BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13614_g1_i1 len=1485 path=[1501:0-1223 2725:1224-1271 40:1272-1484]

Length=1485
                                                                      Score     E

emb|CDP13671.1|  unnamed protein product                                372   2e-122   
emb|CDP13674.1|  unnamed protein product                                370   2e-121   
ref|XP_010314094.1|  PREDICTED: uncharacterized protein LOC101244061    353   5e-115   
ref|XP_009763291.1|  PREDICTED: uncharacterized protein LOC104215233    344   1e-111   
ref|XP_011097721.1|  PREDICTED: uncharacterized protein LOC105176569    339   2e-109   
gb|EYU33727.1|  hypothetical protein MIMGU_mgv1a0262881mg               327   6e-105   
ref|XP_007020399.1|  Uncharacterized protein TCM_030574                 306   1e-96    
ref|XP_007206363.1|  hypothetical protein PRUPE_ppa017788mg             302   2e-95    
ref|XP_006452672.1|  hypothetical protein CICLE_v10010821mg             299   5e-94    
gb|KDO59224.1|  hypothetical protein CISIN_1g036500mg                   298   6e-94    
ref|XP_010644630.1|  PREDICTED: uncharacterized protein LOC100852612    299   7e-94    
ref|XP_008353192.1|  PREDICTED: uncharacterized protein LOC103416744    299   1e-93    
ref|XP_006418603.1|  hypothetical protein EUTSA_v10002618mg             296   7e-93    
gb|KFK31798.1|  hypothetical protein AALP_AA6G160300                    294   9e-92    
gb|KHN23821.1|  hypothetical protein glysoja_028114                     292   4e-91    
ref|XP_002883629.1|  hypothetical protein ARALYDRAFT_480071             291   1e-90    
ref|XP_011039823.1|  PREDICTED: uncharacterized protein LOC105136253    291   1e-90    
ref|XP_010253022.1|  PREDICTED: uncharacterized protein LOC104594441    291   2e-90    
gb|ABK28164.1|  unknown                                                 289   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178505.1|  uncharacterized protein                               289   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142451.1|  hypothetical protein PHAVU_008G281700g             289   5e-90    
ref|XP_010488665.1|  PREDICTED: uncharacterized protein LOC104766470    289   6e-90    
emb|CDY00849.1|  BnaCnng00490D                                          288   7e-90    
emb|CDY27882.1|  BnaA07g04720D                                          288   9e-90    
ref|XP_010532946.1|  PREDICTED: uncharacterized protein LOC104808831    288   1e-89    
ref|XP_010466979.1|  PREDICTED: uncharacterized protein LOC104747105    287   4e-89    
ref|XP_010514327.1|  PREDICTED: uncharacterized protein LOC104790300    286   6e-89    
ref|XP_011016815.1|  PREDICTED: uncharacterized protein LOC105120349    286   6e-89    
ref|XP_002266988.1|  PREDICTED: uncharacterized protein LOC100249414    286   1e-88    Vitis vinifera
ref|XP_002532169.1|  conserved hypothetical protein                     286   1e-88    Ricinus communis
ref|XP_002300574.2|  hypothetical protein POPTR_0001s47170g             285   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006299727.1|  hypothetical protein CARUB_v10015920mg             285   2e-88    
ref|XP_009102402.1|  PREDICTED: uncharacterized protein LOC103828543    285   2e-88    
ref|XP_010107360.1|  hypothetical protein L484_006875                   283   7e-88    
ref|XP_010103965.1|  hypothetical protein L484_020218                   303   1e-87    
gb|AET00846.2|  kinesin heavy chain, putative                           304   1e-87    
ref|XP_003617887.1|  Kinesin-4                                          304   2e-87    
ref|XP_010929447.1|  PREDICTED: uncharacterized protein LOC105050916    282   2e-87    
emb|CBI28480.3|  unnamed protein product                                281   3e-87    
ref|XP_011072457.1|  PREDICTED: uncharacterized protein LOC105157708    282   3e-87    
ref|XP_010542041.1|  PREDICTED: uncharacterized protein LOC104815373    281   6e-87    
ref|XP_010676107.1|  PREDICTED: uncharacterized protein LOC104892001    281   9e-87    
ref|XP_007217278.1|  hypothetical protein PRUPE_ppa017616mg             280   1e-86    
ref|NP_193005.1|  uncharacterized protein                               279   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305864.1|  PREDICTED: uncharacterized protein LOC101301230    280   2e-86    
ref|XP_002863234.1|  hypothetical protein ARALYDRAFT_497148             279   2e-86    
ref|XP_006284280.1|  hypothetical protein CARUB_v10005449mg             277   7e-86    
ref|XP_008229762.1|  PREDICTED: uncharacterized protein LOC103329112    278   9e-86    
ref|XP_006469407.1|  PREDICTED: uncharacterized protein LOC102629245    278   1e-85    
ref|XP_006447854.1|  hypothetical protein CICLE_v10017488mg             277   3e-85    
ref|XP_010450329.1|  PREDICTED: uncharacterized protein LOC104732477    275   7e-85    
ref|XP_010435360.1|  PREDICTED: uncharacterized protein LOC104719196    275   1e-84    
ref|XP_010496357.1|  PREDICTED: uncharacterized protein LOC104773443    274   1e-84    
emb|CDO97954.1|  unnamed protein product                                275   1e-84    
ref|XP_008444827.1|  PREDICTED: uncharacterized protein LOC103488057    274   4e-84    
ref|XP_008380035.1|  PREDICTED: uncharacterized protein LOC103443030    273   7e-84    
ref|XP_008353616.1|  PREDICTED: uncharacterized protein LOC103417205    273   8e-84    
ref|XP_008342273.1|  PREDICTED: uncharacterized protein LOC103405081    273   1e-83    
ref|XP_002307050.1|  hypothetical protein POPTR_0005s06920g             271   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_008783101.1|  PREDICTED: uncharacterized protein LOC103702440    270   6e-83    
ref|XP_004135720.1|  PREDICTED: uncharacterized protein LOC101212848    271   8e-83    
ref|XP_010038753.1|  PREDICTED: uncharacterized protein LOC104427347    270   1e-82    
ref|XP_003518296.1|  PREDICTED: uncharacterized protein LOC100796483    270   2e-82    
ref|XP_009777340.1|  PREDICTED: uncharacterized protein LOC104226933    270   2e-82    
ref|XP_011031123.1|  PREDICTED: uncharacterized protein LOC105130358    269   4e-82    
gb|KDP32618.1|  hypothetical protein JCGZ_13168                         268   5e-82    
ref|XP_011080356.1|  PREDICTED: uncharacterized protein LOC105163627    269   5e-82    
ref|XP_009622577.1|  PREDICTED: uncharacterized protein LOC104113961    268   7e-82    
ref|XP_006343140.1|  PREDICTED: uncharacterized protein LOC102583919    268   1e-81    
ref|XP_007142239.1|  hypothetical protein PHAVU_008G264000g             266   2e-81    
ref|XP_004235628.1|  PREDICTED: uncharacterized protein LOC101250288    267   2e-81    
ref|XP_010552345.1|  PREDICTED: uncharacterized protein LOC104822...    265   3e-81    
ref|XP_006857698.1|  hypothetical protein AMTR_s00061p00168530          266   3e-81    
ref|XP_004490568.1|  PREDICTED: uncharacterized protein LOC101492045    266   5e-81    
ref|XP_003544282.1|  PREDICTED: uncharacterized protein LOC100810973    265   8e-81    
gb|EPS70677.1|  hypothetical protein M569_04081                         262   9e-80    
ref|XP_007049429.1|  Uncharacterized protein TCM_002465                 262   1e-79    
ref|XP_003615564.1|  hypothetical protein MTR_5g069570                  262   2e-79    
ref|XP_009778863.1|  PREDICTED: uncharacterized protein LOC104228156    262   2e-79    
ref|XP_006366122.1|  PREDICTED: uncharacterized protein LOC102584925    261   2e-79    
ref|XP_004252365.1|  PREDICTED: uncharacterized protein LOC101249896    261   3e-79    
ref|XP_002524594.1|  conserved hypothetical protein                     259   3e-78    Ricinus communis
ref|XP_011022881.1|  PREDICTED: uncharacterized protein LOC105124530    259   3e-78    
ref|XP_003556772.1|  PREDICTED: uncharacterized protein LOC100806502    258   6e-78    
ref|XP_009592922.1|  PREDICTED: uncharacterized protein LOC104089679    258   7e-78    
ref|XP_002310533.1|  hypothetical protein POPTR_0007s04630g             257   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010465151.1|  PREDICTED: uncharacterized protein LOC104745569    255   3e-77    
ref|XP_007146005.1|  hypothetical protein PHAVU_006G004800g             256   4e-77    
ref|XP_010552346.1|  PREDICTED: uncharacterized protein LOC104822...    253   6e-77    
ref|XP_006299636.1|  hypothetical protein CARUB_v10015817mg             254   6e-77    
ref|XP_002884958.1|  hypothetical protein ARALYDRAFT_478708             254   7e-77    
gb|KHN43917.1|  hypothetical protein glysoja_025956                     253   9e-77    
gb|EYU45840.1|  hypothetical protein MIMGU_mgv1a019714mg                254   1e-76    
ref|XP_009135291.1|  PREDICTED: uncharacterized protein LOC103859505    254   1e-76    
ref|XP_010500251.1|  PREDICTED: uncharacterized protein LOC104777658    253   2e-76    
ref|XP_006407245.1|  hypothetical protein EUTSA_v10022027mg             253   2e-76    
ref|NP_683561.1|  uncharacterized protein                               253   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199638.1|  uncharacterized protein                               253   1e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CDY66553.1|  BnaCnng51410D                                          250   2e-75    
ref|XP_009392096.1|  PREDICTED: uncharacterized protein LOC103978120    250   3e-75    
ref|XP_004502142.1|  PREDICTED: uncharacterized protein LOC101513281    250   7e-75    
ref|XP_010487075.1|  PREDICTED: uncharacterized protein LOC104765...    248   1e-74    
emb|CDX82547.1|  BnaA03g32740D                                          248   3e-74    
emb|CDY48744.1|  BnaA02g30050D                                          248   4e-74    
ref|XP_002865625.1|  hypothetical protein ARALYDRAFT_917720             248   5e-74    
gb|KHN46178.1|  hypothetical protein glysoja_022820                     245   7e-74    
ref|XP_010495442.1|  PREDICTED: uncharacterized protein LOC104772538    247   9e-74    
ref|XP_010487076.1|  PREDICTED: uncharacterized protein LOC104765...    246   1e-73    
ref|XP_010484925.1|  PREDICTED: uncharacterized protein LOC104763219    247   1e-73    
gb|KFK31309.1|  hypothetical protein AALP_AA6G096000                    246   5e-73    
ref|XP_010445941.1|  PREDICTED: uncharacterized protein LOC104728686    245   6e-73    
ref|XP_003601505.1|  hypothetical protein MTR_3g082430                  244   9e-73    
ref|XP_006281899.1|  hypothetical protein CARUB_v10028103mg             244   1e-72    
ref|XP_006395202.1|  hypothetical protein EUTSA_v10005686mg             245   1e-72    
emb|CDY05690.1|  BnaC02g38470D                                          241   8e-72    
ref|XP_009387555.1|  PREDICTED: uncharacterized protein LOC103974443    241   1e-71    
gb|EPS70399.1|  hypothetical protein M569_04363                         238   6e-71    
ref|XP_009129718.1|  PREDICTED: uncharacterized protein LOC103854529    240   7e-71    
emb|CDX86317.1|  BnaA06g30340D                                          239   7e-71    
ref|XP_009151628.1|  PREDICTED: uncharacterized protein LOC103874...    237   7e-70    
gb|KHN09942.1|  hypothetical protein glysoja_043621                     234   1e-69    
ref|XP_009151627.1|  PREDICTED: uncharacterized protein LOC103874...    237   1e-69    
gb|EYU21422.1|  hypothetical protein MIMGU_mgv1a022950mg                235   4e-69    
gb|KDP22998.1|  hypothetical protein JCGZ_01720                         244   2e-68    
dbj|BAK07193.1|  predicted protein                                      230   4e-67    
ref|XP_002977922.1|  hypothetical protein SELMODRAFT_107811             229   5e-67    
ref|XP_002986948.1|  hypothetical protein SELMODRAFT_158336             229   5e-67    
ref|XP_006848668.1|  hypothetical protein AMTR_s00305p00015080          228   2e-66    
ref|XP_001772274.1|  predicted protein                                  224   1e-65    
ref|XP_010689671.1|  PREDICTED: uncharacterized protein LOC104903342    222   5e-64    
gb|ABR17303.1|  unknown                                                 220   6e-64    Picea sitchensis
ref|XP_004515862.1|  PREDICTED: uncharacterized protein LOC101502004    221   7e-64    
ref|XP_010551974.1|  PREDICTED: uncharacterized protein LOC104822...    221   2e-63    
ref|XP_001770719.1|  predicted protein                                  218   6e-63    
ref|XP_009359202.1|  PREDICTED: uncharacterized protein LOC103949811    217   2e-62    
emb|CDY19961.1|  BnaA09g02900D                                          217   2e-62    
gb|KDO82205.1|  hypothetical protein CISIN_1g020915mg                   217   3e-62    
ref|XP_008340356.1|  PREDICTED: uncharacterized protein LOC103403320    216   4e-62    
ref|XP_006438240.1|  hypothetical protein CICLE_v10033962mg             216   6e-62    
ref|XP_011071966.1|  PREDICTED: uncharacterized protein LOC105157288    216   7e-62    
ref|XP_010039142.1|  PREDICTED: uncharacterized protein LOC104427810    216   9e-62    
emb|CDY00069.1|  BnaC09g02320D                                          215   1e-61    
ref|XP_003525519.1|  PREDICTED: uncharacterized protein LOC100779755    216   1e-61    
ref|XP_008793736.1|  PREDICTED: uncharacterized protein LOC103709963    215   2e-61    
gb|KEH31766.1|  protein phosphatase 2c, putative                        215   2e-61    
gb|KDP31019.1|  hypothetical protein JCGZ_11395                         214   2e-61    
ref|XP_002511308.1|  conserved hypothetical protein                     215   2e-61    Ricinus communis
ref|XP_007155488.1|  hypothetical protein PHAVU_003G205700g             215   3e-61    
ref|XP_003571347.2|  PREDICTED: uncharacterized protein LOC100832869    214   3e-61    
ref|XP_010102967.1|  hypothetical protein L484_018986                   214   3e-61    
gb|EAY84891.1|  hypothetical protein OsI_06256                          214   3e-61    Oryza sativa Indica Group [Indian rice]
ref|NP_001046211.1|  Os02g0198800                                       214   4e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EMT16711.1|  hypothetical protein F775_12417                         213   9e-61    
gb|KHN10445.1|  hypothetical protein glysoja_030881                     213   1e-60    
ref|XP_003549823.1|  PREDICTED: uncharacterized protein LOC100802...    213   1e-60    
ref|XP_010663087.1|  PREDICTED: uncharacterized protein LOC100243254    213   2e-60    
ref|XP_010929912.1|  PREDICTED: uncharacterized protein LOC105051269    212   3e-60    
gb|EMS50536.1|  hypothetical protein TRIUR3_22811                       211   5e-60    
ref|XP_007224142.1|  hypothetical protein PRUPE_ppa016161mg             210   8e-60    
emb|CBI14939.3|  unnamed protein product                                210   9e-60    
ref|XP_009111832.1|  PREDICTED: uncharacterized protein LOC103837244    211   9e-60    
ref|XP_007044827.1|  Uncharacterized protein TCM_010569                 211   1e-59    
gb|ACF81406.1|  unknown                                                 209   1e-59    Zea mays [maize]
ref|XP_008239343.1|  PREDICTED: uncharacterized protein LOC103337946    210   2e-59    
ref|XP_007208899.1|  hypothetical protein PRUPE_ppa026898mg             210   2e-59    
ref|XP_010090262.1|  hypothetical protein L484_006168                   209   2e-59    
ref|NP_001131873.1|  hypothetical protein                               209   3e-59    Zea mays [maize]
ref|XP_009628338.1|  PREDICTED: uncharacterized protein LOC104118721    209   4e-59    
ref|XP_002282388.2|  PREDICTED: probable protein phosphatase 2C 14      218   4e-59    Vitis vinifera
ref|XP_004236272.1|  PREDICTED: uncharacterized protein LOC101245536    209   5e-59    
ref|XP_006484324.1|  PREDICTED: uncharacterized protein LOC102618638    218   5e-59    
gb|AFK39419.1|  unknown                                                 209   5e-59    
ref|XP_004970997.1|  PREDICTED: uncharacterized protein LOC101768022    208   5e-59    
ref|XP_006344483.1|  PREDICTED: uncharacterized protein LOC102586788    208   6e-59    
ref|XP_008372607.1|  PREDICTED: uncharacterized protein LOC103435955    213   6e-59    
ref|XP_010912954.1|  PREDICTED: uncharacterized protein LOC105038765    208   7e-59    
ref|XP_006382769.1|  hypothetical protein POPTR_0005s05250g             207   9e-59    
ref|XP_007207341.1|  hypothetical protein PRUPE_ppa009272mg             207   1e-58    
ref|XP_008218232.1|  PREDICTED: uncharacterized protein LOC103318613    207   1e-58    
ref|XP_011005698.1|  PREDICTED: uncharacterized protein LOC105111908    206   2e-58    
ref|XP_006433029.1|  hypothetical protein CICLE_v10001999mg             206   2e-58    
ref|XP_007030623.1|  Uncharacterized protein TCM_026394                 206   3e-58    
ref|XP_002319062.1|  hypothetical protein POPTR_0013s03440g             206   3e-58    Populus trichocarpa [western balsam poplar]
ref|XP_003601156.1|  hypothetical protein MTR_3g076610                  207   4e-58    
ref|XP_009798084.1|  PREDICTED: uncharacterized protein LOC104244370    208   4e-58    
emb|CDX85324.1|  BnaC07g26350D                                          204   5e-58    
ref|XP_010256015.1|  PREDICTED: uncharacterized protein LOC104596517    205   7e-58    
ref|XP_008455804.1|  PREDICTED: uncharacterized protein LOC103495897    205   8e-58    
ref|XP_008802684.1|  PREDICTED: uncharacterized protein LOC103716457    204   8e-58    
ref|XP_004139223.1|  PREDICTED: uncharacterized protein LOC101220430    204   9e-58    
ref|XP_007138005.1|  hypothetical protein PHAVU_009G173000g             206   1e-57    
ref|XP_006645201.1|  PREDICTED: uncharacterized protein LOC102718506    204   1e-57    
ref|XP_008351057.1|  PREDICTED: probable protein phosphatase 2C 14      213   2e-57    
ref|XP_011046236.1|  PREDICTED: uncharacterized protein LOC105140891    205   2e-57    
gb|KGN60826.1|  hypothetical protein Csa_2G011590                       205   2e-57    
ref|XP_008390094.1|  PREDICTED: uncharacterized protein LOC103452380    214   2e-57    
ref|XP_010251033.1|  PREDICTED: uncharacterized protein LOC104593063    204   2e-57    
gb|KHN30960.1|  hypothetical protein glysoja_017497                     204   3e-57    
ref|XP_003522405.1|  PREDICTED: uncharacterized protein LOC100813254    204   3e-57    
ref|XP_004501866.1|  PREDICTED: uncharacterized protein LOC101507...    204   3e-57    
ref|XP_011032437.1|  PREDICTED: uncharacterized protein LOC105131255    203   3e-57    
ref|XP_006581901.1|  PREDICTED: uncharacterized protein LOC100816323    204   3e-57    
ref|XP_002512236.1|  conserved hypothetical protein                     203   4e-57    Ricinus communis
ref|XP_002318087.2|  hypothetical protein POPTR_0012s09090g             204   5e-57    Populus trichocarpa [western balsam poplar]
emb|CDP12711.1|  unnamed protein product                                203   6e-57    
ref|XP_006439940.1|  hypothetical protein CICLE_v10023489mg             203   6e-57    
ref|XP_006838233.1|  hypothetical protein AMTR_s00103p00021650          202   7e-57    
ref|XP_008811744.1|  PREDICTED: uncharacterized protein LOC103722827    202   1e-56    
ref|XP_010910592.1|  PREDICTED: uncharacterized protein LOC105036529    201   1e-56    
emb|CAN64151.1|  hypothetical protein VITISV_041021                     202   1e-56    Vitis vinifera
ref|XP_002277386.1|  PREDICTED: uncharacterized protein LOC100267457    202   1e-56    Vitis vinifera
ref|XP_004302026.1|  PREDICTED: uncharacterized protein LOC101296394    201   2e-56    
ref|XP_010546610.1|  PREDICTED: uncharacterized protein LOC104818644    201   2e-56    
ref|XP_008807465.1|  PREDICTED: uncharacterized protein LOC103719825    202   2e-56    
emb|CDY00013.1|  BnaC09g02880D                                          201   2e-56    
ref|XP_002451729.1|  hypothetical protein SORBIDRAFT_04g006760          201   3e-56    Sorghum bicolor [broomcorn]
ref|XP_010674843.1|  PREDICTED: uncharacterized protein LOC104890923    200   5e-56    
ref|XP_009588422.1|  PREDICTED: uncharacterized protein LOC104085995    200   5e-56    
ref|XP_004951552.1|  PREDICTED: uncharacterized protein LOC101772581    200   5e-56    
ref|XP_008221896.1|  PREDICTED: uncharacterized protein LOC103321834    209   5e-56    
ref|XP_003521743.1|  PREDICTED: uncharacterized protein LOC100791607    200   6e-56    
gb|KDP23639.1|  hypothetical protein JCGZ_23472                         200   6e-56    
ref|XP_010649892.1|  PREDICTED: uncharacterized protein LOC100246068    200   6e-56    
ref|XP_007144817.1|  hypothetical protein PHAVU_007G186400g             199   7e-56    
ref|XP_003632331.1|  PREDICTED: uncharacterized protein LOC100853449    199   8e-56    
gb|ACU18448.1|  unknown                                                 199   8e-56    Glycine max [soybeans]
ref|XP_008804337.1|  PREDICTED: uncharacterized protein LOC103717650    199   8e-56    
ref|XP_002322201.2|  hypothetical protein POPTR_0015s09600g             203   1e-55    Populus trichocarpa [western balsam poplar]
ref|XP_009805050.1|  PREDICTED: uncharacterized protein LOC104250176    199   1e-55    
ref|XP_007147151.1|  hypothetical protein PHAVU_006G100000g             199   1e-55    
ref|XP_010277409.1|  PREDICTED: uncharacterized protein LOC104611862    199   2e-55    
gb|EYU22191.1|  hypothetical protein MIMGU_mgv1a010634mg                199   2e-55    
ref|XP_006395009.1|  hypothetical protein EUTSA_v10004720mg             198   2e-55    
ref|XP_010923391.1|  PREDICTED: uncharacterized protein LOC105046501    198   2e-55    
emb|CAN68226.1|  hypothetical protein VITISV_040533                     198   2e-55    Vitis vinifera
ref|XP_004301059.1|  PREDICTED: uncharacterized protein LOC101305476    207   2e-55    
ref|XP_009364535.1|  PREDICTED: uncharacterized protein LOC103954432    198   3e-55    
dbj|BAJ95878.1|  predicted protein                                      197   3e-55    
ref|XP_010932250.1|  PREDICTED: uncharacterized protein LOC105052962    198   5e-55    
ref|XP_010248684.1|  PREDICTED: uncharacterized protein LOC104591523    207   5e-55    
ref|XP_009362927.1|  PREDICTED: uncharacterized protein LOC103952942    197   6e-55    
ref|XP_009151242.1|  PREDICTED: uncharacterized protein LOC103874571    197   7e-55    
ref|XP_008388659.1|  PREDICTED: uncharacterized protein LOC103451015    197   8e-55    
ref|XP_004159590.1|  PREDICTED: uncharacterized protein LOC101232142    197   8e-55    
ref|XP_008345708.1|  PREDICTED: uncharacterized protein LOC103408652    196   1e-54    
ref|XP_003554710.1|  PREDICTED: uncharacterized protein LOC100806479    196   1e-54    
