWTARNKLIFDDKTAQPLEIATKGLAAALEWD-L  819

Query  501   TEVDDQQRRSQ---HQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSA  331
              +  DQ +R+Q        + I  +Q +    VDAA D +S + G+ W   N  G     
Sbjct  820   AQSTDQLKRNQVFPQAPSRRQIPGIQSYPSCFVDAAWDASSNRAGIAWHFTNDLGTNSPP  879

Query  330   ACNSWIGVLSPKEAEALAIR----EALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
                    V SP  AE+LA+R    EALS  K+     +   SD   ++  +S+ + +   
Sbjct  880   GSQIIDNVASPLMAESLALRQGIKEALSLGKKS----VSFHSDCATLIRAISTQSQIKEI  935

Query  162   DLLLADIKDLLSTFCSLLYL  103
               +L DIK L + F  + +L
Sbjct  936   YGVLQDIKHLSANFDRIQFL  955



>gb|EAZ03196.1| hypothetical protein OsI_25347 [Oryza sativa Indica Group]
Length=858

 Score =   230 bits (586),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 172/548 (31%), Positives = 248/548 (45%), Gaps = 57/548 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             RI  W   FLS  G+E+L+K+V+QA+P Y M LF LP  +  D+ +    FWWG  +   
Sbjct  296   RIIQWGENFLSSGGKEILIKAVLQAIPVYVMGLFKLPDSMCEDLMKATRNFWWG-ANKGK  354

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +   W++WD L   K+ GGMGFR +K FN ALL++QAW L + P+SL A+++KAKYYPN 
Sbjct  355   QTTHWRSWDCLMKSKQSGGMGFRDMKLFNQALLARQAWHLLDSPDSLCARVLKAKYYPNG  414

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D    GN S  W  +     +++    WR+GNG S+RIW D W+P  N  R      
Sbjct  415   SIIDTCFTGNSSPGWKGIEHGLELLKKGIIWRVGNGHSIRIWRDPWIPR-NFSRKAISGK  473

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                    V+ LL++ G  WD+  VR  F   DA++IL I   +G  ED + W  D+ G F
Sbjct  474   GSCRLRWVSDLLDSDGL-WDEHRVRHFFLPIDAEVILGIRTSRGRDEDFVAWHPDKFGSF  532

Query  981   TVKSCYKAISLDLDSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRRIDCSP  802
             +V                               K F W+  +  L      + R ++ S 
Sbjct  533   SV-------------------------------KIFAWKAITNSLAIMLNKKKRNLEQSS  561

Query  801   LCPLCLNVEESAFHILAECSFATQCW---RLFEPLPATSQAQ-SCSEWITKCFESLQPPR  634
              C +C   EE   H L  C  A   W   R    +      + + S+WI    E L  P 
Sbjct  562   TCTICGIEEEDVAHALCRCPQAKFLWLALRNSNDIGFVPDGRWTGSDWILNQLEILVEPD  621

Query  633   ASLFVIICWNIWRARNEKVWKNICLPAKA--------------VVENSKA-LWRDWKACT  499
               +F+++ W  W  RNE V      P +A              + +  KA L +      
Sbjct  622   RVMFLLLLWRAWHIRNEVVHGKHAPPIEASHRFIVSYHTSLLEIKQFPKADLTKGKHVIG  681

Query  498   EVDDQQRRSQHQYIT---KWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAA  328
             ++     R Q Q  T    W +P  GW KLNVD +   +    G+G +LRN  G    A+
Sbjct  682   QMVGHSGRHQRQPETLPYTWKKPDTGWMKLNVDGSFQEHDGSGGIGAILRNSAGEVVFAS  741

Query  327   CNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS-FDLLL  151
             C S        EAE LA R+ L+   +  +  I +ESD L  +  + S     S    L+
Sbjct  742   CGSMNRCGGALEAELLACRDGLTLVLQWTLLPIVIESDCLQAIQLIQSKEEERSDLAFLI  801

Query  150   ADIKDLLS  127
              +IK L++
Sbjct  802   REIKHLMA  809



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score =   233 bits (593),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 139/419 (33%), Positives = 217/419 (52%), Gaps = 26/419 (6%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W+ + LS+ G+EV++KSV  ALP++ M+ + L Q L S +   ++ FWW + D + 
Sbjct  676   RVNGWSAKLLSKGGKEVMIKSVALALPTHVMSCYKLTQDLTSKLTSAISSFWWKSND-KA  734

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AWDK+C  K  GG+GFR ++ FN A+L+KQ WRL ++P+SL A++MK +Y+ N 
Sbjct  735   RGMHWLAWDKMCKEKCDGGLGFRALEQFNDAMLAKQYWRLIHYPDSLMARVMKGRYFRNQ  794

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 AKK  NPSF W S+  TK +++   RW +G+G+S+ +W D WLPDV  PR    P 
Sbjct  795   HPIMAKKSYNPSFAWRSIYSTKDLVEEGARWTVGSGVSISVWRDPWLPDV-RPR----PA  849

Query  1161  PYlanasvnsllnNH-----GSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
                      +L+ NH        W   ++ +  +  D QLI ++ + +  R D+++W   
Sbjct  850   NGRGRLLHPNLMVNHLINPITKDWHLPILEEFMDPVDIQLIRNMAVSKTNRPDRLVWHFT  909

Query  996   EKGVFTVKSCYKAISLDLDSVPIASWSTI-----WNVHLPPRAKTFIWQVCSGCLPTADL  832
             + G ++VK+ Y+     +  V      T      W + +PP+   F WQ+ SG LP  + 
Sbjct  910   KSGKYSVKTGYRVARELVAEVEYGPTCTALRAQSWELDVPPKIPHFFWQIASGTLPVLER  969

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCF-  655
             L HR I C   C  C    E+  H L EC  + Q W L        +    S +    F 
Sbjct  970   LAHRGIRCDTRCKRCDLTAETINHALFECPRSRQIWELTPVSLDPQRFPYASIYANLDFI  1029

Query  654   ------ESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVV---ENSKALWRDWKA  505
                   +S     A     I W++W+ RN+KV++ I      ++    N KALW + KA
Sbjct  1030  FWRASSQSGVTDIALQLPWIIWSLWKDRNKKVFQGIEAEPNDILGQAANDKALWEEAKA  1088



>ref|XP_009141426.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=679

 Score =   228 bits (580),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 164/549 (30%), Positives = 260/549 (47%), Gaps = 37/549 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             + +S++ +FLS AG+ V+L+SV+ A+PSY+M+ F LP  L + I+  +  FWW N +   
Sbjct  102   KARSYSTKFLSSAGKLVMLQSVLSAVPSYSMSYFALPVSLCNRIQSAVTRFWWDNNE-HT  160

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYP-N  1345
             K + W +W  +  PK  GG+G R  + FN ALL+K +WRL  +P+SL ++++  KY P N
Sbjct  161   KKMAWVSWTSMAKPKALGGLGVRDFQTFNTALLAKTSWRLLQNPDSLLSRVLLGKYCPDN  220

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
                  A      S  W S+L  + ++  N  W +GNG S+++WHD WL   N  R   PP
Sbjct  221   INILLASPTSTMSHGWRSVLLGRDLLIKNLGWLVGNGQSIQVWHDAWLNTSNQERPMGPP  280

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                     V+ L+      WD   ++ +    + + IL I   Q    DK+IW+  + G 
Sbjct  281   NQDHLEILVSDLMLPESCEWDVLKIQRLVPDYE-ETILRIKPSQTGAPDKLIWLGTKTGS  339

Query  984   FTVKSCYKAISLDLDSVPIA------SW-STIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             ++ KS Y ++    +    A      +W   +W +   P+ +TF W++  G LP  + L 
Sbjct  340   YSTKSGYYSVVNREEGGENALINANFNWKKNVWELGCTPKIRTFAWKLLKGALPVGERLA  399

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQS------CSEWIT  664
              R I   P C  C    ES  H+  +C FA Q WRL    P T++ ++       ++W +
Sbjct  400   ERHIPIDPSCKRC-GAPESIIHLFFQCRFARQVWRL---APFTTEVETSGIIDLAAQWPS  455

Query  663   KCFESLQPPRA----SLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTE  496
              C     PP      SL   I W +W+ARN+ V++     ++  +  +  L R+W++  E
Sbjct  456   LCSTLCLPPAGITSKSLVPWIPWCLWKARNKFVFEGSSGSSEDTLSLALTLAREWESKRE  515

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
               D+  R     +    RP  G   +  DAA        GLGWV      IF   A   +
Sbjct  516   --DETTRKPLAPLPAPQRP-SGTVTIRSDAAWTPEGTTAGLGWV------IFSPEAQRPF  566

Query  315   IG----VLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLA  148
                   V SP  AE LA+ EA+     +    +  ESDS  ++  ++S   +     ++ 
Sbjct  567   SKRVNFVSSPLVAEGLALLEAVRSGVCEERSLVAFESDSAQLIRAINSGEGIPELYGVIE  626

Query  147   DIKDLLSTF  121
             DI    S F
Sbjct  627   DILSFASVF  635



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score =   231 bits (588),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/334 (36%), Positives = 190/334 (57%), Gaps = 15/334 (4%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             I  W  + LSRAG+E+L+K+V+QA+P+Y+M+ F +P+GL  ++   M  FWW     + +
Sbjct  729   ISGWKEKLLSRAGKEILIKAVLQAIPTYSMSCFQIPKGLCKELNGIMARFWWAKAKDK-R  787

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             G+ W  W+ LC  K  GG+GFR ++ FN ALL+KQ WR+   PESL A+I +A+Y+P+  
Sbjct  788   GIHWVKWELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRARYHPSVP  847

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP-F  1162
             F +A+ G NPSF+W SL   K ++    RWR+G+G+S++++ D WLP  +  +I +PP  
Sbjct  848   FLEAEVGTNPSFIWGSLQWGKELLNKGVRWRVGSGVSIQVYTDKWLPAPSCFKIMSPPQL  907

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
             P           +     W+  +++DIF  ++   IL IP+      D +IW  +  G++
Sbjct  908   PLSTRVCDLFTSSGQ---WNVPLLKDIFWDQEVDAILQIPLASLAGHDCLIWHYERNGMY  964

Query  981   TVKSCYKAISLDLDSV---PIAS-------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +VKS Y+   L+ D +   P A        W  IW + +P + K F+W+     LP   +
Sbjct  965   SVKSGYRLARLEKDKMSGEPSARVDLNSKFWKKIWALKIPNKIKFFLWRCAWDFLPCGQI  1024

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQ  730
             L +R+I  +P+CP C    ES  H +  C  A +
Sbjct  1025  LFNRKIAPTPICPKCHRKAESVLHAVWLCEAAKE  1058



>ref|XP_010468497.1| PREDICTED: uncharacterized protein LOC104748579 [Camelina sativa]
Length=1041

 Score =   230 bits (587),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 149/537 (28%), Positives = 244/537 (45%), Gaps = 55/537 (10%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             + +  W  RFLS+ G+EVLLKSV  A+P + M+ F L + + +++   M  FWW N +  
Sbjct  457   ANLTGWYSRFLSQGGKEVLLKSVAMAMPVFVMSCFKLSKTICANLSSAMADFWWSNAE-H  515

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W +W+KLC+PK+ GGMGFR I  FN ALL+KQAWR+   P+SL A++MK++Y+P 
Sbjct  516   TKGIHWLSWEKLCLPKEQGGMGFRDISTFNQALLAKQAWRILQFPDSLFAQVMKSRYFPE  575

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVN--------  1189
             + F  A  G  PS+ W S+L  + ++      ++GNG S+++W D W+ D          
Sbjct  576   NDFLSANLGPRPSYAWRSILHGRELLIQEMEKKVGNGKSIKVWIDEWIEDDGWRAPWRRN  635

Query  1188  ---NPRITTPPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPRED  1018
                NP +                L+     WD E +   F   D   I  I  P    ED
Sbjct  636   NFFNPDLRVSEL-----------LDLRSRDWDQEALEHHFLPGDIIRINKIK-PVTSIED  683

Query  1017  KMIWVKDEKGVFTVKSCY--------KAISLDLDSVPI--ASWSTIWNVHLPPRAKTFIW  868
                W  ++ G F+VKS Y        + I L+ +  P   A  + +W VH  P+ K F+W
Sbjct  684   FYSWKFNKSGEFSVKSAYWLASHSTNQHIRLEANQQPSTNALKAQVWKVHTDPKIKVFLW  743

Query  867   QVCSGCLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQA  688
             ++ SG LP    L+ + +     C +C   EE+  H+L  CS + Q W L   +P+ S  
Sbjct  744   KLLSGALPVTAALKSKGMKVEDTCQICGAEEETINHVLFSCSLSRQIWAL-SGIPSPSSG  802

Query  687   QSCSEWITKCFESLQPPRASL--------FVIICWNIWRARNEKVWKNICLPAKAVVENS  532
                    +     L   R SL        F  + W IW+ +N   ++         V+  
Sbjct  803   LHKGSIFSNMHYLLSNQRNSLWPEELRKFFPWLIWRIWKNKNSVSFEGTSFSPLDTVQKC  862

Query  531   KALWRDWKACTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNH  352
             +  W +W    + D++               + G     +     ++   +G  W LR+H
Sbjct  863   REDWMEWSEAQKRDNENGEESE---------VDGEGNQGIQR---VHESLVGCSWALRDH  910

Query  351   HGIFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSP  181
             +G+    +  +++GV    +A    +  A+   +   +  +        +V  L++P
Sbjct  911   NGVVLLHSRTAFVGVKDKLDAHFQRLIWAIECMRNHRVKKVIFAMQENCLVKALTNP  967



>ref|XP_010495441.1| PREDICTED: uncharacterized protein LOC104772536 [Camelina sativa]
Length=911

 Score =   230 bits (586),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 166/565 (29%), Positives = 262/565 (46%), Gaps = 42/565 (7%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR   W+ R LS+ G+EV++KSV  A+ ++ M+ + LP+ + + +   +  FWW   + Q
Sbjct  324   SRTTGWSARLLSKGGKEVMVKSVATAVLTFVMSCYRLPKTITTKLTSAVANFWWST-NGQ  382

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
               G+ W AW++LC  K+ GG+GF+ + DFN ALL+KQ WRL  +P+SL A++ K++YY N
Sbjct  383   SGGMHWIAWERLCCSKQLGGLGFKSVDDFNTALLAKQLWRLIEYPDSLFARVFKSRYYRN  442