ref|XP_011042397.1|  PREDICTED: uncharacterized protein LOC105138...    196   1e-54    
ref|XP_006347793.1|  PREDICTED: uncharacterized protein LOC102597851    196   1e-54    
ref|XP_011042396.1|  PREDICTED: uncharacterized protein LOC105138...    196   2e-54    
ref|XP_002872306.1|  hypothetical protein ARALYDRAFT_489643             195   2e-54    
ref|XP_009111920.1|  PREDICTED: uncharacterized protein LOC103837313    195   2e-54    
ref|XP_006288375.1|  hypothetical protein CARUB_v10001626mg             195   3e-54    
ref|XP_010041438.1|  PREDICTED: uncharacterized protein LOC104430401    195   3e-54    
ref|XP_004230118.1|  PREDICTED: uncharacterized protein LOC101268432    195   3e-54    
ref|XP_002530041.1|  protein phosphatase 2c, putative                   204   5e-54    Ricinus communis
dbj|BAK05996.1|  predicted protein                                      195   5e-54    
ref|XP_007037767.1|  Uncharacterized protein TCM_014486                 196   5e-54    
ref|XP_010421680.1|  PREDICTED: uncharacterized protein LOC104707100    194   6e-54    
emb|CDY52485.1|  BnaC07g49460D                                          194   6e-54    
gb|KDP26687.1|  hypothetical protein JCGZ_17845                         194   1e-53    
emb|CDM85597.1|  unnamed protein product                                194   1e-53    
emb|CAN61445.1|  hypothetical protein VITISV_024138                     197   1e-53    Vitis vinifera
ref|XP_002466252.1|  hypothetical protein SORBIDRAFT_01g004400          193   1e-53    Sorghum bicolor [broomcorn]
ref|XP_010682310.1|  PREDICTED: uncharacterized protein LOC104897184    202   2e-53    
ref|XP_006650760.1|  PREDICTED: uncharacterized protein LOC102720690    193   2e-53    
ref|XP_003536115.1|  PREDICTED: uncharacterized protein LOC100778089    193   2e-53    
gb|EPS71408.1|  hypothetical protein M569_03349                         193   2e-53    
ref|XP_010090415.1|  hypothetical protein L484_025081                   193   3e-53    
ref|XP_009402136.1|  PREDICTED: uncharacterized protein LOC103986002    192   3e-53    
ref|XP_010100416.1|  hypothetical protein L484_027727                   193   3e-53    
ref|XP_002315660.1|  hypothetical protein POPTR_0010s05770g             193   3e-53    Populus trichocarpa [western balsam poplar]
ref|XP_004495197.1|  PREDICTED: uncharacterized protein LOC101503605    192   3e-53    
ref|NP_001051637.1|  Os03g0806700                                       192   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010550936.1|  PREDICTED: uncharacterized protein LOC104821683    192   4e-53    
ref|XP_003564146.1|  PREDICTED: uncharacterized protein LOC100837549    192   4e-53    
ref|NP_198167.1|  uncharacterized protein                               191   8e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600794.1|  PREDICTED: uncharacterized protein LOC100802...    190   9e-53    
emb|CDP21506.1|  unnamed protein product                                191   1e-52    
ref|XP_010455167.1|  PREDICTED: uncharacterized protein LOC104736806    190   2e-52    
ref|XP_010494083.1|  PREDICTED: uncharacterized protein LOC104771271    190   2e-52    
ref|XP_003556459.1|  PREDICTED: uncharacterized protein LOC100802...    191   2e-52    
ref|NP_001132137.1|  hypothetical protein                               191   2e-52    
ref|XP_009379950.1|  PREDICTED: uncharacterized protein LOC103968448    191   2e-52    
ref|XP_009333930.1|  PREDICTED: uncharacterized protein LOC103926780    191   3e-52    
ref|XP_004143059.1|  PREDICTED: uncharacterized protein LOC101209288    199   3e-52    
ref|XP_008380651.1|  PREDICTED: uncharacterized protein LOC103443554    192   3e-52    
ref|XP_004981359.1|  PREDICTED: uncharacterized protein LOC101774579    189   3e-52    
ref|XP_008444373.1|  PREDICTED: uncharacterized protein LOC103487722    199   4e-52    
ref|XP_002458958.1|  hypothetical protein SORBIDRAFT_03g043380          189   9e-52    
gb|KDP21447.1|  hypothetical protein JCGZ_21918                         189   1e-51    
ref|XP_002884475.1|  hypothetical protein ARALYDRAFT_477757             188   1e-51    
gb|ACU19762.1|  unknown                                                 187   1e-51    
ref|XP_009385461.1|  PREDICTED: uncharacterized protein LOC103972819    188   2e-51    
gb|AFK40643.1|  unknown                                                 188   2e-51    
ref|XP_009792059.1|  PREDICTED: uncharacterized protein LOC104239187    187   3e-51    
gb|AES61262.2|  plant/T24G3-80 protein                                  187   4e-51    
ref|XP_009601952.1|  PREDICTED: uncharacterized protein LOC104097132    187   4e-51    
gb|AFW67285.1|  hypothetical protein ZEAMMB73_929047                    186   5e-51    
emb|CDY59819.1|  BnaA09g51660D                                          191   6e-51    
ref|XP_007050577.1|  Uncharacterized protein isoform 1                  187   6e-51    
ref|XP_002520723.1|  conserved hypothetical protein                     186   6e-51    
ref|NP_566240.1|  uncharacterized protein                               186   7e-51    
ref|NP_001045150.1|  Os01g0909400                                       186   1e-50    
gb|AAM65821.1|  unknown                                                 185   1e-50    
ref|XP_008235299.1|  PREDICTED: uncharacterized protein LOC103334...    186   2e-50    
gb|EEC72003.1|  hypothetical protein OsI_04864                          186   2e-50    
ref|XP_007199427.1|  hypothetical protein PRUPE_ppa026525mg             185   3e-50    
ref|XP_011040513.1|  PREDICTED: uncharacterized protein LOC105136753    185   6e-50    
ref|XP_003564890.1|  PREDICTED: uncharacterized protein LOC100831420    184   7e-50    
gb|AFW70716.1|  hypothetical protein ZEAMMB73_330752                    189   8e-50    
gb|EMT25403.1|  hypothetical protein F775_31443                         183   1e-49    
ref|XP_010419519.1|  PREDICTED: uncharacterized protein LOC104705248    182   1e-49    
ref|XP_004247361.1|  PREDICTED: uncharacterized protein LOC101254730    183   1e-49    
ref|XP_006408140.1|  hypothetical protein EUTSA_v10021255mg             182   2e-49    
emb|CDY50761.1|  BnaAnng10680D                                          182   2e-49    
ref|XP_010463974.1|  PREDICTED: uncharacterized protein LOC104744596    182   2e-49    
ref|XP_008360800.1|  PREDICTED: uncharacterized protein LOC103424495    184   2e-49    
ref|XP_009407751.1|  PREDICTED: uncharacterized protein LOC103990370    182   2e-49    
emb|CDO99050.1|  unnamed protein product                                182   2e-49    
ref|XP_009124203.1|  PREDICTED: uncharacterized protein LOC103849150    182   3e-49    
ref|XP_004301015.1|  PREDICTED: uncharacterized protein LOC101312836    183   3e-49    
ref|XP_006444048.1|  hypothetical protein CICLE_v10021341mg             182   3e-49    
ref|XP_006360806.1|  PREDICTED: uncharacterized protein LOC102583145    182   3e-49    
ref|XP_011026156.1|  PREDICTED: uncharacterized protein LOC105126841    182   3e-49    
ref|XP_006298244.1|  hypothetical protein CARUB_v10014305mg             181   3e-49    
emb|CDY30020.1|  BnaC01g39880D                                          181   4e-49    
ref|XP_007144641.1|  hypothetical protein PHAVU_007G172700g             182   4e-49    
ref|XP_004501867.1|  PREDICTED: uncharacterized protein LOC101507...    180   5e-49    
ref|NP_001167908.1|  hypothetical protein                               181   5e-49    
gb|EAZ04414.1|  hypothetical protein OsI_26558                          180   8e-49    
ref|XP_003591011.1|  hypothetical protein MTR_1g081260                  182   9e-49    
ref|XP_003518919.1|  PREDICTED: uncharacterized protein LOC100793503    181   1e-48    
ref|XP_009408456.1|  PREDICTED: uncharacterized protein LOC103990890    180   1e-48    
ref|XP_007162443.1|  hypothetical protein PHAVU_001G152600g             180   1e-48    
ref|XP_002307590.1|  hypothetical protein POPTR_0005s23240g             180   1e-48    
ref|XP_006604441.1|  PREDICTED: uncharacterized protein LOC100786850    180   2e-48    
ref|XP_009124977.1|  PREDICTED: uncharacterized protein LOC103850026    179   2e-48    
emb|CDY21108.1|  BnaA01g33390D                                          179   2e-48    
emb|CDY72112.1|  BnaC05g52260D                                          179   2e-48    
ref|XP_010485871.1|  PREDICTED: uncharacterized protein LOC104764117    179   3e-48    
ref|XP_002300838.1|  hypothetical protein POPTR_0002s05250g             179   3e-48    
gb|KHN10674.1|  hypothetical protein glysoja_019105                     179   4e-48    
ref|NP_001060057.1|  Os07g0572300                                       178   7e-48    
ref|XP_002987739.1|  hypothetical protein SELMODRAFT_126470             178   9e-48    
ref|XP_002987520.1|  hypothetical protein SELMODRAFT_126257             178   9e-48    
gb|EMT06649.1|  hypothetical protein F775_13550                         177   1e-47    
ref|NP_001143196.1|  uncharacterized protein LOC100275698               177   1e-47    
ref|XP_003536564.1|  PREDICTED: uncharacterized protein LOC100796685    177   1e-47    
gb|KHN03804.1|  hypothetical protein glysoja_011033                     177   2e-47    
gb|EMS52757.1|  hypothetical protein TRIUR3_04572                       175   2e-47    
ref|XP_004495789.1|  PREDICTED: uncharacterized protein LOC101494890    177   2e-47    
ref|XP_003521248.2|  PREDICTED: uncharacterized protein LOC100799355    177   3e-47    
gb|EMS45281.1|  hypothetical protein TRIUR3_16464                       176   3e-47    
gb|EYU30508.1|  hypothetical protein MIMGU_mgv1a010362mg                177   3e-47    
ref|XP_004493685.1|  PREDICTED: uncharacterized protein LOC101510231    177   3e-47    
ref|XP_011079867.1|  PREDICTED: uncharacterized protein LOC105163276    176   6e-47    
ref|XP_004290606.1|  PREDICTED: uncharacterized protein LOC101299...    176   7e-47    
ref|XP_004494682.1|  PREDICTED: uncharacterized protein LOC101496846    176   8e-47    
ref|XP_011090719.1|  PREDICTED: uncharacterized protein LOC105171...    175   8e-47    
gb|ACU20214.1|  unknown                                                 175   8e-47    
ref|XP_008651185.1|  PREDICTED: uncharacterized protein LOC100275...    175   1e-46    
ref|XP_003626413.1|  hypothetical protein MTR_7g114790                  175   1e-46    
ref|XP_006657868.1|  PREDICTED: uncharacterized protein LOC102710887    174   1e-46    
emb|CBI26241.3|  unnamed protein product                                173   2e-46    
ref|XP_011090718.1|  PREDICTED: uncharacterized protein LOC105171...    175   2e-46    
emb|CDP03641.1|  unnamed protein product                                173   2e-46    
ref|XP_011092005.1|  PREDICTED: uncharacterized protein LOC105172319    174   3e-46    
ref|XP_011032694.1|  PREDICTED: uncharacterized protein LOC105131425    173   3e-46    
emb|CBI28703.3|  unnamed protein product                                172   4e-46    
gb|EYU41493.1|  hypothetical protein MIMGU_mgv1a027106mg                173   5e-46    
gb|EEE56506.1|  hypothetical protein OsJ_05776                          174   6e-46    
ref|XP_009370813.1|  PREDICTED: uncharacterized protein LOC103960122    173   6e-46    
emb|CBI34200.3|  unnamed protein product                                171   1e-45    
ref|XP_004955779.1|  PREDICTED: uncharacterized protein LOC101785301    173   1e-45    
ref|XP_010552768.1|  PREDICTED: uncharacterized protein LOC104823045    172   1e-45    
gb|KHN43207.1|  hypothetical protein glysoja_001790                     169   2e-45    
gb|KEH23778.1|  plant/T24G3-80 protein                                  171   4e-45    
ref|XP_003562863.1|  PREDICTED: uncharacterized protein LOC100826732    169   9e-45    
ref|XP_011071576.1|  PREDICTED: uncharacterized protein LOC105156990    170   1e-44    
ref|XP_002460890.1|  hypothetical protein SORBIDRAFT_02g037000          168   2e-44    
ref|XP_008368838.1|  PREDICTED: uncharacterized protein LOC103432425    168   5e-44    
ref|XP_004146978.1|  PREDICTED: uncharacterized protein LOC101203661    168   7e-44    
ref|XP_010228241.1|  PREDICTED: uncharacterized protein LOC100838117    167   1e-43    
ref|XP_004158912.1|  PREDICTED: uncharacterized protein LOC101227560    167   1e-43    
ref|XP_008386487.1|  PREDICTED: uncharacterized protein LOC103448992    166   3e-43    
ref|XP_009367630.1|  PREDICTED: uncharacterized protein LOC103957228    166   4e-43    
ref|XP_010678886.1|  PREDICTED: uncharacterized protein LOC104894363    166   4e-43    
ref|XP_008451346.1|  PREDICTED: uncharacterized protein LOC103492661    166   5e-43    
ref|XP_006851632.1|  hypothetical protein AMTR_s00040p00202330          164   9e-43    
ref|XP_007050578.1|  Uncharacterized protein isoform 2                  162   1e-42    
ref|XP_004958096.1|  PREDICTED: uncharacterized protein LOC101782767    164   1e-42    
gb|EEE55858.1|  hypothetical protein OsJ_04487                          163   3e-42    
gb|EYU45648.1|  hypothetical protein MIMGU_mgv1a010996mg                162   4e-42    
ref|XP_008235300.1|  PREDICTED: uncharacterized protein LOC103334...    160   5e-42    
gb|EEE60141.1|  hypothetical protein OsJ_13031                          160   1e-41    
gb|ACN25495.1|  unknown                                                 159   2e-41    
gb|EPS66867.1|  hypothetical protein M569_07907                         160   4e-41    
gb|KHN33661.1|  hypothetical protein glysoja_013667                     158   4e-41    
gb|ACU18012.1|  unknown                                                 153   5e-40    
ref|NP_001054431.1|  Os05g0108400                                       156   1e-39    
ref|XP_004290607.1|  PREDICTED: uncharacterized protein LOC101299...    151   2e-38    
ref|XP_010070200.1|  PREDICTED: uncharacterized protein LOC104456989    153   3e-38    
ref|XP_008648652.1|  PREDICTED: uncharacterized protein LOC103629261    150   9e-38    
ref|XP_002439125.1|  hypothetical protein SORBIDRAFT_09g000930          151   1e-37    
gb|AEN83173.1|  AT5G28150-like protein                                  146   1e-37    
gb|ADG39151.1|  AT5G28150-like protein                                  145   1e-37    
gb|ADG39148.1|  AT5G28150-like protein                                  145   2e-37    
gb|AFK42653.1|  unknown                                                 149   2e-37    
gb|ACU18452.1|  unknown                                                 146   2e-37    
gb|ADG39149.1|  AT5G28150-like protein                                  145   3e-37    
gb|ADG39150.1|  AT5G28150-like protein                                  143   9e-37    
ref|XP_006648426.1|  PREDICTED: uncharacterized protein LOC102720024    145   1e-36    
gb|ADG39153.1|  AT5G28150-like protein                                  143   1e-36    
ref|XP_004960541.1|  PREDICTED: uncharacterized protein LOC101780495    146   4e-36    
gb|ADG39147.1|  AT5G28150-like protein                                  141   6e-36    
ref|XP_003527779.1|  PREDICTED: uncharacterized protein LOC100783731    144   3e-35    
ref|XP_006827610.1|  hypothetical protein AMTR_s00009p00241020          139   3e-35    
ref|XP_004244888.1|  PREDICTED: uncharacterized protein LOC101262938    144   3e-35    
ref|XP_007136970.1|  hypothetical protein PHAVU_009G089200g             142   9e-35    
ref|XP_011015288.1|  PREDICTED: uncharacterized protein LOC105118926    140   9e-35    
ref|XP_010245551.1|  PREDICTED: uncharacterized protein LOC104589062    142   4e-34    
ref|XP_002268230.1|  PREDICTED: uncharacterized protein LOC100255180    140   5e-34    
ref|XP_006366515.1|  PREDICTED: uncharacterized protein LOC102585370    139   2e-33    
ref|XP_010519647.1|  PREDICTED: uncharacterized protein LOC104799041    140   2e-33    
gb|EYU46571.1|  hypothetical protein MIMGU_mgv1a026066mg                136   4e-33    
ref|XP_010278217.1|  PREDICTED: uncharacterized protein LOC104612487    137   6e-33    
ref|XP_011036648.1|  PREDICTED: uncharacterized protein LOC105134078    139   6e-33    
ref|XP_009393369.1|  PREDICTED: uncharacterized protein LOC103979072    136   1e-32    
ref|XP_008777988.1|  PREDICTED: uncharacterized protein LOC103697828    135   3e-32    
ref|XP_010243783.1|  PREDICTED: uncharacterized protein LOC104587757    135   3e-32    
ref|XP_010912238.1|  PREDICTED: uncharacterized protein LOC105038210    135   3e-32    
ref|XP_003603315.1|  hypothetical protein MTR_3g106250                  135   3e-32    
ref|XP_010654045.1|  PREDICTED: uncharacterized protein LOC100240...    135   3e-32    
ref|XP_010654044.1|  PREDICTED: uncharacterized protein LOC100240...    134   6e-32    
emb|CAN68722.1|  hypothetical protein VITISV_033681                     140   9e-32    
ref|XP_007011756.1|  Uncharacterized protein TCM_036932                 135   1e-31    
gb|KFK25379.1|  hypothetical protein AALP_AA8G105700                    134   1e-31    
ref|XP_003615562.1|  hypothetical protein MTR_5g069550                  129   3e-31    
ref|XP_002285361.1|  PREDICTED: uncharacterized protein LOC100262872    134   3e-31    
ref|XP_009798119.1|  PREDICTED: uncharacterized protein LOC104244407    132   3e-31    
ref|XP_009776174.1|  PREDICTED: uncharacterized protein LOC104225989    133   4e-31    
emb|CAN69699.1|  hypothetical protein VITISV_001515                     133   5e-31    
emb|CDX97072.1|  BnaC09g45530D                                          132   8e-31    
ref|XP_009763939.1|  PREDICTED: uncharacterized protein LOC104215749    130   9e-31    
ref|XP_009598887.1|  PREDICTED: uncharacterized protein LOC104094627    130   1e-30    
ref|XP_006450316.1|  hypothetical protein CICLE_v10008624mg             132   1e-30    
emb|CDX69793.1|  BnaA10g21420D                                          132   1e-30    
ref|XP_004138846.1|  PREDICTED: uncharacterized protein LOC101205493    130   2e-30    
ref|XP_004501367.1|  PREDICTED: uncharacterized protein LOC101507611    130   2e-30    
ref|XP_009122005.1|  PREDICTED: uncharacterized protein LOC103846761    132   2e-30    
ref|XP_006399599.1|  hypothetical protein EUTSA_v10015286mg             131   2e-30    
ref|XP_007015933.1|  Uncharacterized protein TCM_041499                 129   2e-30    
ref|XP_008445586.1|  PREDICTED: uncharacterized protein LOC103488566    130   2e-30    
emb|CAN62312.1|  hypothetical protein VITISV_018204                     135   2e-30    
ref|XP_010275153.1|  PREDICTED: uncharacterized protein LOC104610298    129   2e-30    
ref|XP_003553754.1|  PREDICTED: uncharacterized protein LOC100780249    129   3e-30    
gb|KGN62983.1|  hypothetical protein Csa_2G382560                       130   3e-30    
ref|XP_010048907.1|  PREDICTED: uncharacterized protein LOC104437620    130   4e-30    
ref|XP_010036729.1|  PREDICTED: uncharacterized protein LOC104425670    129   4e-30    
gb|KCW48363.1|  hypothetical protein EUGRSUZ_K02075                     129   4e-30    
ref|XP_010453134.1|  PREDICTED: uncharacterized protein LOC104735112    130   5e-30    
emb|CDP06975.1|  unnamed protein product                                128   7e-30    
ref|XP_007030630.1|  Sulfate/thiosulfate import ATP-binding prote...    129   7e-30    
ref|XP_004160786.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    128   8e-30    
ref|XP_006289029.1|  hypothetical protein CARUB_v10002414mg             129   9e-30    
ref|NP_196661.1|  uncharacterized protein                               129   9e-30    
ref|XP_009415663.1|  PREDICTED: uncharacterized protein LOC103996465    128   1e-29    
gb|KDP33539.1|  hypothetical protein JCGZ_07110                         129   1e-29    
ref|XP_002512243.1|  conserved hypothetical protein                     128   1e-29    
ref|XP_002515453.1|  conserved hypothetical protein                     128   1e-29    
ref|XP_009379778.1|  PREDICTED: uncharacterized protein LOC103968343    127   1e-29    
ref|XP_010265675.1|  PREDICTED: uncharacterized protein LOC104603360    129   2e-29    
ref|XP_002324318.2|  hypothetical protein POPTR_0018s02290g             129   2e-29    
ref|XP_002873490.1|  hypothetical protein ARALYDRAFT_909057             129   2e-29    
ref|XP_010093199.1|  hypothetical protein L484_008981                   126   3e-29    
ref|XP_008241288.1|  PREDICTED: uncharacterized protein LOC103339729    126   4e-29    
ref|XP_010033684.1|  PREDICTED: uncharacterized protein LOC104422917    127   4e-29    
gb|KDO61039.1|  hypothetical protein CISIN_1g021584mg                   126   4e-29    
ref|XP_006433040.1|  hypothetical protein CICLE_v10001704mg             127   4e-29    
ref|XP_009627559.1|  PREDICTED: uncharacterized protein LOC104118085    125   4e-29    
ref|XP_007202844.1|  hypothetical protein PRUPE_ppa014641mg             125   5e-29    
gb|KDO41094.1|  hypothetical protein CISIN_1g019376mg                   126   6e-29    
ref|XP_002533604.1|  conserved hypothetical protein                     125   6e-29    
ref|XP_009390017.1|  PREDICTED: uncharacterized protein LOC103976515    126   6e-29    
ref|XP_010659926.1|  PREDICTED: uncharacterized protein LOC104881414    125   7e-29    
ref|XP_009411978.1|  PREDICTED: uncharacterized protein LOC103993582    125   7e-29    
ref|XP_009619129.1|  PREDICTED: uncharacterized protein LOC104111192    126   9e-29    
ref|XP_011088851.1|  PREDICTED: uncharacterized protein LOC105169985    124   1e-28    
ref|XP_010419653.1|  PREDICTED: uncharacterized protein LOC104705366    126   2e-28    
ref|XP_008377675.1|  PREDICTED: uncharacterized protein LOC103440754    125   2e-28    
ref|XP_006482363.1|  PREDICTED: uncharacterized protein LOC102616904    124   2e-28    
ref|XP_010665861.1|  PREDICTED: uncharacterized protein LOC104883105    125   2e-28    
ref|XP_008378697.1|  PREDICTED: uncharacterized protein LOC103441769    125   2e-28    
ref|XP_006430292.1|  hypothetical protein CICLE_v10012276mg             124   2e-28    
gb|AFK34249.1|  unknown                                                 124   3e-28    
ref|XP_007147150.1|  hypothetical protein PHAVU_006G099900g             124   3e-28    
ref|XP_002312897.2|  hypothetical protein POPTR_0009s15050g             123   4e-28    
ref|XP_004304733.1|  PREDICTED: uncharacterized protein LOC101305965    123   4e-28    
ref|XP_007150100.1|  hypothetical protein PHAVU_005G126700g             123   5e-28    
ref|XP_010541582.1|  PREDICTED: uncharacterized protein LOC104815002    124   5e-28    



>emb|CDP13671.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 233/303 (77%), Gaps = 22/303 (7%)
 Frame = +3

Query  432   MNPRREDQKEAEESATDQS---YVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPS  602
             ++P + +Q+   E+  ++S   +VTCIH A++A L R I ++WSKSL+GH+L I+VENPS
Sbjct  12    LDPEQLEQRRLTEAVANESIENFVTCIHRARLAGLSRDIMVSWSKSLMGHSLHILVENPS  71

Query  603   EDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATG  782
             E+NH TCKIDLKTWQFWGKKGLKSF V + RVDV+WD R AKFSSSPEP SD+YVAL + 
Sbjct  72    EENHSTCKIDLKTWQFWGKKGLKSFKVGERRVDVFWDLRTAKFSSSPEPVSDYYVALVSE  131

Query  783   GEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE  962
              E+V+LLGDQK+EA+KRT+S+P  +DA LVHKKESV+AKRCFCTRTMLG+GKREH+IIIE
Sbjct  132   KELVLLLGDQKTEAYKRTRSKPSPMDAALVHKKESVFAKRCFCTRTMLGKGKREHHIIIE  191

Query  963   TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSS  1142
             + LSGP +PEMWISVDG+ES+R+ NL+WRFRGNET++VD+V V++FWDVHDW++N + S 
Sbjct  192   SALSGPYDPEMWISVDGVESLRIPNLHWRFRGNETLLVDDVPVQIFWDVHDWLYNSNES-  250

Query  1143  VAAGPGVFIFKQgnggkgegeeDNSLPQKSCD-DSQS------RP-----PEFCHVFYAW  1286
                GPG FIF Q   G  E E DN    ++ D D+ S      RP      EFCH  YAW
Sbjct  251   ---GPGTFIFMQ---GTLECEFDNDYGGRNLDHDAPSGENCDLRPEELSCTEFCHFLYAW  304

Query  1287  KTE  1295
              TE
Sbjct  305   MTE  307



>emb|CDP13674.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 233/303 (77%), Gaps = 22/303 (7%)
 Frame = +3

Query  432   MNPRREDQKEAEESATDQS---YVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPS  602
             ++P + +Q+   E+  +++   +VTCIH A++A L R I ++WSKSL+GH+L ++VENPS
Sbjct  12    LDPEQLEQRRLTETVANETIENFVTCIHRARLAGLSRDIIVSWSKSLMGHSLHVLVENPS  71

Query  603   EDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATG  782
             E+NH TCKIDLKTWQFWGKKGLKSF V + RVDV+WD R AKFSSSPEP SD+YVAL + 
Sbjct  72    EENHSTCKIDLKTWQFWGKKGLKSFKVGERRVDVFWDSRTAKFSSSPEPVSDYYVALVSE  131

Query  783   GEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE  962
              E+V+LLGDQK+EA+KRT+S+P  +DA LVHKKESV+AKRCFCTRTMLG+GKREH+IIIE
Sbjct  132   KELVLLLGDQKTEAYKRTRSKPSPMDAALVHKKESVFAKRCFCTRTMLGKGKREHHIIIE  191

Query  963   TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSS  1142
             + LSGP +PEMWISVDG+ES+R+ NL+WRFRGNET++VD+V V++FWDVHDW++N + S 
Sbjct  192   SALSGPYDPEMWISVDGVESLRIPNLHWRFRGNETLLVDDVPVQIFWDVHDWLYNSNES-  250

Query  1143  VAAGPGVFIFKQgnggkgegeeDNSLPQKSCD-DSQS------RP-----PEFCHVFYAW  1286
                GPG FIF Q   G  E E DN    ++ D D+ S      RP      EFCH  YAW
Sbjct  251   ---GPGTFIFMQ---GTLECEFDNDYGGRNLDHDAPSGENCDLRPEELSCTEFCHFLYAW  304

Query  1287  KTE  1295
              TE
Sbjct  305   MTE  307



>ref|XP_010314094.1| PREDICTED: uncharacterized protein LOC101244061 [Solanum lycopersicum]
Length=298

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 225/299 (75%), Gaps = 9/299 (3%)
 Frame = +3

Query  411   SMAQLRPMNPRR-EDQKEAEESATD---QSYVTCIHLAKIADLLRTITITWSKSLIGHAL  578
             S+     MN ++ ED+K+ EE+  +   + + TCI++AKIA +   IT TWSK++  H L
Sbjct  5     SLESEASMNQKQLEDEKQTEETIVNKFGEDFTTCIYVAKIAHIFHAITTTWSKNMTSHTL  64

Query  579   SIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSD  758
              I+VE+ SE+ H+TCKIDLK+WQFWGKKGLKSF V ++R D+YWD R+AKFS+ PEP SD
Sbjct  65    DIIVEHLSEERHFTCKIDLKSWQFWGKKGLKSFRVGEKRTDIYWDLRSAKFSTRPEPVSD  124

Query  759   FYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK  938
             +YVAL + G++V+L+GDQ  EAFKRTKS P ++DA+L+HKKE++YAK+CFCTRTMLG+GK
Sbjct  125   YYVALVSEGDMVLLIGDQNKEAFKRTKSLPAMLDASLLHKKETIYAKKCFCTRTMLGQGK  184

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDW  1118
             ++H+I IE+ LSGP++P M ISV+G  ++R+ NL+WRFRGNE V +DNV VE+FWDVHDW
Sbjct  185   KQHDITIESVLSGPSDPAMQISVNGTVAIRIANLHWRFRGNEKVFLDNVPVEIFWDVHDW  244

Query  1119  MFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             ++    S    GPG FIFKQG   +   + + ++  ++C D QS   EFCH  YAWKTE
Sbjct  245   LY----SGPNYGPGSFIFKQGKLEERYSDSETNINDENC-DLQSPCTEFCHFLYAWKTE  298



>ref|XP_009763291.1| PREDICTED: uncharacterized protein LOC104215233 [Nicotiana sylvestris]
Length=302

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 219/306 (72%), Gaps = 16/306 (5%)
 Frame = +3

Query  414   MAQLRPMNPRREDQKEAEESATDQS--------YVTCIHLAKIADLLRTITITWSKSLIG  569
             M +L+  +    +QK+ E++ T+++        +VTCI++AK+A     IT TWSK+L  
Sbjct  1     MIKLQLESEAFMNQKQLEKNPTEETVIHKFGEDFVTCIYVAKVAKNFHAITTTWSKNLTS  60

Query  570   HALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEP  749
             H L IVVEN SE+ H+TCKIDLK+WQFWGKKG KSF V ++R D+YWD R+AKFSS PEP
Sbjct  61    HTLYIVVENLSEETHFTCKIDLKSWQFWGKKGFKSFKVGEKRADIYWDLRSAKFSSRPEP  120

Query  750   DSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLG  929
              SD+YVAL + GE+++LLGDQ  EAFKRTKSRP ++D  LVHKKE+VYAK+ FCTRTMLG
Sbjct  121   VSDYYVALVSEGEMILLLGDQNKEAFKRTKSRPALMDVVLVHKKETVYAKKYFCTRTMLG  180

Query  930   RGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDV  1109
             +GK++H+I IE  +SGP++P MWISVDG  S+R+ NL+WRFRGNETV VDNV VE+FWDV
Sbjct  181   QGKKQHDITIECVISGPSDPAMWISVDGTVSIRITNLHWRFRGNETVFVDNVPVEIFWDV  240

Query  1110  HDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNS----LPQKSCDDSQSRPPEFCHVF  1277
             HDW++    S   +GPG FIFKQ N G G+ E   S           D QS   EF +  
Sbjct  241   HDWLY----SGPHSGPGTFIFKQDNNGSGKLERKYSNFEGYISDGSSDLQSACTEFWYFL  296

Query  1278  YAWKTE  1295
             YAWK E
Sbjct  297   YAWKIE  302



>ref|XP_011097721.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
 ref|XP_011097722.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
Length=295

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/299 (54%), Positives = 220/299 (74%), Gaps = 13/299 (4%)
 Frame = +3

Query  423   LRPMNPRREDQKEAEESATD---QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVE  593
             L P  P    Q+ A++  T+   +++VTCIH AK+ D++  IT+TW+K++IGH+L I VE
Sbjct  2     LEPSVPTTLVQQPADDPTTNKPAENFVTCIHKAKLVDIVCNITVTWAKTVIGHSLYITVE  61

Query  594   NPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVAL  773
             NP +DN+YTCKIDLKTWQFWGKKGLK+F V ++R+DV+WD R+AKF+ SPEPDSD+YVA+
Sbjct  62    NPQDDNYYTCKIDLKTWQFWGKKGLKTFRVAEKRIDVFWDLRSAKFTDSPEPDSDYYVAM  121