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLP-DVNNPRITTP  1168
             S   D  +  +PS+ W S++  + ++      R+G+G S+ IW D W+P     P ++  
Sbjct  443   SDPMDPIRSYSPSYGWRSIVSARSLVNKGLITRVGSGTSISIWSDPWVPAQFARPALSNG  502

Query  1167  PFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKG  988
             PF        + +  +  S W  +++   F+S D  LI +IP+ +  R+D   W   + G
Sbjct  503   PFKDPNLPISHLIDRSANS-WRKDLLMHHFDSEDVALIEAIPLGRQLRDDYFGWHFTKSG  561

Query  987   VFTVKSCYKAISLDL-----------DSVPIASWSTIWNVHLPPRAKTFIWQVCSGCLPT  841
              +TVKS Y+    D+           D  P+   + +W V  PP+ + F+WQV SGC+  
Sbjct  562   KYTVKSGYEMARSDVQGPFRALASGPDFTPL--LARVWKVRCPPKLQHFMWQVLSGCISV  619

Query  840   ADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITK  661
             +  LR R + C  +C  C    E   H +  C  A Q W L   +P   Q          
Sbjct  620   STNLRRRGVSCDVVCTRCGMEAEDINHAIFLCPPARQVWALAN-VPVGPQLFPTGSVYAN  678

Query  660   CFESLQP----PRASLFVIICWNIWRARNEKVWKNICLPAKAVV---ENSKALWRDWKAC  502
                 L P       S F  + W IW+ARN  V+ +I      VV   E     W++ +  
Sbjct  679   LDHFLDPKGPGSHISAFPWLMWYIWKARNASVFDSIDERPDVVVRVAEGEAVTWQEAQVD  738

Query  501   TEVDDQ-----QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFH  337
              E D+         S  +      R   G ++  VD +   +    G GW   +      
Sbjct  739   IEEDEHPIIPLHPSSGPRLCASLPRTFTG-YRCYVDGSWKDSDAFSGAGWCCFSSQDTSP  797

Query  336   SAACNSWIGVLSPKEAEALAIREALSWCKRQHIDY----IHVESDSLVVVHGLSSPAFVT  169
                  ++   LSP   E     EA  W  R  I +    +   +D   +V  +SSP    
Sbjct  798   VFGATNFRRSLSPLHTEV----EAFLWAIRCMIGHDFRDVVFLTDCSDLVKMVSSPTDWP  853

Query  168   SFDLLLADI---KDLLSTFCSLLYL  103
             +F   L DI   K+  S+F SLLY+
Sbjct  854   AFAAYLDDIQTDKEEFSSF-SLLYV  877



>gb|EAY96391.1| hypothetical protein OsI_18290 [Oryza sativa Indica Group]
Length=653

 Score =   226 bits (577),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 161/544 (30%), Positives = 243/544 (45%), Gaps = 41/544 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                R+  W  +FLS  G+EVL+KSVIQALP+Y M++F LP G   D  + +  FWWG   
Sbjct  42    LMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMSVFKLPSGFCEDYMKMIRKFWWGEEK  101

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + K   W +W +L  PK  GG+GF+ +K FN ALL++QAWRL    +SL AK+MKA+Y+
Sbjct  102   NRRK-THWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLMKARYF  160

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN    D     + S VW  +     +++    WRIG G  + IW DNW+P  +  R+T 
Sbjct  161   PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWIPRDHQLRVTG  220

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                       V  L+  +   WD+ ++R IF       IL I +P+ P +D + W  +  
Sbjct  221   KR-TRTRLKWVADLVKPNNQEWDEGLIRQIFCPPYVDEILKIKLPESPTDDFLAWHPERL  279

Query  990   GVFTVKSCYKAISLDLDSVPIAS------------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             GVFTV+S YK    +      A             W  IW+  +P +   F W++    L
Sbjct  280   GVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVPQKVCIFAWRLAVERL  339

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQ--AQS  682
             PT    + R I  S  C +C    E  FH    C+ A       R F P+P   +   Q 
Sbjct  340   PTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELRAFWPIPPEDKFVRQG  399

Query  681   CSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR-----  517
                 +          +A + +++ W  W  RN  V     L     +   ++  +     
Sbjct  400   PDWLLLLLDTLDMRNKAQMLLML-WRAWHLRNNSVHDTGTLTISGSIRFLQSYVQLLFPI  458

Query  516   ----DWKACTEVDDQQRRSQHQYITK------WIRPMQGWFKLNVDAALDINSRKMGLGW  367
                 D K         R +Q+  +TK      W  P +GW K+NVD A  +     G+G 
Sbjct  459   RQKEDPKGKCAAQVPGRVNQNPGVTKADCLQIWEPPPEGWAKINVDGAFSMTDNTGGIGV  518

Query  366   VLRNHHGIFHSAACNSWIGV---LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVH  196
             + R+  G    A  +SW  +      ++ E LA  E +          I +ESD + V+ 
Sbjct  519   IARDSEG---KALLSSWEYLHRCADAEQVEILACYEGMKLAAEWIRKPIILESDCITVIG  575

Query  195   GLSS  184
              +++
Sbjct  576   RMTA  579



>ref|XP_009115971.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=614

 Score =   226 bits (575),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 148/500 (30%), Positives = 239/500 (48%), Gaps = 29/500 (6%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             +R+  W  +F ++ G+EV++KSV+ ALP++ M+++ LP+     +   +  FWW  G  +
Sbjct  108   NRVNGWTFKFFTKGGKEVIIKSVVTALPNHVMSVYRLPKATTKKLTTAVAQFWWSPGG-R  166

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ WK+WDK+C+ K+ GG+GF+ I DFN A+L KQ WRL  +P +L +++ K +YY N
Sbjct  167   TRGMHWKSWDKVCLDKEAGGLGFKDITDFNTAMLGKQLWRLIENPNTLFSRVFKGRYYRN  226

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             +   +  +  +PS+ W S++  + ++      R+G+G S+ +W+D WLP           
Sbjct  227   ASPLEPIRSYSPSYGWRSIVSARSLVSKGLIKRVGSGSSISVWNDPWLPTTRPRPANKNQ  286

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +  N +V+SL+++    W+   +R + + +D ++I SIP+ +    D+  W     G 
Sbjct  287   HIFDPNLTVDSLIDSTSRTWNSHALRAMIDPQDVKIIESIPLSKTQMVDRDGWHFTNNGK  346

Query  984   FTVKSCYKA--ISLDLDSVPIASWSTI-------WNVHLPPRAKTFIWQVCSGCLPTADL  832
             +TVKS Y+   +  D +  P+    T+       W +  PP+ K F+WQ+ +GC+     
Sbjct  347   YTVKSGYQIERVYPDRERPPLKFGPTVDALKAFCWKIRCPPKLKHFLWQLVTGCIAVKKN  406

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITK---  661
             L+ R I     C  C   EES  H+  EC  A Q W L   +P+       S   T    
Sbjct  407   LKARGIQGDTCCARCGAEEESINHVFFECPPALQVWAL-SKIPSNPTMFPTSSLFTNMDH  465

Query  660   CFESLQPPRAS-LFVIICWNIWRARNEKVWKNICLPAK---AVVENSKALWRDWKACTEV  493
              F  + PP     F  I W IW+ RN KV+ N+ +  +    + E    LW +    TE 
Sbjct  466   LFWRVSPPMEDHQFAWILWYIWKGRNNKVFSNMDMDPRDTLKLAETESTLWANAHVLTET  525