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
              +  E+++LLGDQ+ EA +RTKSR P  DA+LV KKE V+AK+CFCT+T LG+ K EH+I
Sbjct  122   VSREELILLLGDQQKEALRRTKSRLPSEDASLVQKKEIVFAKKCFCTKTTLGQDK-EHSI  180

Query  954   IIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
             IIE+ LSGP +PEMWISVDG+ES+RV NL+WRFRGNET++VDN  V++ WDVHDW++N +
Sbjct  181   IIESSLSGPYDPEMWISVDGMESIRVPNLHWRFRGNETILVDNSPVQILWDVHDWLYNGN  240

Query  1134  SSSVAAGPGVFIFKQgnggkgegeeD---NSLPQKSCDDSQSRPPE--FCHVFYAWKTE  1295
              S    G G+F+F++          +       +   D  + +P    FCH  YAWKTE
Sbjct  241   HS----GVGIFVFRRDADEGEFHSSNIEAEDFGKSFWDVLEEQPSSVGFCHFLYAWKTE  295



>gb|EYU33727.1| hypothetical protein MIMGU_mgv1a0262881mg, partial [Erythranthe 
guttata]
Length=302

 Score =   327 bits (839),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 196/244 (80%), Gaps = 4/244 (2%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCK  626
             +D      +    ++VTCIH  K+ + +  +T+TW+K+LI H L I VENP ++NHYTCK
Sbjct  23    DDPASTNNNKPAHNFVTCIHKVKLGETICHVTVTWAKTLISHTLYITVENPLDENHYTCK  82

Query  627   IDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLG  806
             IDLKTWQFWGKKGLK+F V ++RVDV+WD R+AKF++SPEP+SD+YVA+ +  EVV+LLG
Sbjct  83    IDLKTWQFWGKKGLKTFRVAEKRVDVFWDLRSAKFATSPEPNSDYYVAMVSDQEVVLLLG  142

Query  807   DQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTE  986
             DQK+EA +RTKSRP + D++LVHKKE V+A++CFCT+T LG+ K+EH+IIIE+ L GP +
Sbjct  143   DQKNEALRRTKSRPSLQDSSLVHKKEIVFARKCFCTKTTLGKSKKEHSIIIESALCGPYD  202

Query  987   PEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             PEMWISVDG+ES+RV NL+WRFRGNET++VD+  V++ WDVHDW++N   S    G G+F
Sbjct  203   PEMWISVDGMESIRVPNLHWRFRGNETIVVDDFPVQILWDVHDWLYNGTHS----GVGIF  258

Query  1167  IFKQ  1178
             +F++
Sbjct  259   VFRR  262



>ref|XP_007020399.1| Uncharacterized protein TCM_030574 [Theobroma cacao]
 gb|EOY11924.1| Uncharacterized protein TCM_030574 [Theobroma cacao]
Length=302

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/290 (54%), Positives = 199/290 (69%), Gaps = 9/290 (3%)
 Frame = +3

Query  438   PRREDQKEAEESATD--QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDN  611
             P +E QKE + +  +  Q  VT I+ A IAD  R +T TW KSL+ H+ +I VENPS+D 
Sbjct  18    PSKEKQKENQGTTDNAAQCSVTSIYHAHIADSSRKVTATWCKSLVNHSFTINVENPSDDQ  77

Query  612   -HYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
                TCKIDLK WQFWG+KGLKS  VD +RVDVYWDFR AKFS SPEP SD+YVA+ +  E
Sbjct  78    CPCTCKIDLKAWQFWGRKGLKSLEVDGQRVDVYWDFRQAKFSGSPEPCSDYYVAIVSEEE  137

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             V +++GD K++AFKRTK RP +VDA L+ KKE +  K+ FC++  L  GK E++I+IE  
Sbjct  138   VALVVGDMKTDAFKRTKKRPSLVDAILLCKKEHICGKKLFCSKAKLNEGKHENDIMIENS  197

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
             LSGP +PEMW+S+DG   +R+MNL+WRFRGNE V V+N  V++FWDVHDW++N   SS  
Sbjct  198   LSGPDDPEMWVSIDGTAVIRIMNLHWRFRGNEIVTVNNTPVQIFWDVHDWLYNTSGSS--  255

Query  1149  AGPGVFIFKQgng-gkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                G+FIF  G        + D      S  DSQS  P FC+V YAWKTE
Sbjct  256   --HGLFIFTPGVPDSAAHCDSDGCNTYDSPRDSQSV-PRFCYVLYAWKTE  302



>ref|XP_007206363.1| hypothetical protein PRUPE_ppa017788mg, partial [Prunus persica]
 gb|EMJ07562.1| hypothetical protein PRUPE_ppa017788mg, partial [Prunus persica]
Length=271

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 189/275 (69%), Gaps = 6/275 (2%)
 Frame = +3

Query  474   ATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY-TCKIDLKTWQF  650
             A  QS +T ++  K+A+L   +T TW K+   H+L I +E P ++N   TCK+DL + QF
Sbjct  2     AAPQSAITYVYQVKLAELYCNVTATWCKNHTSHSLCITMEKPCQNNQCCTCKVDLNSCQF  61

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             WGKKGLKSF VD  RVDVYWDFR AKFSS+PEP SD+YVAL +  EVV+LLGD   +A+K
Sbjct  62    WGKKGLKSFEVDGRRVDVYWDFRQAKFSSTPEPCSDYYVALVSKQEVVLLLGDLMEDAYK  121

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RT+SR    DA L++KKE+V  KR FCT+ ML  GK+EH+I+IET LSGP EPEMWIS+D
Sbjct  122   RTRSRASSEDAKLMYKKENVSGKRLFCTKAMLEEGKKEHDIVIETSLSGPDEPEMWISID  181

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg  1190
             G  ++++MNL+WRFRGNETVM+++V VE+FWDVHDW+F    SS+    G FIFK     
Sbjct  182   GTVAIQIMNLHWRFRGNETVMLNDVPVEIFWDVHDWLF----SSLGTSHGFFIFKPSRLD  237

Query  1191  kgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                     S    S   S S    FCH  YAWKTE
Sbjct  238   GDYSSGSPS-QYNSPKGSSSPTTGFCHFLYAWKTE  271



>ref|XP_006452672.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
 gb|ESR65912.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
Length=292

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 198/292 (68%), Gaps = 17/292 (6%)
 Frame = +3

Query  417   AQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN  596
             A+  P + +RED+   + S   QS++  I+ AKIA   R IT+TWSK+L+ H L   VEN
Sbjct  15    AKPPPSSTKREDRVANKAS---QSWLILIYQAKIAHFFRKITVTWSKNLVNHYLCFNVEN  71

Query  597   PSEDNH-YTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVAL  773
             P +D H YT K DLK  QFW KKGLK+F +D +R  VYWDFR AKFSS+P P SD+YVA+
Sbjct  72    PYDDQHPYTFKTDLKASQFWNKKGLKNFEIDGKRAFVYWDFRQAKFSSNPAPSSDYYVAV  131

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
                 E+V+LLGD  ++A+KRTK RP   +ATL+ KKE+VY K+ FCTR +LG GK EH+I
Sbjct  132   VYEDEIVLLLGDSPNDAYKRTKKRPTFPEATLLCKKENVYGKKLFCTRALLGDGKEEHDI  191

Query  954   IIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
             +IE  L GP +PEMWIS+DGI ++R++NLNWRFRGNET+ +++ +++++WDVHDW+FN+ 
Sbjct  192   VIENSLFGPGDPEMWISIDGISTIRILNLNWRFRGNETISMNDTSIQIYWDVHDWLFNES  251

Query  1134  SSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWK  1289
             S S     G+FIFK             S   K  DDS      FCHV YA K
Sbjct  252   SPSY----GLFIFKPNTIECA------SSANKENDDSIQ---GFCHVLYALK  290



>gb|KDO59224.1| hypothetical protein CISIN_1g036500mg [Citrus sinensis]
Length=292

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 199/292 (68%), Gaps = 17/292 (6%)
 Frame = +3

Query  417   AQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN  596
             A+  P + +RED+   + S   QS++  I+ AKIAD  R IT+TWSK+L+ H L   VEN
Sbjct  15    AKPPPSSTKREDRVANKAS---QSWLILIYQAKIADFFRKITVTWSKNLVNHYLCFNVEN  71

Query  597   PSEDNH-YTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVAL  773
             P +D H YT K DLK  QFW KKGLK+F +D +R  VYWDFR AKFSS+P P SD+YVA+
Sbjct  72    PYDDQHPYTFKTDLKASQFWNKKGLKNFEIDGKRAFVYWDFRQAKFSSNPAPSSDYYVAI  131

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
                 E+V+LLGD  ++A+KRTK RP   +ATL+ KK++VY K+ FCTR +LG GK EH+I
Sbjct  132   VYEDEIVLLLGDSLNDAYKRTKKRPTFPEATLLCKKQNVYGKKLFCTRALLGDGKEEHDI  191

Query  954   IIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
             +IE  L GP +PEMWIS+DGI ++R++NLNWRFRGNET+ +++ +++++WDVHDW+FN+ 
Sbjct  192   VIENSLFGPGDPEMWISIDGIWTIRILNLNWRFRGNETISMNDTSIQIYWDVHDWLFNES  251

Query  1134  SSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWK  1289
             S S     G+FIFK             S   K  DDS      FCHV YA K
Sbjct  252   SPSY----GLFIFKPNTIECA------SSANKENDDSIQ---GFCHVLYALK  290



>ref|XP_010644630.1| PREDICTED: uncharacterized protein LOC100852612 [Vitis vinifera]
Length=308

 Score =   299 bits (766),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 184/240 (77%), Gaps = 4/240 (2%)
 Frame = +3

Query  456   KEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDL  635
             K+   +  ++S  T ++ AK+ADL   + +TW KSLI H+LSI VENPS +NH+TCKIDL
Sbjct  24    KDHPRNKCEESSTTSVYQAKVADLSCKVNVTWCKSLIDHSLSIHVENPSAENHHTCKIDL  83

Query  636   KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQK  815
                 FW KKGLKSF +D++RVD +WDFR  KFS+SPEP SD+Y+A+ +  EVV+LLGD K
Sbjct  84    DILHFWNKKGLKSFEIDEKRVDFFWDFREVKFSNSPEPCSDYYLAMVSNKEVVLLLGDLK  143

Query  816   SEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEM  995
             +EA+KRT S+P + +ATLV+KKE+VY KR FCT+  LG GK+EH+I+IE  +SG  +PE+
Sbjct  144   NEAYKRTNSKPSLEEATLVYKKENVYGKRLFCTKAKLGEGKKEHDIVIENAVSGFGDPEI  203

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             WIS DGI  +RVMNL+WRFRGNETV ++N+ +++FWDVHDW+FN    S + G  +FIFK
Sbjct  204   WISADGIVLIRVMNLHWRFRGNETVFLNNLPIQIFWDVHDWLFN----SPSLGHALFIFK  259



>ref|XP_008353192.1| PREDICTED: uncharacterized protein LOC103416744 [Malus domestica]
Length=318

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 202/310 (65%), Gaps = 26/310 (8%)
 Frame = +3

Query  429   PMNPRRED---QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP  599
             P +P  E    +KE ++SA  QS VT ++ AK+A+L   +T TW K+L  H+L I VE P
Sbjct  14    PKSPSSEKVCKEKEKDKSAP-QSAVTYVYQAKVAELCCNVTATWCKNLTSHSLCITVEKP  72

Query  600   SEDNHY-TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALA  776
              + N   TCKIDL + QFWGKKGLKSF VD  RVDVYWDFR AKFS +PEP S++YVAL 
Sbjct  73    CQQNQCCTCKIDLSSTQFWGKKGLKSFEVDGRRVDVYWDFRQAKFSCTPEPCSNYYVALV  132

Query  777   TGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNII  956
             +  EVV+LLGD   +A+KRT+SR    +A L++KKE+V  K  FCT+ ML  G++EH+I+
Sbjct  133   SKQEVVLLLGDLMEDAYKRTRSRSSSEEARLMYKKENVCGKGLFCTKAMLEEGRKEHDIV  192

Query  957   IETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDS  1136
             IET LSGP +PEMWISVDG  ++R+MNLNWRFRGN+TVM++++ VE+FWDVHDW+F    
Sbjct  193   IETLLSGPKDPEMWISVDGTVAIRIMNLNWRFRGNKTVMLNDMPVEIFWDVHDWLF----  248

Query  1137  SSVAAGPGVFIFKQgng------------gkgegeeDNSLPQKSCDD-----SQSRPPEF  1265
             SS+    G FIFK G               +       SL    C+      S S    F
Sbjct  249   SSLGTSQGFFIFKAGTVDWESSNINYDYGSRNGNCSSCSLQHSPCNSPKGKGSSSNIGGF  308

Query  1266  CHVFYAWKTE  1295
             CH  YAWKTE
Sbjct  309   CHFLYAWKTE  318



>ref|XP_006418603.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
 gb|ESQ37039.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
Length=303

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 193/282 (68%), Gaps = 13/282 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC++   I+   R +T+ WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCMYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+ +SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFSTRARFYDRKKEHEIIVESSISGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    SS   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SSPGTGHGLFIFKPGTNEDS  261

Query  1176  -QgnggkgegeeDNSLPQK-SCDDSQSRPPEFCHVFYAWKTE  1295
                  G G GE D S+  +     S S PPEFC   YAWK E
Sbjct  262   DMEGSGHGGGESDTSIGSRYYSTKSSSWPPEFCLFLYAWKLE  303



>gb|KFK31798.1| hypothetical protein AALP_AA6G160300 [Arabis alpina]
Length=310

 Score =   294 bits (752),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 192/289 (66%), Gaps = 20/289 (7%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+   IA   R +TI WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHIAGFWRNVTILWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG K+F V+   V+VYWDFR+AKF+SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKTFEVEGNPVEVYWDFRSAKFASSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWISVDGI
Sbjct  146   KSRPALVEAALFYKKETVFGKKCFSTRAKFYDKKKEHEIIVESSTSGPKEPEMWISVDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SAPGTGHGLFIFKPGTVEEN  261

Query  1176  ---------QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                       G GG G   + ++  +     S S PPEFC   YAWK E
Sbjct  262   DMEGSGHGGGGGGGGGGESDTSTWSRYYSTKSGSWPPEFCLFLYAWKLE  310



>gb|KHN23821.1| hypothetical protein glysoja_028114 [Glycine soja]
Length=308

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 204/309 (66%), Gaps = 13/309 (4%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATD--QSYVTCIHLAKIADLLRTITITWSKSLI  566
             M    + +A   P + ++   K+ +    D  QS+VT ++  K+A+LLR+ITI+W K  I
Sbjct  1     MEEESVMLAIPEPHSKKKTTCKDNKAMKIDAPQSFVTFVYQTKVAELLRSITISWCKDPI  60

Query  567   GHALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFS-SSP  743
              H LS+ V+N  E+N YTCKIDL + Q WGKKGL+SF +   RVD++WDFR A+FS +SP
Sbjct  61    DHFLSMSVDNTLEENKYTCKIDLGSGQSWGKKGLRSFEIAGVRVDIFWDFRRAEFSATSP  120

Query  744   EPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTM  923
             +P S +YVAL    EV++LLGD + +AF+RTKS+P + +ATL+ K+++VY K+ FCTR +
Sbjct  121   QPCSGYYVALVYKKEVLLLLGDLEKDAFERTKSKPSLDEATLLCKRDNVYGKKMFCTRAI  180

Query  924   LGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFW  1103
             L  GK EH+++IET LSGP +PEMWI++DG+ + R+MNL+WRFRGNE VMV+N  V++FW
Sbjct  181   LEDGKIEHDVVIETSLSGPDDPEMWINIDGMLASRIMNLHWRFRGNEIVMVNNFPVQIFW  240

Query  1104  DVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPE-------  1262
             DVHDW+F +D   +  GP  F+FK               P++    S+    E       
Sbjct  241   DVHDWLFTND---LGLGPAFFVFKPVFLETTSDFNSIECPERGGGSSKHELLEDNSSTQG  297

Query  1263  FCHVFYAWK  1289
             FCH  YAW+
Sbjct  298   FCHYLYAWR  306



>ref|XP_002883629.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59888.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 187/283 (66%), Gaps = 14/283 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+++ H+L ++V N   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNVMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               ++V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK G     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----STPGTGHGLFIFKPGTTEDS  261

Query  1197  egeeDNSLPQK----------SCDDSQSRPPEFCHVFYAWKTE  1295
             + E                  S   S   PPEFC   +AWK E
Sbjct  262   DMEGSGHGGGGSDTSTGSRYYSTKSSNPWPPEFCLFLHAWKLE  304



>ref|XP_011039823.1| PREDICTED: uncharacterized protein LOC105136253 [Populus euphratica]
Length=307

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 191/279 (68%), Gaps = 12/279 (4%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q  VT I+  ++A+LL  +T+TW+K+++  +LSI VENP +++HYTCKID+KTWQFWGKK
Sbjct  33    QISVTYIYTVEVAELLSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             GLKSF VD +RVDVYWDFR AKFS+  EP SD+YVAL    EVV++LGD K +AFKRTK 
Sbjct  93    GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RP + +  L+ KKE+VY KR FC + +  + K EH+++IE  LSG  +PEM I++DG E 
Sbjct  153   RPSLTEPILLCKKENVYGKRSFCAKAVFQKDKTEHDLVIEFSLSGLGDPEMGITIDGFEV  212

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             +RVMNLNWRFRGNE + VD+V V++FWDVHDW+F   S+S     G+FI K      G+ 
Sbjct  213   IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFTGSSTS----HGLFILKPAAEEGGDD  268

Query  1203  eeDNSLPQKSCD--------DSQSRPPEFCHVFYAWKTE  1295
             +  +    +  D        +  S  P F HV  AWK E
Sbjct  269   KVGDGRHCRGNDGGMYDSPKERSSSTPGFFHVINAWKYE  307



>ref|XP_010253022.1| PREDICTED: uncharacterized protein LOC104594441 [Nelumbo nucifera]
Length=326

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 190/296 (64%), Gaps = 26/296 (9%)
 Frame = +3

Query  474   ATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY--TCKIDLKTWQ  647
             ++ Q  V C++ A IA +   + + WSK+L+ H L+I V NPS DNH   +CKIDLK W 
Sbjct  35    SSAQCTVMCVYQASIAGMCYNVHVIWSKNLMNHCLNISVNNPSSDNHQISSCKIDLKPWH  94

Query  648   FWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             FW KKGLKSF V  +RVDV+WD RAAKF SSPEP SD+YVAL +  EVV+LLGD K EA+
Sbjct  95    FWSKKGLKSFEVQGKRVDVFWDLRAAKFESSPEPCSDYYVALVSEEEVVLLLGDHKKEAY  154