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                 R   H  +T        W     D +   N    G GW L    G        +  
Sbjct  526   ----RIGSHVEVTTLPSIPGRW--CFTDGSWKENEVFSGQGW-LSTLEGFDGLLGARNVR  578

Query  312   GVLSPKEAEALAIREALSWC  253
               LSP  AE     EAL W 
Sbjct  579   ACLSPLHAEI----EALLWA  594



>gb|EEC68887.1| hypothetical protein OsI_37529 [Oryza sativa Indica Group]
Length=1765

 Score =   233 bits (593),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 164/517 (32%), Positives = 240/517 (46%), Gaps = 71/517 (14%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W    LS  G+EVL+K+VIQA+P Y M +F LP+ ++ D+ +    FWW + + Q 
Sbjct  1232  RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQR  1291

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K   WKAWD L  PK  GG+GFR  + FN ALL++QAWRL  +P+SL A+++KAKY+P+ 
Sbjct  1292  K-THWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKYFPHG  1350

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                D   G N S  W S+     +++    WR+GNG S+RIW D+WLP  ++ R  T   
Sbjct  1351  SLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPRDHSRRPITG--  1408

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                      S L      WD   +   F++ DA++IL+I I     ED + W  D+ G+F
Sbjct  1409  KANCRLKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDFIAWHPDKNGMF  1468

Query  981   TVKSCYKAISLDLDSVPIAS----------WSTIWNVHLPPRAKTFIWQVCSGCLPTADL  832
             +V+S Y+ ++  L ++  +S          W  IW   +P + K F W+V S CL T  +
Sbjct  1469  SVRSAYR-LAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMAM  1527

Query  831   LRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFE  652
                       L  L  N     +++  E            P   TSQ +    ++   F+
Sbjct  1528  F---------LMTLWRN-----WYVRNELIHGKSA-----PPTETSQ-RFIQSYVDLLFQ  1567

Query  651   SLQPPRASLFVIICWNIWRARNEKVWKNICL---PAKAVVENSKALWRDWKACTEVDDQQ  481
               Q P+A L           + + V + + L   P   V+ N +  W             
Sbjct  1568  IRQAPQADL----------VKGKHVVRTVPLKGGPKYRVLNNHQPCWE------------  1605

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
                         RP  GW KLNVD + D +S K GLG +LRN  G     +C       +
Sbjct  1606  ------------RPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNN  1653

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGL  190
             P E+E  A  E L       +  I VE+D   VV  L
Sbjct  1654  PLESELRACVEGLKLAIHWTLLPIQVETDCASVVQLL  1690



>ref|XP_009114092.1| PREDICTED: uncharacterized protein LOC103839337 [Brassica rapa]
Length=778

 Score =   228 bits (581),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 165/551 (30%), Positives = 254/551 (46%), Gaps = 56/551 (10%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R  SW+ + LS+ G+E+ +K+V QA+PS+ M+ +LLPQG+   +   ++ FWW       
Sbjct  201   RTNSWSTKLLSKGGKEIQIKAVAQAVPSFTMSCYLLPQGITKKLMSAVSRFWWST-KINN  259

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             KGL W AWDK+CVP   GG+GFR    FNLALL+KQ WRL  +P SL A+++K +YY ++
Sbjct  260   KGLHWVAWDKICVPTDEGGLGFRDFHAFNLALLTKQLWRLLQYPHSLLARVLKGRYYRHT  319

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP-  1165
                + +K  NPS+ W SLL +K ++    R +IGNG + ++W + WLP       T P  
Sbjct  320   NPMNVQKASNPSYGWRSLLASKEVLHKGLRKKIGNGHTTKVWEEPWLP-------TQPAR  372

Query  1164  FPYlanasvnsllnNH------GSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
              P       +   + H         W+ E++  + ++ D   I S+ + +  R D+  W 
Sbjct  373   APLSIGNVRDEDFHVHHLIDAQNQSWNLEILNTVISTEDIPKITSLRVSRTGRHDRYSWD  432

Query  1002  KDEKGVFTVKSCYKAISLDLDSVPIASWST----------IWNVHLPPRAKTFIWQVCSG  853
               + GV++V+S YK I+ +L S    S  T          IW    P + K F+WQV +G
Sbjct  433   FTKSGVYSVRSGYK-IARELQSTANPSVVTEPSTTELKKAIWKFKAPRKLKHFLWQVTTG  491

Query  852   CLPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSE  673
              L TA+ L+ R      +C  C +  +S  H + +C  A QCW           AQS   
Sbjct  492   YLATAEQLKERHFAKESICVRCGDENKSINHTIFKCPPALQCW-----------AQSDIP  540

Query  672   WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKAL----WRDWKA  505
                  F     P  SL+  I + ++RA+   V   I         +S  L       W  
Sbjct  541   SSLGLF-----PSNSLYSNIDFLLFRAKETGVRSEIFKDKDITPLDSLQLAVKEAESWTL  595

Query  504   CTEV-------DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHG  346
                +        D+QRR++H    + + P   W +   DA+      + G+G+VL     
Sbjct  596   AQRIPEDTKGERDEQRRTRHSASIQEL-PAARW-RCQTDASWTNERDRAGMGFVLLEDDI  653

Query  345   IFHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTS  166
                       + V SP  AEA  +  A+    R     +  ESD   ++  +       S
Sbjct  654   PILFGTQGLSVAV-SPLHAEAEGLLWAMQEVMRHGTRAVRFESDCEQLIKLIRDDEDWPS  712

Query  165   FDLLLADIKDL  133
                 L +IKDL
Sbjct  713   MASELDEIKDL  723



>ref|XP_004301010.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=735

 Score =   227 bits (579),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/532 (30%), Positives = 250/532 (47%), Gaps = 64/532 (12%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             + + W  + LS AG+EVL+KS+IQA+P+Y M+ F LP  L +++ + M  FWWG    + 
Sbjct  38    QTQGWRDKTLSGAGKEVLIKSIIQAIPTYVMSCFELPGHLCNEMHQLMAKFWWGEFGDER  97

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K +RW AWDKLC  KK GG+GFR I  FN ALL+KQ WR+   P+SL A++         
Sbjct  98    K-IRWIAWDKLCSTKKEGGLGFRDINVFNRALLAKQGWRMICRPQSLLAQV---------  147

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                                              GNG  + IW+D W+P   + +  + P 
Sbjct  148   ---------------------------------GNGEMISIWNDPWVPLPYSFKPFSDPM  174

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  L++     W+ EV+ D+FN  +  LIL IP+     ED+++W  D+KG +
Sbjct  175   QGSEDMRVCDLIDGDIGEWNVEVIEDLFNPMEIDLILKIPLSLYGGEDRLVWHFDKKGCY  234

Query  981   TVKSCYKAISLDLDSVPIAS-----------WSTIWNVHLPPRAKTFIWQVCSGCLPT-A  838
             TVKS Y    L       AS           W  +W+  +PP+     W++  G LPT A
Sbjct  235   TVKSGYYVGRLVEGLEKQASGSDSRVKRGRLWCKLWSAQVPPKVHMHGWRLAQGTLPTRA  294

Query  837   DLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWR--LFEPLPATSQAQSCSEWIT  664
              L++ +       C  CLN  E + H+   C+     W+  + +  P T  + S   W  
Sbjct  295   ALIKKKAQLPDVSCVFCLNSVEDSLHLFKNCNALRAFWKQYMLQIQPYTHPSVSIEVWFW  354