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISV  1007
             KRTKSRP + DATL++KK++V+ K+CF TR      ++EH+I++E  ++GP +PEMWIS+
Sbjct  155   KRTKSRPSLADATLIYKKDNVFGKKCFATRAKFDERRKEHDIVVEISITGPKDPEMWISI  214

Query  1008  DGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK----  1175
             DGI  + V NL W+FRGNET+ V+ + V+VFWDVHDW+F    S    G G+FIFK    
Sbjct  215   DGIVLIHVTNLQWKFRGNETIRVNTIPVQVFWDVHDWLF----SGQPTGHGLFIFKPAPH  270

Query  1176  -------QgnggkgegeeDNSLPQKSCDD------SQSRP---PEFCHVFYAWKTE  1295
                           +     +   +S D       SQSRP    +FC   YAWK E
Sbjct  271   DYDSDLDHDKDAGSDSGSQGAGGSESGDSGYYSTYSQSRPSSTSDFCLFLYAWKLE  326



>gb|ABK28164.1| unknown [Arabidopsis thaliana]
Length=308

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 191/286 (67%), Gaps = 17/286 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V N   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF+V+   V+VYWDFR+AKF+SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFDVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg--  1190
               ++V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S    G G+FIFK G     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SMPGTGHGLFIFKPGTTEDS  261

Query  1191  ---------kgegeeDNSLPQK--SCDDSQSRPPEFCHVFYAWKTE  1295
                       G GE D S   +  S   S   PPEFC   +A+K E
Sbjct  262   DMEGSGHGGGGGGESDTSTGSRYYSTKSSNPWPPEFCLFLHAYKLE  307



>ref|NP_178505.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD27916.2| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15482.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABE65426.1| hypothetical protein At2g04220 [Arabidopsis thaliana]
 gb|AEC05808.1| uncharacterized protein AT2G04220 [Arabidopsis thaliana]
Length=307

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 191/286 (67%), Gaps = 17/286 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V N   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF+V+   V+VYWDFR+AKF+SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFDVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg--  1190
               ++V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S    G G+FIFK G     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SMPGTGHGLFIFKPGTTEDS  261

Query  1191  ---------kgegeeDNSLPQK--SCDDSQSRPPEFCHVFYAWKTE  1295
                       G GE D S   +  S   S   PPEFC   +A+K E
Sbjct  262   DMEGSGHGGGGGGESDTSTGSRYYSTKSSNPWPPEFCLFLHAYKLE  307



>ref|XP_007142451.1| hypothetical protein PHAVU_008G281700g [Phaseolus vulgaris]
 gb|ESW14445.1| hypothetical protein PHAVU_008G281700g [Phaseolus vulgaris]
Length=309

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 201/311 (65%), Gaps = 14/311 (5%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATD----QSYVTCIHLAKIADLLRTITITWSKS  560
             M NS +    L    P    +   ++  T+    Q+ VT ++  K+ + LR++T++W K 
Sbjct  1     MPNSPVKSVMLTVQEPSSRKKTGKDDKITEGDAPQNSVTFVYQTKVGESLRSVTVSWCKD  60

Query  561   LIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSS  740
                H L++ V+N  E+N ++CKIDL++ Q WGKKGL+SF +   RVD+YWD R AKFS+S
Sbjct  61    PTDHFLAMSVDNTLEENKFSCKIDLESGQSWGKKGLRSFEIAGARVDIYWDLRHAKFSTS  120

Query  741   PEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRT  920
             P+P+S +Y+AL    EV++LLGD +++A  RTKS+P   +ATLV K+++VY K+ FCTR 
Sbjct  121   PQPNSGYYIALVYKKEVLLLLGDLENDALVRTKSKPSPEEATLVCKRDNVYGKKMFCTRA  180

Query  921   MLGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVF  1100
             +L  GK EH+++IET LSGP +PEMWI +DG+ + R+MNL+WRFRGNE VMV+N+ V++F
Sbjct  181   ILEDGKTEHDVVIETSLSGPDDPEMWIIIDGMLTSRIMNLHWRFRGNEIVMVNNLPVQIF  240

Query  1101  WDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDS-------QSRPP  1259
             WDVHDW+F +D   +  GP  F+FK G             P+++ D S        S   
Sbjct  241   WDVHDWLFTND---LGPGPAFFVFKPGFLETSSDPISTECPERTGDSSTDELLEENSSST  297

Query  1260  EFCHVFYAWKT  1292
              FCH  YAW+T
Sbjct  298   GFCHFLYAWRT  308



>ref|XP_010488665.1| PREDICTED: uncharacterized protein LOC104766470 [Camelina sativa]
Length=308

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 191/287 (67%), Gaps = 18/287 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDKKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S    G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SKPGTGHGMFIFKPGNGEDS  261

Query  1176  ----QgnggkgegeeDNSLPQK---SCDDSQSRPPEFCHVFYAWKTE  1295
                  G+GG G GE D S       S   S   PPEFC   +AWK E
Sbjct  262   DMEGSGHGGGGGGESDTSTAGSRYYSTKTSNPWPPEFCLFLHAWKLE  308



>emb|CDY00849.1| BnaCnng00490D [Brassica napus]
Length=291

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 187/276 (68%), Gaps = 13/276 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+   I+   R +T+ WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+SSPEP SDFYVAL    EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+ F TR      K+EH I +E+ +SG  EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SAPGTGHGLFIFKP------  255

Query  1197  egeeDNSLPQKS---CDDSQSRPPEFCHVFYAWKTE  1295
                ED+ +  +S      S S PPEFC   YAWK E
Sbjct  256   GTAEDSDMEGRSRYHSTKSGSWPPEFCLFLYAWKLE  291



>emb|CDY27882.1| BnaA07g04720D [Brassica napus]
Length=291

 Score =   288 bits (737),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 187/276 (68%), Gaps = 13/276 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+   I+   R +T+ WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+SSPEP SDFYVAL    EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+ F TR      K+EH I +E+ +SG  EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SAPGTGHGLFIFKP------  255

Query  1197  egeeDNSLPQKS---CDDSQSRPPEFCHVFYAWKTE  1295
                ED+ +  +S      S S PPEFC   YAWK E
Sbjct  256   GNAEDSDMEGRSRYHSTKSGSWPPEFCLFLYAWKLE  291



>ref|XP_010532946.1| PREDICTED: uncharacterized protein LOC104808831 [Tarenaya hassleriana]
Length=303

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 183/283 (65%), Gaps = 14/283 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+   IA   R +TI WSK+L+ H+L+++V +   D  Y CK+DLK W FW 
Sbjct  25    TAQSTVTCIYQTHIAGFWRNVTILWSKNLMNHSLTVMVTSVEGDMDYCCKVDLKPWHFWN  84

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  85    KKGYKSFEVEGNPVEVYWDFRSAKFAGCPEPSSDFYVALVSDEEVVLLLGDCKKKAFKRT  144

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      K+EH I++E+  SGP EPEMWIS+DGI
Sbjct  145   KSRPALVDAALFYKKENVFGKKSFSTRAKFHDRKKEHEIVVESSASGPKEPEMWISIDGI  204

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   ++VFWDV DW+F    SS   G G+FIFK G   + 
Sbjct  205   VLVQVKNLQWKFRGNQTVLVDKQPIQVFWDVFDWLF----SSPGTGHGLFIFKPGAVEES  260

Query  1197  egeeDNSLPQKSCDDSQSR----------PPEFCHVFYAWKTE  1295
             + E          D S             PPEFC   YAWK E
Sbjct  261   DHEGSGHGTGNDSDASNGSRYYSAKSSVWPPEFCLFLYAWKLE  303



>ref|XP_010466979.1| PREDICTED: uncharacterized protein LOC104747105 [Camelina sativa]
Length=308

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 192/287 (67%), Gaps = 18/287 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDEKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----STPGTGHGMFIFKPGNGEDS  261

Query  1176  ----QgnggkgegeeDNSLPQK---SCDDSQSRPPEFCHVFYAWKTE  1295
                  G+GG G GE D S       S   S   PPEFC   +AWK +
Sbjct  262   DMEGSGHGGGGGGESDTSTAGSRYYSTKSSNPWPPEFCLFLHAWKLD  308



>ref|XP_010514327.1| PREDICTED: uncharacterized protein LOC104790300 [Camelina sativa]
Length=305

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 187/284 (66%), Gaps = 15/284 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
              SRP +V+A L +KKE+V++K+CF TR      K+EH II+E+  SGP EPEMWIS+DGI
Sbjct  146   NSRPALVEAALFYKKENVFSKKCFTTRAKFYDKKKEHEIIVESLTSGPKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVSDWLF----STPGTGHGMFIFKPGNGEDS  261

Query  1176  -QgnggkgegeeDNSLPQK---SCDDSQSRPPEFCHVFYAWKTE  1295
                    G GE D S       S   S   PPEFC   +AWK E
Sbjct  262   DMEGSVHGGGESDTSTAGSRYYSTKSSNPWPPEFCLFLHAWKLE  305



>ref|XP_011016815.1| PREDICTED: uncharacterized protein LOC105120349, partial [Populus 
euphratica]
Length=296

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 175/231 (76%), Gaps = 4/231 (2%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q  VT I+  ++A+LL  +T+TW+K+++  +LSI VENP +++HYTCKID+KTWQFWGKK
Sbjct  33    QISVTYIYTVEVAELLSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             GLKSF VD +RVDVYWDFR AKFS+  EP SD+YVAL    EVV++LGD K +AFKRTK 
Sbjct  93    GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RP + +  L+ KKE+VY KR FC + +  + K EH+++IE  LSG  +PEM I++DG E 
Sbjct  153   RPSLTEPILLCKKENVYGKRSFCAKAVFQKDKTEHDLVIEFSLSGLGDPEMGITIDGFEV  212

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             +RVMNLNWRFRGNE + VD+V V++FWDVHDW+F   S+S     G+FI K
Sbjct  213   IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFTGSSTS----HGLFILK  259



>ref|XP_002266988.1| PREDICTED: uncharacterized protein LOC100249414 [Vitis vinifera]
Length=312

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 195/309 (63%), Gaps = 15/309 (5%)
 Frame = +3

Query  396   RNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHA  575
             R    S+    P   R  D+    ++A  QS VTC +   IA   R +TI W K+++ H+
Sbjct  10    RAQSFSIQTSAPPAERVTDEPVTYKTA--QSTVTCAYQTNIAGFWRNVTILWCKNIMNHS  67

Query  576   LSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
             LSI V++   + H+TCKIDLK W FW KKG KSF  D   VDV+WD R+AKFS  PEP +
Sbjct  68    LSITVDSLDGEIHHTCKIDLKPWHFWSKKGYKSFEFDGNPVDVFWDLRSAKFSGGPEPSA  127

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             D+YVAL +  EVV+LLGD K +A+KRTKSRP +VDA   +KKE+V+AK+CF TR      
Sbjct  128   DYYVALVSDEEVVLLLGDHKKKAYKRTKSRPALVDAIQFYKKENVFAKKCFSTRAKFEEK  187

Query  936   KREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHD  1115
             K+EH+I++E+  SGP +PEMWIS+DGI  + V NL W+FRGN+TV+VD + V+VFWDVHD
Sbjct  188   KKEHDIVVESSTSGPRDPEMWISIDGIVLIHVKNLQWKFRGNQTVLVDKLQVQVFWDVHD  247

Query  1116  WMFNDDSSSVAAGPGVFIFK---------QgnggkgegeeDNSLPQKSCDDSQSRPPEFC  1268
             W+F    S+   G G+FIFK         +       G+ D S       ++++  PEF 
Sbjct  248   WLF----SNPGTGHGLFIFKPGAPEADSDRDGDSSRGGDSDTSTGSSRYYNARAAAPEFS  303

Query  1269  HVFYAWKTE  1295
              + YAWK +
Sbjct  304   LLLYAWKID  312



>ref|XP_002532169.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30206.1| conserved hypothetical protein [Ricinus communis]
Length=317

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 198/305 (65%), Gaps = 26/305 (9%)
 Frame = +3

Query  453   QKEAEESATDQ---SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTC  623
             +K+ E+  T++   S VT I+ A +A+  R + +TW+KSLI ++L+I VEN S +NHYTC
Sbjct  15    EKQPEDQPTNKAPHSSVTLIYEANVAEFNRNVIVTWNKSLINYSLTISVENLSNENHYTC  74

Query  624   KIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILL  803
             KIDLKTWQFWG+KGLKSF VD  +VDVYWDFR AKFSS+PEP SD+YVAL    EVV++L
Sbjct  75    KIDLKTWQFWGRKGLKSFPVDGGKVDVYWDFRRAKFSSNPEPSSDYYVALVYEEEVVLML  134

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK---REHNIIIETDLS  974
             GD K +A++RTK RP + +  L+ KKE+VY K+ FCT+ ML  G    REH+I+IE   S
Sbjct  135   GDSKKDAYRRTKKRPSMFEPILLCKKENVYGKKIFCTKAMLHLGNEEHREHDIVIEMS-S  193

Query  975   GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
             G  +PE+WIS+D  E   V NL+WRFRGNE V+++NV +++FWDVHDW+F   +S   +G
Sbjct  194   GLGDPELWISIDSFEVTHVKNLHWRFRGNEKVIMNNVVIDIFWDVHDWLFGSPASQ-TSG  252

Query  1155  PGVFIFKQgnggkgegeeDN------------------SLPQKSCDDSQSRPPEFCHVFY  1280
              G+FIFK G        + N                   L   S  +  +    F HV Y
Sbjct  253   HGLFIFKPGELDYQPDSDTNRNRNTSRNGNNVLFEDKLGLGYDSSSEIWTPSSGFFHVVY  312

Query  1281  AWKTE  1295
             AWK E
Sbjct  313   AWKLE  317



>ref|XP_002300574.2| hypothetical protein POPTR_0001s47170g [Populus trichocarpa]
 gb|EEE85379.2| hypothetical protein POPTR_0001s47170g [Populus trichocarpa]
Length=309

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 174/231 (75%), Gaps = 4/231 (2%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q  VT I+  ++A+L   +T+TW+K+++  +LSI VENP +++HYTCKID+KTWQFWGKK
Sbjct  33    QISVTYIYTVEVAELRSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             GLKSF VD +RVDVYWDFR AKFS+  EP SD+YVAL    EVV++LGD K +AFKRTK 
Sbjct  93    GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RP + +  L+ KKE+VY KR FC + M    K EH+++IE  LSG  +PEM I+VDG E 
Sbjct  153   RPSLTEPILLCKKENVYGKRSFCAKAMFQNDKTEHDLVIEFSLSGLGDPEMGITVDGFEV  212

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             +RVMNLNWRFRGNE + VD+V V++FWDVHDW+F+  S+S     G+FI K
Sbjct  213   IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFSGSSTS----HGLFILK  259



>ref|XP_006299727.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
 gb|EOA32625.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
Length=306

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 187/285 (66%), Gaps = 16/285 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A I+   R +T+ WSK+L+ H+L ++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF SSPEP SDFYVAL +  EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFMSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L  KKE+V+ K+CF TR      K+EH I +E+  SG  EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFCKKENVFGKKCFTTRAKFYDKKKEHEINVESSTSGSKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGNETV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNETVLVDKQPVQVFWDVYDWLF----STPGTGHGMFIFKPGNAEDI  261

Query  1176  ---QgnggkgegeeDNSLPQK--SCDDSQSRPPEFCHVFYAWKTE  1295
                    G G GE D S   K  S   S   PPEFC   +AWK E
Sbjct  262   DMEGSGHGGGGGESDTSTANKNYSTKSSNPWPPEFCLFLHAWKLE  306



>ref|XP_009102402.1| PREDICTED: uncharacterized protein LOC103828543 [Brassica rapa]
Length=302

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/281 (52%), Positives = 187/281 (67%), Gaps = 12/281 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+   I+   R +T+ WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF+SSPEP SDFYVAL    EVV+L+GD K +AFKRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+V+ K+ F TR      K+EH I +E+ +SG  EPEMWIS+DGI
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-------  1175
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLF----SAPGTGHGLFIFKPGNAEDS  261

Query  1176  QgnggkgegeeDNSLPQK-SCDDSQSRPPEFCHVFYAWKTE  1295
                G    GE D S   +     S S PPEFC   YAWK E
Sbjct  262   DMEGSGHGGESDTSTGSRYHSTKSGSWPPEFCLFLYAWKLE  302



>ref|XP_010107360.1| hypothetical protein L484_006875 [Morus notabilis]
 gb|EXC15611.1| hypothetical protein L484_006875 [Morus notabilis]
Length=299

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 189/276 (68%), Gaps = 9/276 (3%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC+++A I+   R +T+TW K+L+ H  SI V +   D H +CKIDLK W FW 
Sbjct  30    TAQSTVTCVYMANISGFWRKVTVTWCKNLMNHFFSITVHSLEGDFHCSCKIDLKPWHFWS  89

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF VD   V+V+WD R+AKFS+ PEP SDFYVAL    EVV+L+GD K +A+KRT
Sbjct  90    KKGYKSFEVDGNTVEVFWDIRSAKFSTGPEPCSDFYVALVCDEEVVLLIGDIKKKAYKRT  149

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A + +KKE+V+AKRCF TR  L   K+E +I++E+  SGP +PEMWISVDGI
Sbjct  150   KSRPALVEAIMFYKKENVFAKRCFSTRARLDERKKECDIVVESSTSGPRDPEMWISVDGI  209

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK---Qgng  1187
               + V NL W+FRGN+TV+V+N  V+VFWDVHDW+F     S   G G+FIFK       
Sbjct  210   VLIHVKNLQWKFRGNQTVLVNNQYVQVFWDVHDWLFG----SPGNGRGLFIFKPGFTEPE  265

Query  1188  gkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
              + EG E+ S+   +  +S S+  EFC   +AWK E
Sbjct  266   SEKEGSENGSVYHSTISNSSSQ--EFCLFLHAWKIE  299



>ref|XP_010103965.1| hypothetical protein L484_020218 [Morus notabilis]
 gb|EXB97668.1| hypothetical protein L484_020218 [Morus notabilis]
Length=1381

 Score =   303 bits (777),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 200/304 (66%), Gaps = 26/304 (9%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQS-YVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN-PSED  608
             NP+  + + A   +  QS  +TC + AK+ ++   +++TW KSL  ++L+I V+   S++
Sbjct  1087  NPKEANNENAHHKSGPQSDMITCFYQAKLGEIFCNVSVTWCKSLTSYSLTIKVDKKASKE  1146

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
             NHYTCKIDLK  QFWGKKGLKSF  D ERVD++WDFR  KFSSSPEP SD+YVAL    E
Sbjct  1147  NHYTCKIDLKNNQFWGKKGLKSFAADGERVDLFWDFRLVKFSSSPEPCSDYYVALVCKEE  1206

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             +V+LLGD +  A KRT++RP +  ATL+HKKE+V  K  FCT  ML  GK+E+ I+IE  
Sbjct  1207  MVLLLGDLEDVACKRTRARPSLEGATLLHKKENVCGKNLFCTNAMLNAGKKENEIVIENS  1266

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
             L GP +PEMWISV+G  ++RVMNLNWRFRGNET+M +NV +++FWDVHDW+F    +S  
Sbjct  1267  LLGPGDPEMWISVEGAVAIRVMNLNWRFRGNETLMANNVPIQIFWDVHDWLF----TSPG  1322

Query  1149  AGPGVFIFKQgnggkge---------------geeDNSLPQKSCDDSQSRPPEFCHVFYA  1283
             +G G+FIFK G+                     + DN  PQ S   +     E+CH  YA
Sbjct  1323  SGHGLFIFKLGSPDSTNTDFYARNCSEVRYNDSKYDNDSPQGSLSTN-----EYCHYLYA  1377

Query  1284  WKTE  1295
             WK E
Sbjct  1378  WKIE  1381



>gb|AET00846.2| kinesin heavy chain, putative [Medicago truncatula]
Length=1462

 Score =   304 bits (778),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 199/291 (68%), Gaps = 10/291 (3%)
 Frame = +3

Query  441   RREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             ++  + +A ++ T  S V  ++  K+ D  R + +TW K+LI H+LS+ VE PSE+N +T
Sbjct  1176  KKSSKHKAIQNLTPHSSVIYVYQTKLGDSFRNVAVTWCKNLIEHSLSMSVEEPSEENKFT  1235

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CKIDL + Q WGKKGLKSF ++  RVDVYWDFR AKFS++P+P S +YVAL    EV++L
Sbjct  1236  CKIDLASGQSWGKKGLKSFEIEGARVDVYWDFRHAKFSTNPQPCSGYYVALVYKKEVLLL  1295

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGP  980
             LGD  ++A+ RTKS+P   +ATL+ KKE+V  K+ FCTR ML  GK EH+++IET LSGP
Sbjct  1296  LGDLTNDAYVRTKSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGP  1355

Query  981   TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              +PEMWIS+DG+ + R+MNLNW+FRGNE VMV+N+ V++FWDVHDW+FND    + +GP 
Sbjct  1356  DDPEMWISIDGMLASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFND----LGSGPA  1411

Query  1161  VFIFK----QgnggkgegeeDNSLPQKSCD--DSQSRPPEFCHVFYAWKTE  1295
             VFIFK    + +        + +    S D  D  S    F H  YAW+ +
Sbjct  1412  VFIFKPGILETDDSNSRECTERNEDSGSYDLVDENSSTKSFLHFLYAWRMD  1462



>ref|XP_003617887.1| Kinesin-4 [Medicago truncatula]
Length=1503

 Score =   304 bits (778),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 199/291 (68%), Gaps = 10/291 (3%)
 Frame = +3

Query  441   RREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             ++  + +A ++ T  S V  ++  K+ D  R + +TW K+LI H+LS+ VE PSE+N +T
Sbjct  1217  KKSSKHKAIQNLTPHSSVIYVYQTKLGDSFRNVAVTWCKNLIEHSLSMSVEEPSEENKFT  1276

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CKIDL + Q WGKKGLKSF ++  RVDVYWDFR AKFS++P+P S +YVAL    EV++L
Sbjct  1277  CKIDLASGQSWGKKGLKSFEIEGARVDVYWDFRHAKFSTNPQPCSGYYVALVYKKEVLLL  1336

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGP  980
             LGD  ++A+ RTKS+P   +ATL+ KKE+V  K+ FCTR ML  GK EH+++IET LSGP
Sbjct  1337  LGDLTNDAYVRTKSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGP  1396

Query  981   TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              +PEMWIS+DG+ + R+MNLNW+FRGNE VMV+N+ V++FWDVHDW+FND    + +GP 
Sbjct  1397  DDPEMWISIDGMLASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFND----LGSGPA  1452

Query  1161  VFIFK----QgnggkgegeeDNSLPQKSCD--DSQSRPPEFCHVFYAWKTE  1295
             VFIFK    + +        + +    S D  D  S    F H  YAW+ +
Sbjct  1453  VFIFKPGILETDDSNSRECTERNEDSGSYDLVDENSSTKSFLHFLYAWRMD  1503



>ref|XP_010929447.1| PREDICTED: uncharacterized protein LOC105050916 [Elaeis guineensis]
Length=299

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 186/294 (63%), Gaps = 13/294 (4%)
 Frame = +3

Query  441   RREDQKEAEESA---TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDN  611
             R   +K  EE A   T Q  V  I+ A I  L R +T+ WSK+LI H+LS+ VE  + D+
Sbjct  10    RSSSEKHVEEPASNKTAQCSVISIYQANILGLPRNVTVVWSKNLINHSLSVSVEKSNGDS  69

Query  612   HYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEV  791
              +TCK+DLK W FW KKG KSF +D +RVD+YWD R+ KFS+ PEP   +YVALA   EV
Sbjct  70    PFTCKVDLKPWPFWSKKGFKSFEIDGKRVDIYWDLRSVKFSNGPEPSGGYYVALACDEEV  129

Query  792   VILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLG-RGKREHNIIIETD  968
             V+LLGD K EA+KRTK RP +  A LV K+E+V+ K+CF TR     R  +EH+II+E  
Sbjct  130   VLLLGDCKKEAYKRTKCRPALESAALVSKRENVFGKKCFTTRARFDERKTKEHDIIVENS  189

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
             +SG  +PEMWIS+DG+  + V NL W+FRGNETVMV+ V V+VFWDVHDW+F     +  
Sbjct  190   ISGAKDPEMWISIDGVVLIHVDNLQWKFRGNETVMVEKVPVQVFWDVHDWLFG----APG  245

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQ-----SRPPEFCHVFYAWKTE  1295
              G  +FIFK G  G    E+ N     S    Q     S  PEFC    AWKTE
Sbjct  246   TGHALFIFKPGVPGAAAEEDRNGTEGCSSSSGQNGTASSPAPEFCFFLCAWKTE  299



>emb|CBI28480.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 186/300 (62%), Gaps = 33/300 (11%)
 Frame = +3

Query  396   RNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHA  575
             R    S+    P   R  D+    ++A  QS VTC +   IA   R +TI W K+++ H+
Sbjct  10    RAQSFSIQTSAPPAERVTDEPVTYKTA--QSTVTCAYQTNIAGFWRNVTILWCKNIMNHS  67

Query  576   LSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
             LSI V++   + H+TCKIDLK W FW KKG KSF  D   VDV+WD R+AKFS  PEP +
Sbjct  68    LSITVDSLDGEIHHTCKIDLKPWHFWSKKGYKSFEFDGNPVDVFWDLRSAKFSGGPEPSA  127

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             D+YVAL +  EVV+LLGD K +A+KRTKSRP +VDA   +KKE+V+AK+CF TR      
Sbjct  128   DYYVALVSDEEVVLLLGDHKKKAYKRTKSRPALVDAIQFYKKENVFAKKCFSTRAKFEEK  187

Query  936   KREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHD  1115
             K+EH+I++E+  SGP +PEMWIS+DGI  + V NL W+FRGN+TV+VD + V+VFWDVHD
Sbjct  188   KKEHDIVVESSTSGPRDPEMWISIDGIVLIHVKNLQWKFRGNQTVLVDKLQVQVFWDVHD  247

Query  1116  WMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             W+F    S+   G G+FIFK                           PEF  + YAWK +
Sbjct  248   WLF----SNPGTGHGLFIFK---------------------------PEFSLLLYAWKID  276



>ref|XP_011072457.1| PREDICTED: uncharacterized protein LOC105157708 [Sesamum indicum]
Length=309

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 196/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  396   RNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHA  575
             RN  +S +Q +P+  +  +    +++A  QS VTC++   IA   R +TI WSK+L+ ++
Sbjct  8     RNHSMSSSQ-QPLAQKLMNDPVTQKTA--QSMVTCVYQTHIAGFWRNVTIVWSKNLMNYS  64

Query  576   LSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
             LSI VE+   D  Y CKI+LK W FW K+G ++F VD  ++D YWD R+AKFS SPEP S
Sbjct  65    LSISVESIDHDQPYMCKIELKPWHFWAKRGYRTFEVDGHQLDAYWDLRSAKFSGSPEPSS  124

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             DFYVAL +  EVV+LLGD K +A+KRTK RP +V+A + +KKE V+ K+ F TR    + 
Sbjct  125   DFYVALVSEEEVVLLLGDSKKKAYKRTKGRPALVEAVMFYKKEHVFGKKSFSTRAKFDQK  184

Query  936   KREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHD  1115
             KREH I++E+  SGP EPEMWIS+DGI  + + NL W+FRGN+TV+V+   V+VFWDVH 
Sbjct  185   KREHEIVVESSTSGPREPEMWISIDGIVLIHIKNLQWKFRGNQTVLVNKQPVQVFWDVHA  244

Query  1116  WMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFC  1268
             W+F    SS     G+FIFK G        ED +   +S C          S S+  +FC
Sbjct  245   WLFCAPGSS----HGLFIFKPGEPEADSDVEDETRGDESDCSGPSKYYSTLSYSKASQFC  300

Query  1269  HVFYAWKTE  1295
                YAWK E
Sbjct  301   LFLYAWKIE  309



>ref|XP_010542041.1| PREDICTED: uncharacterized protein LOC104815373 [Tarenaya hassleriana]
Length=303

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/283 (51%), Positives = 183/283 (65%), Gaps = 14/283 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC +   IA   R +TI WSK+++ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  25    TAQSTVTCTYQTHIAGFWRNVTILWSKNMLNHSLTVMVTSIEGDMNYCCKVDLKPWNFWN  84

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+   V+VYWDFR+AKF   PEP SDFYVA+ +  EVV+LLGD K +AFKRT
Sbjct  85    KKGYKSFEVEGNPVEVYWDFRSAKFVGGPEPSSDFYVAVVSDEEVVLLLGDCKKKAFKRT  144

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+A L +KKE+ + K+ F TR      K+EH II+E+  SGP +PEMWIS+DGI
Sbjct  145   KSRPALVEAALFYKKENAFGKKSFATRAKFNDRKKEHEIIVESSTSGPKDPEMWISIDGI  204

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD  +V+VFWDV+DW+F    S    G G FIFK G   + 
Sbjct  205   VLVQVRNLQWKFRGNQTVLVDKQSVQVFWDVYDWLF----SPPGTGHGRFIFKPGAVEES  260

Query  1197  egeeDNSLPQKSCDDS-QSR---------PPEFCHVFYAWKTE  1295
             + E          D S  SR         PPEFC   YAWK E
Sbjct  261   DKEGSGHFNGNDSDASIGSRYYSTASSVWPPEFCLFLYAWKLE  303



>ref|XP_010676107.1| PREDICTED: uncharacterized protein LOC104892001 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 201/309 (65%), Gaps = 17/309 (6%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGH  572
             M +SQ + AQ        EDQ   E + + +S VTCI+   +A  LR I ITWSK+   H
Sbjct  1     MPSSQSTPAQKSSSEKLHEDQ---ESNMSTESSVTCIYQVMLAACLRNIIITWSKTSTIH  57

Query  573   ALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQ-ERVDVYWDFRAAKFSSSPEP  749
             +L+I VEN S++NH TC+ID ++ QFW +KGLKS +VD+ +RVD++WDFRA KFS++PEP
Sbjct  58    SLTITVENHSDENHQTCQIDFQSGQFWSRKGLKSLSVDETDRVDIFWDFRAVKFSTNPEP  117

Query  750   DSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLG  929
              S++YVA     +VV+LLGD K EA+KRT  RP  V  TL+HK+E +Y   CF T+ +LG
Sbjct  118   CSNYYVAFVFDKQVVLLLGDSKDEAYKRTMGRPSQVGPTLLHKEEILYGNNCFYTQVLLG  177

Query  930   RGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDV  1109
              G +EH+I+I      P EPE+ IS+DG   V+VMNL+WRFRGNETV+V+NV V++FWDV
Sbjct  178   DGPKEHDIVINNPSKMPDEPELKISIDGRAVVQVMNLSWRFRGNETVLVNNVPVQIFWDV  237

Query  1110  HDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEF-------C  1268
             HDW+F   SSS   G G+FIFK       +   D+    K   + ++R  ++       C
Sbjct  238   HDWLF---SSSPGTGHGLFIFKP---ESLKNILDDDKSHKGNREKKNRDEDYVTSAVGCC  291

Query  1269  HVFYAWKTE  1295
             H  +A KT+
Sbjct  292   HFVFAVKTQ  300



>ref|XP_007217278.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
 gb|EMJ18477.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
Length=309

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = +3

Query  456   KEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDL  635
             +E   + T QS VTC++LA IA   R +T+ W K+L+ H+LSI V+    D HYTCKIDL
Sbjct  25    EEPVTTKTAQSTVTCVYLANIATNWRKVTVIWCKNLMNHSLSIRVDGLEGDFHYTCKIDL  84

Query  636   KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQK  815
             K W FW KKG KSF V+  +V+VYWD R+AKF   PEP SDFYVAL    EVV+LLGD K
Sbjct  85    KPWHFWSKKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMK  144

Query  816   SEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEM  995
              +A+KRTKSRP +V+A L +KKE+V+AK+ F TR      ++EH+I++E+  +GP +PEM
Sbjct  145   KKAYKRTKSRPAIVEALLYYKKENVFAKKSFATRVRFDEKRKEHDIVVESSTAGPKDPEM  204

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             WISVDGI  + V NL W+FRGN+TV+V+   V+VFWDVHDW+F    +S + G G+FIFK
Sbjct  205   WISVDGIVLIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLF----TSPSTGHGLFIFK  260



>ref|NP_193005.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190706.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB40986.1| putative protein [Arabidopsis thaliana]
 emb|CAB78311.1| putative protein [Arabidopsis thaliana]
 gb|AAM61648.1| unknown [Arabidopsis thaliana]
 gb|ABG48411.1| At4g12690 [Arabidopsis thaliana]
 dbj|BAF01198.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83163.1| uncharacterized protein AT4G12690 [Arabidopsis thaliana]
 gb|AEE83164.1| uncharacterized protein AT4G12690 [Arabidopsis thaliana]
Length=285

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 185/274 (68%), Gaps = 11/274 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWY  81

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VDVYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      KREH I++E+  +G  EPEMWISVDGI
Sbjct  142   KSRPSLVDAALFYKKENVFGKKIFSTRAKFHDRKREHEIVVESS-TGAKEPEMWISVDGI  200

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    S+   G G+FIFK       
Sbjct  201   VLVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWLF----STPGTGHGLFIFKP-----E  251

Query  1197  egeeDNSLPQKSC-DDSQSRPPEFCHVFYAWKTE  1295
              GE + S   K+C   S S   EFC   YAWK E
Sbjct  252   SGESETSNETKNCSASSSSSSSEFCLFLYAWKLE  285



>ref|XP_004305864.1| PREDICTED: uncharacterized protein LOC101301230 [Fragaria vesca 
subsp. vesca]
Length=312

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 185/287 (64%), Gaps = 16/287 (6%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S T QS VTC+HLA IA   R +T+ W K+L+ H+LS+ +++   D HYTCKIDLK W F
Sbjct  30    SKTAQSTVTCVHLANIAMNWRKVTVIWCKNLMNHSLSVRIDSLEGDFHYTCKIDLKPWHF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF V+   V+VYWD R+AKF   PEP+ DFYVAL    EVV+LLGD K +A+K
Sbjct  90    WSKKGYKSFAVEGTHVEVYWDLRSAKFVGGPEPNHDFYVALVCDEEVVLLLGDMKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTK+RP V +A + +KKE+V+AK+ F TR      ++EH+I++E+  SG  +PEMWIS+D
Sbjct  150   RTKARPSVAEAVMYYKKENVFAKKSFSTRVRFDEKRKEHDIVVESSTSGQKDPEMWISID  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg  1190
             GI  V V NL W+FRGN+TVMV+ + V+VFWDVHDW+F    SS   G G+FIFK G   
Sbjct  210   GIVLVHVKNLQWKFRGNQTVMVNMLPVQVFWDVHDWLF----SSPGTGHGLFIFKPGAPD  265

Query  1191  kgegeeDNSLPQKSCDDS------------QSRPPEFCHVFYAWKTE  1295
               E + D       C DS             +   +FC   +A+K E
Sbjct  266   SEENDYDRGDGVDQCGDSDNGSAYFSTRSLNTTASDFCLFLHAYKLE  312



>ref|XP_002863234.1| hypothetical protein ARALYDRAFT_497148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39493.1| hypothetical protein ARALYDRAFT_497148 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/273 (51%), Positives = 182/273 (67%), Gaps = 12/273 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VDVYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      KREH I++E+  +G  +PEMWISVDGI
Sbjct  142   KSRPSLVDAALFYKKENVFGKKSFSTRAKFHDRKREHEIVVESS-TGAKDPEMWISVDGI  200

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    SS   G G+FIFK       
Sbjct  201   VLVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWLF----SSPGTGHGLFIFKP------  250

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                 ++     + D S S   +FC   YAWK E
Sbjct  251   -ESGESETSNGTKDSSVSSSSDFCLFLYAWKLE  282



>ref|XP_006284280.1| hypothetical protein CARUB_v10005449mg [Capsella rubella]
 gb|EOA17178.1| hypothetical protein CARUB_v10005449mg [Capsella rubella]
Length=279

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 184/273 (67%), Gaps = 10/273 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  17    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWNFWN  76

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VDVYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  77    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  136

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      K+EH I++E+  +G T+PEM ISVDGI
Sbjct  137   KSRPSLVDAALFYKKENVFGKKSFSTRAKFHDRKKEHEIVVESS-TGETDPEMLISVDGI  195

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW+F    SS   G G+FIFK       
Sbjct  196   LLVKVRNLQWKFRGNQTVVVDKEPVQVFWDVYDWLF----SSPGTGHGLFIFKP-----E  246

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
              GE D+S       ++ S   EFC   YAWK E
Sbjct  247   SGESDSSNGGTKYSNASSSSSEFCLFLYAWKLE  279



>ref|XP_008229762.1| PREDICTED: uncharacterized protein LOC103329112 [Prunus mume]
Length=309

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + T QS VTC++LA IA   R +T+ W K+L+ H+LSI V+    D HYTCKIDLK W F
Sbjct  30    TKTAQSTVTCVYLANIATNWRKVTVIWCKNLMNHSLSIRVDGLEGDFHYTCKIDLKPWHF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF V+  +V+VYWD R+AKF   PEP SDFYVAL    EVV+LLGD K +A+K
Sbjct  90    WSKKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTKSRP +V+A L +K+E+V+AK+ F TR      ++EH+I++E+  +GP +PEMWIS+D
Sbjct  150   RTKSRPAIVEALLYYKRENVFAKKSFATRVRFDEKRKEHDIVVESSTAGPKDPEMWISID  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             GI  + V NL W+FRGN+TV+V+   V+VFWDVHDW+F    +S + G G+FIFK
Sbjct  210   GIVLIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLF----TSPSTGHGLFIFK  260



>ref|XP_006469407.1| PREDICTED: uncharacterized protein LOC102629245 [Citrus sinensis]
 gb|KDO51012.1| hypothetical protein CISIN_1g047581mg [Citrus sinensis]
Length=308