Query  663   KCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQ  484
                + L       F++  W IW  RN  VW+     A  + E S  L R++K C +    
Sbjct  355   DMIDMLSGETLGAFLMALWVIWVERNNMVWRGKYYNAANMFEWSTTLLREYKECHQHSGS  414

Query  483   QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVL  304
             +++   + I+KW    +G  K+N+D + +      G+G V+RN+ G   +     +   L
Sbjct  415   KKK---RAISKWSCLPRGRLKVNIDGSFEQELGSGGVGVVVRNYEGECVATFARPFQYAL  471

Query  303   SPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLA  148
             S    EA A+R  +  C +Q  + + VESD + +VH L +    T  DL +A
Sbjct  472   SAFHMEAEALRAGMLICIQQGWEDVEVESDCVNLVHALQN----TDDDLSIA  519



>gb|AAD24601.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1319

 Score =   231 bits (589),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/543 (30%), Positives = 257/543 (47%), Gaps = 26/543 (5%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             S +  W  + LS+ G+E+LLKS+  ALP Y M  F LP+GL + +   M  FWW + +  
Sbjct  726   SHLSGWYDKTLSQGGKEILLKSIALALPVYIMTCFRLPKGLCTKLTSVMMDFWWNSMEFS  785

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              K + W    KL +PK  GG GF+ ++ FN ALL+KQAWRLF+  +S+ ++I K++Y+ N
Sbjct  786   NK-IHWIGGKKLTLPKSLGGFGFKDLQCFNQALLAKQAWRLFSDSKSIVSQIFKSRYFMN  844

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             + F +A++G  PS+ W S+L  + ++ G  +  IGNG    +W D WL D ++ R     
Sbjct  845   TDFLNARQGTRPSYTWRSILYGRELLNGGLKRLIGNGEQTNVWIDKWLFDGHSRRPMNLH  904

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                  +  V+ L++     W+ + + ++F+ +D QLI+    P    ED   W     G+
Sbjct  905   SLMNIHMKVSHLIDPLTRNWNLKKLTELFHEKDVQLIMH-QRPLISSEDSYCWAGTNNGL  963

Query  984   FTVKSCY--------KAISLDLDSVPIAS--WSTIWNVHLPPRAKTFIWQVCSGCLPTAD  835
             +TVKS Y        K +  + D  P  +  +  +W++   P+ K F+W+   G L   D
Sbjct  964   YTVKSGYERSSRETFKNLFKEADVYPSVNPLFDKVWSLETVPKIKVFMWKALKGALAVED  1023

Query  834   LLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL-FEPLPATSQAQSCSEWITKC  658
              LR R I  +  C  C    E+  H+L +C FA Q W L     PAT    S    I   
Sbjct  1024  RLRSRGIRTADGCLFCKEEIETINHLLFQCPFARQVWALSLIQAPATGFGTSIFSNINHV  1083

Query  657   FESLQP---PRASLFVI--ICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
              ++ Q    PR    V   + W IW+ RN+ +++   L +  +V  +      W    E 
Sbjct  1084  IQNSQNFGIPRHMRTVSPWLLWEIWKNRNKTLFQGTGLTSSEIVAKAYEECNLWINAQEK  1143

Query  492   DDQQRR-SQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSW  316
                    S+H    KW  P  G  K N+  A     +  G+ WVLR+  G     +  S+
Sbjct  1144  SSGGVSPSEH----KWNPPPAGELKCNIGVAWSRQKQLAGVSWVLRDSMGQVLLHSRRSY  1199

Query  315   IGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIKD  136
               V S  +A+  +   AL      H D +   + S  ++  L  P     + +L+  I +
Sbjct  1200  SQVYSLFDAKIKSWDWALESMDHFHFDKVTFAATSHDIIKALHKP---NEWPMLIGHIAE  1256

Query  135   LLS  127
              LS
Sbjct  1257  FLS  1259



>gb|AAX94970.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93330.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=816

 Score =   228 bits (581),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/544 (30%), Positives = 244/544 (45%), Gaps = 41/544 (8%)
 Frame = -2

Query  1710  FFSRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGD  1531
                R+  W  +FLS  G+EVL+KSVIQALP+Y MN+F LP G   D  + +  FWWG   
Sbjct  42    LMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMNVFKLPSGFCEDYMKMIRKFWWGEEK  101

Query  1530  TQGKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYY  1351
              + K   W +W +L  PK  GG+GF+ +K FN ALL++QAWRL    +SL AK+MKA+Y+
Sbjct  102   NRRK-THWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLMKARYF  160

Query  1350  PNSQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITT  1171
             PN    D     + S VW  +     +++    WRIG G  + IW DNW+P  +  R+T 
Sbjct  161   PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWIPRDHQLRVTG  220

Query  1170  PPFPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEK  991
                       V  L++ +   WD+ ++R IF       IL I +P+ P +D + W  +  
Sbjct  221   KR-TRTCLKWVADLVSPNNQEWDEGLIRQIFYPPYVDEILKIKLPESPTDDFLAWHPERL  279

Query  990   GVFTVKSCYKAISLDLDSVPIAS------------WSTIWNVHLPPRAKTFIWQVCSGCL  847
             GVFTV+S YK    +      A             W  IW+  +P +   F W++    L
Sbjct  280   GVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVPQKVCIFAWRLAVERL  339

Query  846   PTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQC---WRLFEPLPATSQ--AQS  682
             PT    + R I  S  C +C    E  FH    C+ A       R F P+P   +   Q 
Sbjct  340   PTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELRAFWPIPPEDKFVRQG  399

Query  681   CSEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWR-----  517
                 +          +A + +++ W  W  RN  V     L     +   ++  +     
Sbjct  400   PDWLLLLLDTLDMRNKAQMLLML-WRAWHLRNNSVHDTGTLTISGSIRFLQSYVQLLFPI  458

Query  516   ----DWKACTEVDDQQRRSQHQYITK------WIRPMQGWFKLNVDAALDINSRKMGLGW  367
                 D K         R +Q+  +TK      W  P +GW K+NVD A  +     G+G 
Sbjct  459   RQKEDPKGKCAAQVPGRLNQNPGVTKADCLQIWEPPPEGWAKINVDGAFSMTDNTGGIGV  518

Query  366   VLRNHHGIFHSAACNSWIGV---LSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVH  196
             + R+  G    A  +SW  +      ++ E LA  E +          I +ESD + V+ 
Sbjct  519   IARDSEG---KALLSSWKYLHRCADAEQVEILACYEGMKLAAEWIRKPIILESDCVTVIG  575

Query  195   GLSS  184
              +++
Sbjct  576   RMTA  579



>ref|XP_010445303.1| PREDICTED: uncharacterized protein LOC104727950 [Camelina sativa]
Length=867

 Score =   228 bits (582),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/324 (37%), Positives = 189/324 (58%), Gaps = 6/324 (2%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R+  W+ + LS+ G+E+++KSV  ALP++ M+ + LPQ L S +   ++ FWW + D + 
Sbjct  487   RVNGWSAKCLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAISTFWWKSND-KA  545

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ W AWDKLC  K  GG+GFR ++ FN A+L+KQ WRL  +P SL AK+MK++Y+ N 
Sbjct  546   RGMHWVAWDKLCKDKAEGGLGFRALEQFNEAMLAKQFWRLIQYPTSLMAKVMKSRYFRNK  605