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 183/285 (64%), Gaps = 16/285 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC +   IA  LR +T+ W K+L+ H+LSI++ +   D HY+CK+DLK W FW 
Sbjct  28    TAQSTVTCGYQTHIAGYLRNVTVLWCKNLMNHSLSIMINSLEGDYHYSCKVDLKPWHFWS  87

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KS +V+  +V++YWD R+AKFS  PEP  DFYVAL    EVV+LLGD K +A+KRT
Sbjct  88    KKGYKSLDVEGNQVEIYWDLRSAKFSGGPEPCGDFYVALVWEEEVVLLLGDYKKKAYKRT  147

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             K+RP +V+A   +KKE+V+AK+ F TR      KREH+I++E+   GP +PEMWIS+DGI
Sbjct  148   KARPALVEALQYYKKENVFAKKSFGTRAKFDERKREHDIVVESSTLGPKDPEMWISIDGI  207

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V V NL W+FRGN+TV+VD   V+VFWDVHDW+F    S+   G G+FIFK       
Sbjct  208   VLVHVRNLQWKFRGNQTVLVDKQPVQVFWDVHDWLF----STPGTGHGLFIFKPNAPEIS  263

Query  1197  egeeDNSLPQKSCDDSQSR------------PPEFCHVFYAWKTE  1295
             E E  +     S + + S+             PEFC   YAWK E
Sbjct  264   ESEGSSQGGGDSDNSNGSKYHSSRNSSRSNTAPEFCLFLYAWKIE  308



>ref|XP_006447854.1| hypothetical protein CICLE_v10017488mg [Citrus clementina]
 gb|ESR61094.1| hypothetical protein CICLE_v10017488mg [Citrus clementina]
Length=308

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 183/285 (64%), Gaps = 16/285 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC +   IA  LR +T+ W K+L+ H+LSI++ +   D HY+CK+DLK W FW 
Sbjct  28    TAQSTVTCGYQTHIAGYLRNVTVLWCKNLMNHSLSIMINSLEGDYHYSCKVDLKPWHFWS  87

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KS +V+  +V++YWD R+AKFS  PEP  DFYVAL    EVV+LLGD K +A+KRT
Sbjct  88    KKGYKSLDVEGNQVEIYWDLRSAKFSGGPEPCGDFYVALVWEEEVVLLLGDYKKKAYKRT  147

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             K+RP +V+A   +KKE+V+AK+ F TR      KREH+I++E+   GP +PEMW+S+DGI
Sbjct  148   KARPALVEALQYYKKENVFAKKSFGTRAKFDERKREHDIVVESSTLGPKDPEMWVSIDGI  207

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V V NL W+FRGN+TV+VD   V+VFWDVHDW+F    S+   G G+FIFK       
Sbjct  208   VLVHVRNLQWKFRGNQTVLVDKQPVQVFWDVHDWLF----STPGTGHGLFIFKPNAPEIS  263

Query  1197  egeeDNSLPQKSCDDSQSR------------PPEFCHVFYAWKTE  1295
             E E  +     S + + S+             PEFC   YAWK E
Sbjct  264   ESEGSSQGGGDSDNSNGSKYHSSRNSSRSNTAPEFCLFLYAWKIE  308



>ref|XP_010450329.1| PREDICTED: uncharacterized protein LOC104732477 [Camelina sativa]
Length=285

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 181/273 (66%), Gaps = 9/273 (3%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VD YWDFR+AKF+ SPEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  82    KKGYKSFEVEGNQVDAYWDFRSAKFNGSPEPSSDFYVALVSDEEVVLLLGDHKKKAFKRT  141

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      K+EH I++E+  +G  +PEMWISVDGI
Sbjct  142   KSRPALVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESS-TGEKDPEMWISVDGI  200

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW F    S+   G G+FIFK  NG   
Sbjct  201   ILVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFF----STPGTGHGLFIFKPENGESD  256

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
               +       K    S S   EFC   YAWK E
Sbjct  257   ASDGGT----KDSSSSSSSSSEFCLFLYAWKLE  285



>ref|XP_010435360.1| PREDICTED: uncharacterized protein LOC104719196 [Camelina sativa]
Length=285

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 181/273 (66%), Gaps = 9/273 (3%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VDVYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      K+EH I++E+  +G  +PEMWISVDGI
Sbjct  142   KSRPALVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESS-TGEKDPEMWISVDGI  200

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW F    S+   G G+FIFK  NG   
Sbjct  201   ILVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFF----STPGTGHGLFIFKPENGESD  256

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
               +       K    S S   EFC   YAWK E
Sbjct  257   ASDGGT----KDSSSSSSSSSEFCLFLYAWKLE  285



>ref|XP_010496357.1| PREDICTED: uncharacterized protein LOC104773443 [Camelina sativa]
Length=284

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 181/273 (66%), Gaps = 10/273 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTCI+ A +    R + + WSK+L+ H+L+++V +   D +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF V+  +VDVYWDFR+AKF+  PEP SDFYVAL +  EVV+LLGD K +AFKRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSDEEVVLLLGDHKKKAFKRT  141

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +VDA L +KKE+V+ K+ F TR      K+EH I++E+  +G  +PEMWISVDGI
Sbjct  142   KSRPTLVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESS-NGKKDPEMWISVDGI  200

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V+V NL W+FRGN+TV+VD   V+VFWDV+DW F    S+   G G+FIFK       
Sbjct  201   ILVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFF----STPGTGHGLFIFKP-----E  251

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
              GE D S        S S   EFC   YAWK E
Sbjct  252   NGESDASDGGTKDSSSSSSSSEFCLFLYAWKLE  284



>emb|CDO97954.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 175/279 (63%), Gaps = 12/279 (4%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             QS  TC++   I    R +T+ WSK+L+ H+LSI V++   D H TCKIDLK W FW KK
Sbjct  34    QSTATCVYQTHIGGYWRNVTVLWSKNLMNHSLSITVDSVETDYHQTCKIDLKPWHFWAKK  93

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+F VD  ++D YWD R+AKFS SPEP +DFYVAL    EVV+L+GD K +A+KRTKS
Sbjct  94    GYKTFEVDGNQLDAYWDLRSAKFSGSPEPCTDFYVALVADEEVVLLIGDYKKKAYKRTKS  153

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RP +VDA L  KKE V+ K+ F TR      K++H+I++E+  SGP +PEMWIS+DGI  
Sbjct  154   RPALVDAVLFFKKEHVFGKKSFSTRAKFDHRKKDHDIVVESSTSGPRDPEMWISIDGIVL  213

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             + + NL W+FRGN+TV+V+   ++VFWDVH W+F     S     G+FIFK G       
Sbjct  214   IHIRNLQWKFRGNQTVLVNKQPIQVFWDVHSWLF----CSPGTSHGLFIFKPGVPEAESD  269

Query  1203  eeDNSLPQKSCD--------DSQSRPPEFCHVFYAWKTE  1295
             ++ N      C          S S+   FC   YAWK E
Sbjct  270   KDSNCTGDSDCSADSRYYSTQSHSKSSPFCLFLYAWKIE  308



>ref|XP_008444827.1| PREDICTED: uncharacterized protein LOC103488057 [Cucumis melo]
Length=311

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 194/310 (63%), Gaps = 19/310 (6%)
 Frame = +3

Query  411   SMAQLRPMNPRREDQKEAEE---SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALS  581
             SM      NP    +K  EE   S T QS VTC + A IA   R +T+ W K+L+ H L+
Sbjct  6     SMRSQSLANPPPLAEKITEEPITSKTAQSTVTCFYQANIAGFWRNVTVLWCKNLMNHTLT  65

Query  582   IVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDF  761
             I +++   D H   KID+K W FW KKG KS  +D  ++D+YWD R+AKFS+ PEP SDF
Sbjct  66    ITIQSLQGDFHCNYKIDVKPWHFWSKKGFKSLELDGNQIDIYWDVRSAKFSTGPEPYSDF  125

Query  762   YVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKR  941
             YVAL +  EVV+LLGD K +A+KRTKSRP ++DA L++KKE+V+AK+CF TR      ++
Sbjct  126   YVALVSDEEVVLLLGDYKKKAYKRTKSRPALLDAILIYKKENVFAKKCFSTRAKFDDRRK  185

Query  942   EHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWM  1121
             E +I++E   SG  +PEMWIS+DGI  V+V NL W+FRGN+TV+V+  +V+V WDVHDW+
Sbjct  186   ECDIVVEISTSGAKDPEMWISIDGIVLVQVKNLQWKFRGNQTVLVNKQSVQVLWDVHDWL  245

Query  1122  FNDDSSSVAAGPGVFIFK------------QgnggkgegeeDNSLPQKSCDDSQSRPPEF  1265
             F +  +    G G+FIFK             G GG  E  +D S+   +   + S   EF
Sbjct  246   FTNPGT----GHGLFIFKPGPPESESDKEGSGGGGALEPSDDGSIYYSTRSMNSSHQTEF  301

Query  1266  CHVFYAWKTE  1295
             C   YAWK E
Sbjct  302   CLFLYAWKLE  311



>ref|XP_008380035.1| PREDICTED: uncharacterized protein LOC103443030 [Malus domestica]
 ref|XP_008365566.1| PREDICTED: uncharacterized protein LOC103429200 [Malus domestica]
Length=310

 Score =   273 bits (699),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 182/285 (64%), Gaps = 14/285 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + T QS VTC+ LA IA   R +TI W K+L+ H+LSI +++   + HYTCK DLK W F
Sbjct  30    TKTAQSTVTCVFLANIATFWRKVTIIWCKNLMNHSLSIRIDSLDGEFHYTCKFDLKPWHF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF  +  +V+VYWD R+AKF   PEP SDFYVAL    EVV+LLGD K +A+K
Sbjct  90    WSKKGYKSFEFEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTKSRP +V+A L +KKE+V+AK+ F TR      ++EH+I++E+  SG  +PEMWISVD
Sbjct  150   RTKSRPALVEALLYYKKENVFAKKSFATRVKFDEKRKEHDIVVESSTSGLKDPEMWISVD  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-----  1175
             GI  + V NL W+FRGN+TV V+   V+VFWDVHDW+F    SS   G G+FIFK     
Sbjct  210   GIVLIHVKNLQWKFRGNQTVQVNMQPVQVFWDVHDWLF----SSPGTGHGLFIFKPGAPE  265

Query  1176  ----QgnggkgegeeDNSLPQKSCDDS-QSRPPEFCHVFYAWKTE  1295
                     G G    DNS    S   S  S   +FC   +A+K E
Sbjct  266   SESDHDRDGNGSINSDNSSAYYSTQTSNNSTSSDFCMFLHAYKIE  310



>ref|XP_008353616.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353617.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353618.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
Length=309

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/284 (50%), Positives = 186/284 (65%), Gaps = 13/284 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + T QS VTC++LA IA   R +TI W K+L+ H+LSI +++     HYTCKIDLK W F
Sbjct  30    TKTAQSTVTCVYLANIATCWRKVTIIWCKNLMNHSLSIRIDSLDGGFHYTCKIDLKPWHF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF V+  +V+VYWD R+AKF   PEP SDFYVAL    E+V+LLGD K +A+K
Sbjct  90    WSKKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDQEIVLLLGDMKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTKSRP +V+A L +KKE+V+AK+ F TR      ++EH+I++E+  SG  +PEMWIS+D
Sbjct  150   RTKSRPALVEALLYYKKENVFAKKSFATRVKFDENRKEHDIVVESSTSGSKDPEMWISID  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-----  1175
             GI  + V NL W+FRGN+T+ V+   V+VFWDVHDW+F    SS   G G+FIFK     
Sbjct  210   GIVLIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLF----SSPGTGHGLFIFKPGXPE  265

Query  1176  ----QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                     G G  + D+S P  S   S S   +FC   +A+K E
Sbjct  266   SESDHDRDGNGGIDSDHSSPYYSTQTSNSTSSDFCLFLHAYKIE  309



>ref|XP_008342273.1| PREDICTED: uncharacterized protein LOC103405081 [Malus domestica]
Length=308

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/284 (50%), Positives = 186/284 (65%), Gaps = 13/284 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + T QS VTC++LA IA   R +TI W K+L+ H+LSI +++     HYTCKIDLK W F
Sbjct  29    TKTAQSTVTCVYLANIATCWRKVTIIWCKNLMNHSLSIRIDSLDGGFHYTCKIDLKPWHF  88

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF V+  +V+VYWD R+AKF   PEP SDFYVAL    E+V+LLGD K +A+K
Sbjct  89    WSKKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDQEIVLLLGDMKKKAYK  148

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTKSRP +V+A L +KKE+V+AK+ F TR      ++EH+I++E+  SG  +PEMWIS+D
Sbjct  149   RTKSRPALVEALLYYKKENVFAKKSFATRVKFDENRKEHDIVVESSTSGSKDPEMWISID  208

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-----  1175
             GI  + V NL W+FRGN+T+ V+   V+VFWDVHDW+F    SS   G G+FIFK     
Sbjct  209   GIVLIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLF----SSPGTGHGLFIFKPGPPE  264

Query  1176  ----QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                     G G  + D+S P  S   S S   +FC   +A+K E
Sbjct  265   SESDHDRDGNGGIDSDHSSPYYSTQTSNSTSSDFCLFLHAYKIE  308



>ref|XP_002307050.1| hypothetical protein POPTR_0005s06920g [Populus trichocarpa]
 gb|EEE94046.1| hypothetical protein POPTR_0005s06920g [Populus trichocarpa]
Length=294

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 194/301 (64%), Gaps = 13/301 (4%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGH  572
             +RNS +  A L    P +  + +   + T QS VTC + A +A   RTIT+ W K+L+ H
Sbjct  7     LRNSSVG-ASLSSAPPEKISE-DPSTNKTPQSTVTCAYHAYVAGYWRTITVFWCKNLMNH  64

Query  573   ALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPD  752
              L++++ N   +  Y+CKIDLK W FW KKG KSF ++  +VD++WDFR+AKFS SPEP 
Sbjct  65    TLNLIINNLEGEVCYSCKIDLKPWLFWSKKGGKSFELEGCQVDIHWDFRSAKFSGSPEPA  124

Query  753   SDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGR  932
             SD+YVA+ +  EVV+LLGD K +A+KRTK+RP +V+A L  KKE+V+ ++ F TR     
Sbjct  125   SDYYVAIVSDEEVVLLLGDYKKKAYKRTKARPALVEAILYLKKENVFHRKTFSTRAKFDE  184

Query  933   GKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVH  1112
              K EH+II+E+   G  +PEMWIS+DGI  + VMNL W+FRGN+TVM+    V+VFWDVH
Sbjct  185   RKNEHDIIVESSTGGSRDPEMWISIDGIVVIHVMNLQWKFRGNQTVMLSRQPVQVFWDVH  244

Query  1113  DWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKT  1292
             DW+F    S+   G G+FIFK G     + ++ +S   ++         EFC   YAWK 
Sbjct  245   DWLF----STPGTGHGLFIFKPGVPEPEDDKDGSSYGGQTT-------AEFCLFLYAWKI  293

Query  1293  E  1295
             E
Sbjct  294   E  294



>ref|XP_008783101.1| PREDICTED: uncharacterized protein LOC103702440 [Phoenix dactylifera]
Length=273

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 179/289 (62%), Gaps = 17/289 (6%)
 Frame = +3

Query  432   MNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDN  611
             M    +  +EA  + T Q  V  I+ A I  + R +T+ WSK+L+ H+LS+ VE  + D+
Sbjct  1     MEEGEKHGEEATSNKTAQCSVISIYQANIVGVPRNVTVVWSKNLMNHSLSVSVEKSNGDS  60

Query  612   HYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDF-YVALATGGE  788
               TCK++LK W FW KKG KS  +D ERVD+YWD R+AKFS+ PEP     YVAL    E
Sbjct  61    PLTCKVELKPWPFWSKKGFKSLEIDGERVDLYWDLRSAKFSNGPEPSGGHHYVALVCNEE  120

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K EA++RTK RP +  A LV ++E+V+ K+CF TR      K+EH+I++E  
Sbjct  121   VVLLLGDGKKEAYRRTKCRPALESAALVSRRENVFGKKCFTTRARFDERKKEHDIVVENS  180

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
             +SGP +PEMWIS+DG+  + V NL W+FRGNETV+V+ V V+VFWDVHDW+F     +  
Sbjct  181   ISGPQDPEMWISIDGVVLIHVSNLQWKFRGNETVLVEKVPVQVFWDVHDWLF----GTPG  236

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
              G  +FIFK    G                +  S  PEFC    AWKTE
Sbjct  237   TGHALFIFKPAAEGDRN------------GNPSSPAPEFCFFLCAWKTE  273



>ref|XP_004135720.1| PREDICTED: uncharacterized protein LOC101212848 [Cucumis sativus]
 ref|XP_004158103.1| PREDICTED: uncharacterized protein LOC101228551 [Cucumis sativus]
 gb|KGN65893.1| hypothetical protein Csa_1G537430 [Cucumis sativus]
Length=314

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 193/305 (63%), Gaps = 22/305 (7%)
 Frame = +3

Query  435   NPRREDQKEAEE---SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSE  605
             NP    +K  EE   S T QS VTC + A IA   R +T+ W K+L+ H L+I +++   
Sbjct  14    NPPPLAEKITEEPITSKTAQSTVTCFYQANIAGFWRNVTVLWCKNLMNHTLTITIQSLQG  73

Query  606   DNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGG  785
             D H   KID+K W FW KKG KS ++D  ++D+YWD R+AKFS+ PEP SDFYVAL +  
Sbjct  74    DFHCNYKIDVKPWHFWSKKGFKSIDLDGSQIDLYWDVRSAKFSTGPEPYSDFYVALVSDE  133

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP ++DA L++KKE+V+AK+CF TR      ++E +I++E 
Sbjct  134   EVVLLLGDYKKKAYKRTKSRPALLDAILIYKKENVFAKKCFSTRAKFDDRRKECDIVVEI  193

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               SG  +PEMWIS+DGI  V+V NL W+FRGN+TV+V+  +V+V WDVHDW+F +  +  
Sbjct  194   STSGAKDPEMWISIDGIVLVQVKNLQWKFRGNQTVLVNKQSVQVLWDVHDWLFTNPGT--  251

Query  1146  AAGPGVFIFK---------------QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFY  1280
               G G+FIFK                G GG  E  +D S+   +   + S   EFC   Y
Sbjct  252   --GHGLFIFKPGPPESESDKEGSGGGGGGGAFEPSDDGSIYYSTRSMNSSHHTEFCLFLY  309

Query  1281  AWKTE  1295
             AWK E
Sbjct  310   AWKLE  314



>ref|XP_010038753.1| PREDICTED: uncharacterized protein LOC104427347 [Eucalyptus grandis]
 gb|KCW47641.1| hypothetical protein EUGRSUZ_K01385 [Eucalyptus grandis]
Length=310