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 AKK  NPSF W S+   KG+++   RW +G+G S+ +W D W+PD+          
Sbjct  606   HPLMAKKPYNPSFAWRSIYSIKGLVEQGARWAVGSGNSISVWRDPWIPDIRPRPANGRGR  665

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
              +L +  VN L+N     W    + + F+  D QLI S+P+ +  + D++IW   + G +
Sbjct  666   LWLPSLMVNHLINPETKNWHLPTLEEFFDPGDIQLIQSMPVSRTHQPDRLIWHYTKSGKY  725

Query  981   TVKSCY---KAISLDLDSVP--IASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             +VKS Y   + + +D++  P   A  +  W + +P + + F WQ+ SG LP  + L HR 
Sbjct  726   SVKSGYRLARELIMDVEYGPTCTALRAQSWKLDVPSKIQHFFWQIGSGTLPVLERLAHRG  785

Query  816   IDCSPLCPLCLNVEESAFHILAEC  745
             + C  +C  C +  E+  H L EC
Sbjct  786   VRCDTVCKRCDSAVETINHALFEC  809



>ref|XP_009110781.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=634

 Score =   225 bits (573),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 163/542 (30%), Positives = 257/542 (47%), Gaps = 23/542 (4%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +  SW+ + LS AG+ VLLKS++ A PS++M  F LP+ L   I+  +  FWW + +   
Sbjct  63    KAASWSSKQLSAAGKLVLLKSILAAKPSFSMTCFKLPKSLTKRIQSALTRFWW-DANPGK  121

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +WDKL   KK GG+G R I+ FN ALL+KQ+WR+   P+ L AK++  KY    
Sbjct  122   KKMCWVSWDKLATSKKDGGLGLREIESFNDALLAKQSWRILQRPDCLLAKVLLGKYCKYD  181

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
              F   +   + S  W S+L  + ++  N    IGNG    IW D+WL      R   PP 
Sbjct  182   GFMKVQAANDCSHGWRSILCGRDLLLANTGKTIGNGKDTSIWEDSWLSTTAPTRPMGPPD  241

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                 +  V  L+++    W+ E+V  I  + DA  I  I   +    D+  W+  + G +
Sbjct  242   QNTRDLRVADLIDSSTGAWNRELVNLILPT-DAPSIFCIKPSRTDAPDRHCWLLTKNGEY  300

Query  981   TVKSCYKAISLDLDSV--------PIASWSTIWNVHLPPRAKTFIWQVCSGCLPTADLLR  826
             + ++ Y +   +L S         P      IW++ +PP+ K F+W++ +G LP  + L 
Sbjct  301   STRTGYYSAVNNLRSQLQPPPNQNPCNWMGDIWSLTIPPKLKIFLWKIANGALPLGENLE  360

Query  825   HRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEWITKCFESL  646
              R +  +  C  C  ++E+A H+   C FA + W L  P+   +   +  E++T    S 
Sbjct  361   KRGMVDNINCIHC-GMKETAAHLFLHCQFANEIWSL-APVHQATALAAAPEFMTALKLSR  418

Query  645   Q----PPR----ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWK-ACTEV  493
             +    PP       LF  I WNIW ARN+K+++     A   +  + A  R+W+ A T+ 
Sbjct  419   KLNNLPPTGLRLGPLFPWIAWNIWLARNQKLFEGRAFTASETLAKAVANAREWQEAQTDE  478

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNV--DAALDINSRKMGLGWVLRNHHGIFHSAACNS  319
                Q +   Q     I+ M    K+ +  DAA    S   GL W   N  G        +
Sbjct  479   VGVQGKQPRQQRPPEIQHMNREDKITIHTDAAWRKESLMAGLAWTASNETGTTILQGTAT  538

Query  318   WIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADIK  139
                V S   AE LAIREAL   +   +  I ++SD+ + +  ++    +     +L DI 
Sbjct  539   EDCVSSALLAEGLAIREALLQAQAHRLSNIIIKSDAQINIRAINKRESIKEICGILQDIH  598

Query  138   DL  133
              L
Sbjct  599   SL  600



>dbj|BAB08714.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=1197

 Score =   230 bits (587),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 166/533 (31%), Positives = 257/533 (48%), Gaps = 23/533 (4%)
 Frame = -2

Query  1692  SWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGKGL  1513
             SW+ RFLS AG++V+L+SV+ A+P YAM+ FLLP  L   I+ T+  FWW   D Q K +
Sbjct  608   SWSSRFLSGAGKQVMLQSVLTAIPVYAMSCFLLPLSLCDRIQSTLTRFWWDKTDQQRK-M  666

Query  1512  RWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQFF  1333
              W  WD+L VPK  GG+GF+  K +N+ALL+KQ+WR+  HP  L A+++  KY  N  F 
Sbjct  667   CWVGWDRLAVPKVRGGLGFKNFKAYNVALLAKQSWRVLPHPSCLLARVLLGKYCQNESFL  726

Query  1332  DAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFPYl  1153
              A      S  W  LL  + +++    W IGN  SV +W D WL      +   P     
Sbjct  727   KALSPTFASHGWRDLLAGRDLLRKQLGWTIGNDKSVLVWQDAWLAHDKRIQPVGPAPLLS  786

Query  1152  anasvnsllnNHGSGWDD-EVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVFTV  976
              +  V  L   +   WD+ ++   I   +D  L+L+I   +    DK IW+  + G++T 
Sbjct  787   KDWKVKDLFLPNSVDWDEGKIEAAIPFVKD--LVLAIRPSRAGGADKRIWLGAKDGLYTT  844

Query  975   KSCYKAISLDLDS----VPIASWS---TIWNVHLPPRAKTFIWQVCSGCLPTADLLRHRR  817
             K+ YKA   D+DS     P+ S++    +WNV   P+ + F+W+  SG LP    L  R 
Sbjct  845   KTGYKATLCDVDSDSSRDPVLSFNWFDEVWNVQCSPKIRLFLWKAVSGALPVGSQLAIRI  904

Query  816   IDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPAT------SQAQSCSEWI--TK  661
                 P+C  C  +E S+ H L  C F  + WRL  PL         +  +    W+   K
Sbjct  905   PSFDPVCCRCGELETSS-HALFNCMFVQRVWRL-APLEGIDLFLVFTDVKLGLSWLKKKK  962

Query  660   CFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEVDDQQ  481
                S+     +L+  ICW +W  RN+KV+ NI       +  +    ++W+   E + + 
Sbjct  963   TLPSVGLGYCALYPWICWTLWITRNQKVFSNILFSELETINKAIQDAKEWQFAQEPNSRF  1022

Query  480   RRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWIGVLS  301
             +      +   +  +     ++ DAA  + +   GLGW L++  GI           V S
Sbjct  1023  QVRSSMGLRAEVFSLNSTV-IHTDAAWSVLTCSAGLGWTLKS-PGIPLKKNSALSEHVPS  1080

Query  300   PKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSFDLLLADI  142
             P  AEAL +  AL       +  + ++SD  V+   + S   ++    +L DI
Sbjct  1081  PLVAEALVVHSALWSAHNLGLHDVILKSDCQVLTMAIISQFPLSEIHGILQDI  1133



>ref|XP_008374008.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=615

 Score =   224 bits (572),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 162/564 (29%), Positives = 266/564 (47%), Gaps = 57/564 (10%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
             SR+  W  +FLS AG+E+L+K+V  A+P++AM+ F LP G+  DIE+ +  +WW  G   
Sbjct  35    SRMTGWAEQFLSPAGKEILIKAVATAMPNHAMSCFKLPIGVCRDIEKAIRSYWW-RGSGV  93

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              +G+ W +W +L   K  GG+GF+  + FNLA L K  WRL   P+SL AK+M+ KYYP 
Sbjct  94    SRGVHWTSWVRLLQKKXXGGLGFKDFQGFNLAFLGKIGWRLIIFPDSLLAKVMRDKYYPE  153

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
               F +A  G   S+ W  +LE + ++     WR+ +G +++I  D W P  +       P
Sbjct  154   KTFREATIGRGSSWGWKGILEARKVLDKGLIWRVEDGETIKIREDPWYPKPST--FCIRP  211

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
                L    V  L+N     W  +++   F+S +A  ILSIPI +    D+M W     GV
Sbjct  212   AVNLDALYVRDLINQESKTWKADLISASFSSEEANTILSIPISKTGSCDRMGWFHTANGV  271

Query  984   FTVKSCYKAISLDL----------------DSVPIASWSTIWNVHLPPRAKTFIWQVCSG  853
             ++VKS Y  I+++L                 +    +W+ IW++ +P + + FIW+ C+ 
Sbjct  272   YSVKSGY-GIAMELMESGGLRKKGRGATSDKTKHNKTWNAIWSLDVPRKMRFFIWKCCNH  330

Query  852   CLPTADLLRHRRIDCSPLCPL-CLNVEESAFHILAECSFATQCW-RLFEPLPATSQAQSC  679
              L     L+ R +    +C +   ++E + F          Q W  ++  +   +     
Sbjct  331   ALAVRRNLKRRHMRVDNICGINSFDLEGTDF---------LQSWVNIYNRVADLADKN--  379

Query  678   SEWITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACT  499
                     E LQ      FV   W +W+ +N+ +++   LP   ++E  K    +++   
Sbjct  380   --------ELLQE-----FVFGLWRLWKNQNDAIFRGSFLPPTEILEVWKRNVAEYRNAN  426

Query  498   EVDDQ--------QRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI  343
             E  +Q        +   + +    W +P  G  K+N D      S++ GLGWV R+  G+
Sbjct  427   ERVEQGSPTPVYNRDMGEERRRVCWKKPCFGMIKVNTDVTWYKASQRAGLGWVARDFAGV  486

Query  342   FHSAACNSWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSSPAFVTSF  163
                A         S   AEA AIR AL +C  Q    + VESD+  +V  +        F
Sbjct  487   LQGAGGTGASSFHSAAAAEAAAIRGALEFCLLQGFVNVIVESDARAIVL-MIRKELTRDF  545

Query  162   DL--LLADIKDLLSTFCSLLYLFC  97
              +  LL DI++L     ++ ++F 
Sbjct  546   RIGCLLGDIENLARRMQAVSFVFA  569



>ref|XP_008393387.1| PREDICTED: uncharacterized protein LOC103455579 [Malus domestica]
Length=876

 Score =   228 bits (581),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 236/518 (46%), Gaps = 83/518 (16%)
 Frame = -2

Query  1704  SRIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQ  1525
              RI  W  +FLS AG+EVL+KSV  ALP Y M+ F LP  L  +IE+ +  FWW +  T+
Sbjct  335   ERINGWAEQFLSMAGKEVLIKSVAAALPIYTMSCFQLPIHLAKEIEQVIARFWWRDQRTK  394

Query  1524  GKGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPN  1345
              KG+ W  W+K+   K +GG+GFR I DFNLA+L+K  WRL ++P S+ A++++AKYYP+
Sbjct  395   -KGIHWMTWNKVAKKKVYGGLGFREIIDFNLAMLAKVGWRLISNPGSILARVLQAKYYPS  453

Query  1344  SQFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPP  1165
             S F DA  G   S+ W  +L+ + I++   RWR+G+G  ++I  D WLP    PR   P 
Sbjct  454   SSFLDAPVGTGTSWGWKGILQGRKILKAGVRWRVGDGTCIQIGKDPWLP---IPRTFRPT  510

Query  1164  FPYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGV  985
               +       + L +    W  EV+   F+  +A+ ILS+PI +    D+++W     GV
Sbjct  511   SRHEEMPIFVADLVDMEGMWKREVIELCFSEDEAKTILSMPISRFGCPDRVVWHYTRNGV  570

Query  984   FTVKSCY-------KAISLDLDSVPIAS--------WSTIWNVHLPPRAKTFIWQVCSGC  850
             ++VKS Y       K   L    V  +S        W  IW++ +PP+   F W+ C   
Sbjct  571   YSVKSGYIVAQEMNKNGELGRKGVGQSSVDDNRDMVWRDIWSLKVPPKLCHFXWKGCKNI  630

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATS-QAQSCSE  673
             L     L+ R +     CP C N  E+   +              +PL A     Q   E
Sbjct  631   LAXCMNLQRRGVRLDINCPFCDNEVETQVAV--------------DPLTAIHLLKQQWEE  676

Query  672   WITKCFESLQPPRASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRDWKACTEV  493
             W+      +QP      V       RA     W                           
Sbjct  677   WVISDEAQVQPLSRGQLV-------RAPXPHQW---------------------------  702

Query  492   DDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGIFHSAACNSWI  313
                            I+P  G  K+N D A    +   G+GWV R+  GIF+ A     +
Sbjct  703   ---------------IKPPFGTLKVNCDGAWCSRTXIGGVGWVARDFVGIFNGAGGXGNM  747

Query  312   GVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVV  199
               +S   AEA A+  AL  C  +    I +E+DS V+V
Sbjct  748   QCVSSIMAEAEALXVALVXCVAKGFTXIQLETDSQVLV  785



>ref|XP_007224193.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
 gb|EMJ25392.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
Length=916

 Score =   228 bits (581),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 191/330 (58%), Gaps = 16/330 (5%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             +I+ W  + LS AG+E+LLK V QA+P Y MN FL+P+ L  +I++ M  +WWG  D Q 
Sbjct  588   KIQGWKAKLLSVAGKEILLKVVAQAVPIYMMNCFLIPKCLCDEIQQVMARYWWGEQDGQR  647

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             K + W +W+KLC+PK+ GG+GFR +  FN+ LL+KQ WRL   P SL A+I+KA+Y+ N 
Sbjct  648   K-IHWLSWNKLCLPKQEGGLGFRNLYAFNMVLLAKQLWRLIQTPNSLVARILKARYFKNC  706

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                +A+ G +PS++W SL + + +I+   RWRIGNG SVRIW D WLP+  + ++++P  
Sbjct  707   SILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSPQT  766

Query  1161  PYlanasvnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKDEKGVF  982
                  A VNSL+N     W +++++  F++ +   I +IP+      D +IW  +  G +
Sbjct  767   EGFDEAKVNSLINPVTMQWKEDLLQAWFSAEEVNCIRNIPLSFRYPPDILIWHFERDGQY  826

Query  981   TVKSCYKAI----------SLDLDSVPIAS----WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             TV S  +              +++  PI +    W  IW   +PP+ + FIW+     LP
Sbjct  827   TVWSGNEVARRVLLQQDGDDTNMNGGPIVACEQVWKKIWKARVPPKVRIFIWRALLNILP  886

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHIL  754
             T D L HR I     C  C   EE+  H+L
Sbjct  887   TKDNLIHRSISELGGCVFC-GAEETVVHVL  915



>ref|XP_009138589.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=739

 Score =   226 bits (577),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 159/535 (30%), Positives = 257/535 (48%), Gaps = 39/535 (7%)
 Frame = -2

Query  1701  RIKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQG  1522
             R++ W  RFLS AG+EV+LK+V  ALP+Y M  FLLP+ +   I   M+  WW N   + 
Sbjct  126   RVQGWQTRFLSPAGKEVMLKAVALALPTYTMACFLLPKTVCKKIVSIMSEVWWKN-KQES  184

Query  1521  KGLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNS  1342
             +G+ WK+WD++C  K+ GG+GF+ I+ FNLALL KQ WR+ +  +SL  ++ K++Y+  S
Sbjct  185   RGIYWKSWDQMCKRKENGGLGFKDIEAFNLALLGKQLWRMLSVKDSLLTRVFKSRYFAKS  244

Query  1341  QFFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPF  1162
                 A  G  PS+ W S+   + +IQ   R  IG+G   +++ D+W+      R     +
Sbjct  245   DPLSAGLGSRPSYAWRSIHAAQKLIQQGARVLIGSGEDTKVFQDSWIGQQPARRAQVVRW  304

Query  1161  PYlanas-------vnsllnNHGSGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWV  1003
                 +         V  LL N G  W+ E++  +F   +A+ I  I       +D  IW 
Sbjct  305   NSRDSRQYLRHNLRVRELLINQGREWNMELLTRLFPDDEARNISKIRTCGNGSKDIYIWD  364

Query  1002  KDEKGVFTVKSCY--------KAISLDLDSVPIAS-WSTIWNVHLPPRAKTFIWQVCSGC  850
              ++KG +TVKS Y        ++ ++++D   +   +   W+    P+   F+W+  S  
Sbjct  365   YNKKGHYTVKSGYWVQVNVLDRSAAVEIDQPSLDHLFQLAWSTETSPKVHHFLWRCISNL  424

Query  849   LPTADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRLFEPLPATSQAQSCSEW  670
             LP A  L  R I     C  C    E+  H+L +C FA   W L  P+PA  +    +  
Sbjct  425   LPVAGNLARRHIAKEAGCLRCGCDTETVNHVLFQCPFARLVWAL-SPIPAPPEGIIMNSL  483

Query  669   ITKCFESL----QPPR----ASLFVIICWNIWRARNEKVWKNICLPAKAVVENSKALWRD  514
              +  + +L    + PR    A +   I W +W+ RNE ++K     A +++  ++    D
Sbjct  484   YSNIYHALNIKKEYPREDIQAEIVPWILWRLWKNRNELLFKGKEFEAGSLILKAREDLED  543

Query  513   WKA-------CTEVDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRN  355
             W+          E ++ +R +       W  P   WFK N D A   N    GLGW+ R+
Sbjct  544   WQGRCQAEITAAEKNEAKRATTSVQTHTWKPPPTDWFKCNSDGAWHQNRETSGLGWICRD  603

Query  354   HHGIFHSAACNSWIGVLSPKEAEALAIR---EALSWCKRQHIDYIHVESDSLVVV  199
               G    A   +   + S    EA A+R   E L+    +++ +   E+DSL +V
Sbjct  604   ASGHVLWAGARAVTKMDSSILTEAEALRWGAETLAGFGYKNVIF---ETDSLSLV  655



>ref|XP_009115748.1| PREDICTED: uncharacterized protein LOC103840987 [Brassica rapa]
Length=820

 Score =   227 bits (578),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 163/545 (30%), Positives = 255/545 (47%), Gaps = 65/545 (12%)
 Frame = -2

Query  1698  IKSWNHRFLSRAGREVLLKSVIQALPSYAMNLFLLPQGLVSDIERTMNGFWWGNGDTQGK  1519
             + SW+ R LS+ G+EV +KSV QA+P+Y M+ +LLPQG+V  ++  ++ FWW +     +
Sbjct  259   VTSWSARLLSKGGKEVQIKSVAQAVPTYNMSCYLLPQGIVEKLKSAISNFWWSSSQNN-R  317

Query  1518  GLRWKAWDKLCVPKKWGGMGFRRIKDFNLALLSKQAWRLFNHPESLAAKIMKAKYYPNSQ  1339
             GL W AWDK+CVP   GG+GF  + DFN+ALL+KQ WRL   P+SL A++++ +YY  S 
Sbjct  318   GLHWIAWDKICVPHDQGGLGFLDLHDFNIALLAKQLWRLIQFPKSLLARVLRGRYYNRSS  377

Query  1338  FFDAKKGGNPSFVWASLLETKGIIQGNCRWRIGNGLSVRIWHDNWLPDVNNPRITTPPFP  1159
               + +K  +PS+ W S++  K +++   R  IG G +  +W + W+PD+       PP P
Sbjct  378   PLEDRKVYSPSYGWRSIMAAKPLLKSGLRKTIGAGQNTCVWSEPWIPDIE----ARPPRP  433

Query  1158  YlanasvnsllnNHG------SGWDDEVVRDIFNSRDAQLILSIPIPQGPREDKMIWVKD  997
                    +  L  H         WD  ++ + F+  D  LIL +        D   W   
Sbjct  434   SNQITHRHPKLLVHSFIRRDTRDWDTNLLLEYFHPEDIPLILKLRPSNTWSMDGYAWNFT  493

Query  996   EKGVFTVKSCYKAISLDL---DSVPIAS------WSTIWNVHLPPRAKTFIWQVCSGCLP  844
             + GV++VKS Y+ +       D   I         S +W++  P + K F+WQ  +GC+ 
Sbjct  494   KSGVYSVKSGYQRLQKTKPCDDEAQIVQPSITGLQSHVWSIPAPGKMKHFMWQALTGCIA  553

Query  843   TADLLRHRRIDCSPLCPLCLNVEESAFHILAECSFATQCWRL--FEPLPATSQAQSCSEW  670
             TA+ L +R +     CP C + EE+  H+L EC  A Q W L  +  LP    + S    
Sbjct  554   TAERLAYRHLGTDRSCPRCGDPEETINHLLFECPPALQVWALSDYPSLPGYFPSTSARND  613

Query  669   ITKCFESLQPPRASLFVIICWNIWRARN--EKVWKNICLPAKAVVENSKALWRDWKACTE  496
                  + + P        +  + WR  N  E+  +    P  ++V  S            
Sbjct  614   KFFNGKDISPLDTLQLASLEADCWRKANLLEEGEEEEQHPTPSLVSTS-----------S  662

Query  495   VDDQQRRSQHQYITKWIRPMQGWFKLNVDAALDINSRKMGLGWVLRNHHGI--FHSAACN  322
             VD Q+   Q                  +DA+   NS   GLGW  ++  G+  F    C 
Sbjct  663   VDPQRPTCQ------------------IDASWIENSTVSGLGWFYKDQMGVERFGLQGCR  704

Query  321   SWIGVLSPKEAEALAIREALSWCKRQHIDYIHVESDSLVVVHGLSS----PAFVT---SF  163
               +  L    AE   +  ++S  +      IH+E+D   +V  +S+    PAF +   SF
Sbjct  705   KSLSAL---HAEMEGLIWSMSCLRELQYTVIHIETDCSDLVDMISNPTDWPAFASELVSF  761

Query  162   DLLLA  148
              LL A
Sbjct  762   RLLRA  766



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5000389645955