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 187/309 (61%), Gaps = 15/309 (5%)
 Frame = +3

Query  396   RNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHA  575
             R + +   Q  P+  R  D     ++A  QS VT  + A I      ++ITW K+L+ H+
Sbjct  8     RATSLPPTQSPPLAERITDDPVTIKTA--QSTVTLAYQANIGGYWHNVSITWCKNLMNHS  65

Query  576   LSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
             LSI V+    D HYTCKI LK W FW KKG KSF V+ +RVDVYWD R+AKF+ SPEP +
Sbjct  66    LSITVDGLEGDFHYTCKIYLKPWHFWSKKGYKSFEVESKRVDVYWDLRSAKFAGSPEPCT  125

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             D+YVAL +  EVV+LLGD K +A+KRTKSRP +VDA L +KKE+V+ K+ F TR      
Sbjct  126   DYYVALVSDEEVVLLLGDYKKKAYKRTKSRPALVDAMLFYKKENVFGKKTFATRAKFDER  185

Query  936   KREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHD  1115
              +EH I +E+   G  EPEMWI++DG   + V NL+W+FRGN+ ++V+   V+VFWDVHD
Sbjct  186   TKEHEITVESTTFGHREPEMWINIDGAVVIHVRNLDWKFRGNQNIVVNKKPVQVFWDVHD  245

Query  1116  WMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSR---------PPEFC  1268
             WMF     S   G G+FIFK G        + +S    S   + ++          P+FC
Sbjct  246   WMFK----SPGTGHGLFIFKPGLVEPESDRDGSSRGANSDSSTATKYYTARTGSTAPDFC  301

Query  1269  HVFYAWKTE  1295
                YAWK E
Sbjct  302   LFLYAWKVE  310



>ref|XP_003518296.1| PREDICTED: uncharacterized protein LOC100796483 [Glycine max]
Length=307

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 190/297 (64%), Gaps = 13/297 (4%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             P+ P +  + E   S   QS VTC + A +    R ++I W K L+ H+L + V++   +
Sbjct  16    PIIPEKTTE-EPLPSKVAQSTVTCFYQANVVGFWRNVSILWCKHLMNHSLHVTVDSVGGE  74

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
               Y+CKID+K W FW KKG K+F VD  +V++YWD R+AKF+ SPEP SD+YVAL +  E
Sbjct  75    VQYSCKIDVKPWHFWSKKGYKTFEVDGNQVELYWDLRSAKFAGSPEPSSDYYVALVSDEE  134

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K +A+KRTKSRP +VDA L+ KKE+V+AK+ F T+      ++++ I++++ 
Sbjct  135   VVLLLGDYKKKAYKRTKSRPALVDAMLLVKKENVFAKKSFSTKARFDEKRKDNEIVVDSL  194

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
               GP++PEMWIS+DGI  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F    S   
Sbjct  195   TGGPSDPEMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF----SGSG  250

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQS--------RPPEFCHVFYAWKTE  1295
             +GPG+FIFK G       +E +++     DD              EFC V YA+K E
Sbjct  251   SGPGLFIFKPGPPEAESEKEGSAVEGCESDDGSVGYFSTMNIATFEFCLVLYAYKIE  307



>ref|XP_009777340.1| PREDICTED: uncharacterized protein LOC104226933 [Nicotiana sylvestris]
Length=308

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 193/308 (63%), Gaps = 21/308 (7%)
 Frame = +3

Query  399   NSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHAL  578
             +SQ S+AQ    +P   D K A      Q  VTC++ + I    R +T+ W K L+ H+L
Sbjct  13    SSQPSLAQKLIDDPV--DPKNA------QCSVTCVYQSHIGGYWRNVTVIWRKHLMNHSL  64

Query  579   SIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSD  758
             ++ V++   ++H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP  D
Sbjct  65    TVSVDSVENNDHQTCKIDLKPWHFWAKKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPYKD  124

Query  759   FYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK  938
             FYVAL +  EVV+LLGD K +A+KRTKSRP +VDA L +KKE V+ K+ F TR      K
Sbjct  125   FYVALVSDEEVVMLLGDYKKKAYKRTKSRPALVDALLFYKKEHVFGKKSFSTRAKFDNNK  184

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDW  1118
             +E +I++E+  SGP +PEMWIS+DGI  + + NL W+FRGN+TV+V+   V+VFWDVH W
Sbjct  185   KESDIVVESSTSGPRDPEMWISIDGIVLIHIKNLQWKFRGNQTVLVNKQHVQVFWDVHSW  244

Query  1119  MFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCH  1271
             +F    SS  +  G+FIFK G       ++ +S+  +S C D        S S+   FC 
Sbjct  245   LF----SSPGSSHGLFIFKPGELELDSDKDGSSVGGESDCSDHTKYYSTLSHSKAAPFCL  300

Query  1272  VFYAWKTE  1295
                AWK E
Sbjct  301   FLCAWKIE  308



>ref|XP_011031123.1| PREDICTED: uncharacterized protein LOC105130358 [Populus euphratica]
Length=310

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/282 (48%), Positives = 183/282 (65%), Gaps = 13/282 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T QS VTC + A +A   RTIT+ W K+L+ H L++++ N   +  Y CKIDLK W FW 
Sbjct  33    TPQSTVTCAYHAYVAGYWRTITVFWCKNLMNHTLNLIINNLEGEACYNCKIDLKPWLFWS  92

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF ++  +VD++WDFR+AKFS SPEP SD+YVA+ +  EVV+LLGD K +A+KRT
Sbjct  93    KKGGKSFELEGCQVDIHWDFRSAKFSGSPEPASDYYVAIVSDEEVVLLLGDYKKKAYKRT  152

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             K+RP +V+A L  KKE+V+ ++ F TR      K EH+II+E+   G  +PEMWIS+DGI
Sbjct  153   KARPALVEAILYLKKENVFHRKTFSTRAKFDERKNEHDIIVESSAGGSRDPEMWISIDGI  212

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               + VMNL W+FRGN+TVM+    V+VFWDVHDW+F    S+   G G+FIFK G     
Sbjct  213   VVIHVMNLQWKFRGNQTVMLSRQPVQVFWDVHDWLF----STPGTGHGLFIFKPGVPEPE  268

Query  1197  egeeDNSLPQKS---------CDDSQSRPPEFCHVFYAWKTE  1295
             + ++ +S   +S            S S   EFC   YAWK E
Sbjct  269   DDKDGSSYGGQSDTSDGSMYFSTRSLSATAEFCLFLYAWKIE  310



>gb|KDP32618.1| hypothetical protein JCGZ_13168 [Jatropha curcas]
Length=307

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 199/289 (69%), Gaps = 10/289 (3%)
 Frame = +3

Query  453   QKEAEESATDQS---YVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTC  623
             +KE+E+++T+++    VT ++ A +A   R +T+TW+K+L+ ++L+I VEN S +NHY C
Sbjct  21    EKESEDNSTNRAPHISVTHVYEAIVAGFSRHVTVTWNKTLMNYSLTISVENLSNENHYIC  80

Query  624   KIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILL  803
             KIDLK WQFWGKKGLKS  VD +RV++YWDFR  KFS +PEP SD+YVAL  G EVV+ L
Sbjct  81    KIDLKGWQFWGKKGLKSLLVDGKRVEIYWDFRQVKFSRNPEPVSDYYVALVYGEEVVLTL  140

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTK +P + +  L+ KKE+VY KR FCT+  L   K EH+I+IE    G  
Sbjct  141   GDLKKDAYKRTKRKPSLEEPILLCKKENVYGKRIFCTKAKLEDDKIEHDIVIEMSY-GLD  199

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETV-MVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
             EPE+WIS+D  E +R+MNL+W+FRGNE V M +N  VE+FWDVHDW+++  S S ++  G
Sbjct  200   EPELWISIDSFEVIRIMNLHWKFRGNEKVTMRNNFEVEIFWDVHDWLYS-SSLSTSSNHG  258

Query  1161  VFIFK--QgnggkgegeeDNSLPQKSCDDSQSRPP--EFCHVFYAWKTE  1295
             +FIFK    +  + +   D +   +  D  +   P  ++ HV YAWK E
Sbjct  259   LFIFKPINDSIDRDDTFHDKNNGLRYYDSPREILPTSDYFHVVYAWKFE  307



>ref|XP_011080356.1| PREDICTED: uncharacterized protein LOC105163627 [Sesamum indicum]
Length=319

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 181/282 (64%), Gaps = 13/282 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T Q+ VTC++   IA   R  T+ WSK+L+ H+LSI V++  ++    CKIDLK W FW 
Sbjct  42    TPQTTVTCVYQTHIAGFWRNATVLWSKNLMNHSLSISVDSAEQETASMCKIDLKPWHFWA  101

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG K+F VD  +++ YWD R+AKFS SPEP +DFYVAL +  EVV+LLGDQK +A+KRT
Sbjct  102   KKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPSADFYVALVSDEEVVLLLGDQKKKAYKRT  161

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             ++ P +VDA + +KKE+V+ K+ F TR      KREH I++E+  +GP +PEMWIS+DGI
Sbjct  162   RATPALVDAMMFYKKENVFGKKSFSTRVKFDERKREHEIVVESSTTGPRDPEMWISIDGI  221

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               + + NL W+FRGN+TV VD   V+VFWDVH W+F    S+     G+FIFK G+    
Sbjct  222   VLIHIKNLQWKFRGNQTVQVDKQTVQVFWDVHAWLFCAPGSNY----GLFIFKSGDPDAD  277

Query  1197  egeeDNSL---------PQKSCDDSQSRPPEFCHVFYAWKTE  1295
                +D+S           +     S S+  +FC   YAWK E
Sbjct  278   SDGDDSSRGDDSECSGNSRYYSTQSYSKGTQFCLFLYAWKIE  319



>ref|XP_009622577.1| PREDICTED: uncharacterized protein LOC104113961 [Nicotiana tomentosiformis]
Length=308

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 179/280 (64%), Gaps = 13/280 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q  VTC++ + I    R +T+ W K L+ H+L+I V++    +H TCKIDLK W FW KK
Sbjct  33    QGSVTCVYQSHIGGYWRNVTVIWRKHLMNHSLTISVDSVENGDHQTCKIDLKPWHFWAKK  92

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+F VD  +++ YWD R+AKFS SPEP  DFYVAL +  EVV+LLGD K +A+KRTKS
Sbjct  93    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPYKDFYVALVSEEEVVMLLGDYKKKAYKRTKS  152

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RP +VDA L +KKE V+ K+ F TR    + K+E +I++E+  SGP +PEMWIS+DGI  
Sbjct  153   RPALVDALLFYKKEHVFGKKSFSTRAKFDKNKKESDIVVESSTSGPRDPEMWISIDGIVL  212

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             + + NL W+FRGN+TV+V+   V+VFWDVH W+F    SS  +  G+FIFK G       
Sbjct  213   IHIKNLQWKFRGNQTVLVNKQHVQVFWDVHSWLF----SSPGSSHGLFIFKPGELELDSD  268

Query  1203  eeDNSLPQKS-CDD--------SQSRPPEFCHVFYAWKTE  1295
             +E +S    S C D        S S+   FC    AWK E
Sbjct  269   KEGSSAGGDSDCSDHTKYYSTLSHSKASPFCLFLCAWKIE  308



>ref|XP_006343140.1| PREDICTED: uncharacterized protein LOC102583919 [Solanum tuberosum]
Length=308

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 191/308 (62%), Gaps = 21/308 (7%)
 Frame = +3

Query  399   NSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHAL  578
             +SQ S+AQ    +P   D K A+ S      VTC++ + I    R +T+ W K+++ H L
Sbjct  13    SSQPSIAQKLKDDPV--DPKNAQGS------VTCVYQSHIGGYWRNVTVIWRKNMMNHCL  64

Query  579   SIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSD  758
             +I V++   ++H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP  D
Sbjct  65    TISVDSVENEDHQTCKIDLKPWHFWAKKGYKTFEVDGHQLEAYWDLRSAKFSGSPEPFKD  124

Query  759   FYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK  938
             FYVAL    EVV+LLGD K +A+KRTKSRP +VDA L +KKE V+ K+ F TR      K
Sbjct  125   FYVALIAEEEVVLLLGDYKKKAYKRTKSRPALVDALLFYKKEHVFGKKSFSTRAKFENNK  184

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDW  1118
             +E +I++E+  SGP +PEMWIS+DGI  + + NL W+FRGN+TV+V+   V+VFWDVH W
Sbjct  185   KESDIVVESSTSGPRDPEMWISIDGIVLIHIKNLQWKFRGNQTVLVNEQHVQVFWDVHSW  244

Query  1119  MFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCH  1271
             +F +  S+     G+FIFK G        + +S+   S C D        S SR   FC 
Sbjct  245   LFCEPGST----HGLFIFKPGVSELESDRDGSSVGGDSDCSDHTKYYSTLSHSRASPFCL  300

Query  1272  VFYAWKTE  1295
                AWK E
Sbjct  301   FLCAWKIE  308



>ref|XP_007142239.1| hypothetical protein PHAVU_008G264000g [Phaseolus vulgaris]
 gb|ESW14233.1| hypothetical protein PHAVU_008G264000g [Phaseolus vulgaris]
Length=300

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 181/284 (64%), Gaps = 13/284 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S   QS VTC + A +    R +++ W K+L+ H+L + V++   +  Y+CKID+K W F
Sbjct  21    SKVAQSTVTCFYQANVTGYWRNVSVLWCKNLMNHSLHVTVDSVGGEVQYSCKIDVKPWHF  80

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG K+  VD  ++D+YWD R+AKFS SPEP SDFYVAL +  EVV+LLGD K +A+K
Sbjct  81    WSKKGYKTIEVDGNQIDLYWDLRSAKFSGSPEPCSDFYVALVSDEEVVLLLGDYKKKAYK  140

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             RTKSRP +VDA L+ KKE+V+AK+ F T+      +++  I++E+   GP +PEMW+ +D
Sbjct  141   RTKSRPALVDAMLLVKKENVFAKKSFSTKARFDENRKDSEIVVESSTGGPNDPEMWVIID  200

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg  1190
             GI  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F    S   +GPG+FIFK G   
Sbjct  201   GIVLINVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF----SGSGSGPGLFIFKPGPPE  256

Query  1191  kgegeeDNSLPQKSCDDSQS---------RPPEFCHVFYAWKTE  1295
                 +E + +     DD  S            EFC V YA+K E
Sbjct  257   PESEKEGSVMEGCESDDDGSVGYYSTMNIAAIEFCLVLYAYKIE  300



>ref|XP_004235628.1| PREDICTED: uncharacterized protein LOC101250288 [Solanum lycopersicum]
Length=308

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 191/308 (62%), Gaps = 21/308 (7%)
 Frame = +3

Query  399   NSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHAL  578
             +SQ S+AQ    +P   D K A+ S      VTC++ + I    R +T+ W K+++ H L
Sbjct  13    SSQPSIAQKLKDDPV--DPKNAQGS------VTCVYQSHIGGYWRNVTVIWRKNMMNHCL  64

Query  579   SIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSD  758
             +I V++   ++H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP  D
Sbjct  65    TISVDSVENEDHQTCKIDLKPWHFWAKKGYKTFEVDGYQLEAYWDLRSAKFSGSPEPFKD  124

Query  759   FYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK  938
             FYVAL    EVV+LLGD K +A+KRTKSRP +VDA L +KKE V+ K+ F TR      K
Sbjct  125   FYVALIAEEEVVLLLGDYKKKAYKRTKSRPALVDALLFYKKEHVFGKKSFSTRAKFENNK  184

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDW  1118
             +E +I++E+  SGP +PEMWIS+DGI  + + NL W+FRGN+TV+V+   V+VFWDVH W
Sbjct  185   KESDIVVESSTSGPRDPEMWISIDGIVLIHIKNLQWKFRGNQTVLVNEQHVQVFWDVHSW  244

Query  1119  MFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCH  1271
             +F +  S+     G+FIFK G        + +S+   S C D        S SR   FC 
Sbjct  245   LFCEPGST----HGLFIFKPGVSELESDRDGSSVGGDSDCSDHTKYFSTLSHSRASPFCL  300

Query  1272  VFYAWKTE  1295
                AWK E
Sbjct  301   FLCAWKIE  308



>ref|XP_010552345.1| PREDICTED: uncharacterized protein LOC104822715 isoform X1 [Tarenaya 
hassleriana]
Length=273

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 182/269 (68%), Gaps = 8/269 (3%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED-NHYTCKIDLKTWQFWGKK  662
             S VT I++ +IA +   +  TWSKS+  H+LS+ +ENP +D NH+T KIDL  W FWGKK
Sbjct  6     SSVTFIYIVEIAGITLNVVATWSKSISSHSLSVSIENPKDDRNHHTVKIDLSGWSFWGKK  65

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             GLK+   D  R+DVYWDFR AKFS+ PEP S FYVAL +   VV+ +GD  +EA KRT+ 
Sbjct  66    GLKTLEADGTRIDVYWDFRQAKFSNVPEPSSGFYVALVSQDVVVLTIGDLVNEAMKRTRK  125

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTML-GRGKREHNIIIETDLSGPTEPEMWISVDGIE  1019
             RP   +A LV KKE VY KR F TRT   G G+REH ++IET LSGP EPEMWI+VDG+ 
Sbjct  126   RPSAREAALVCKKEHVYGKRVFYTRTAFDGTGRREHEVVIETSLSGPEEPEMWITVDGVA  185

Query  1020  SVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
             ++RVMNLNWRFRGNE V V + VAVE++WD+HDW+F    SS     G+F+FKQ    +G
Sbjct  186   AMRVMNLNWRFRGNEVVTVKEGVAVEIYWDIHDWLFGSCGSSC----GLFVFKQKLVSEG  241

Query  1197  egeeDNSLPQKSCDDSQSRPPEFCHVFYA  1283
                  N    ++ +  +    E+C+V YA
Sbjct  242   RSLSFNGGVDEN-EGGEDSLSEYCYVLYA  269



>ref|XP_006857698.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
 gb|ERN19165.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
Length=286

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/274 (49%), Positives = 176/274 (64%), Gaps = 17/274 (6%)
 Frame = +3

Query  480   DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYTCKIDLKTWQFWG  656
             +QS V C++ AKIA   R +T+TW K+L+ H LSI +E P + DNHYTCKI+LK W FW 
Sbjct  28    NQSTVNCLYEAKIAGFRRLVTVTWCKNLMAHDLSIALEKPGTSDNHYTCKIELKPWYFWS  87

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKG KSF +D +++D YWD R AKFS SPEP +DFYVAL    EVV+L+GD K EAFK+T
Sbjct  88    KKGFKSFEIDGKKLDFYWDLRTAKFSGSPEPFADFYVALVFEEEVVLLMGDLKKEAFKKT  147

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLG-RGKREHNIIIETDLSGPTEPEMWISVDG  1013
             K+RP + DA L+ K+E V+ KR F TR     R  + H IIIE  ++G    E+WIS+DG
Sbjct  148   KARPSLTDAVLLSKREHVFGKRSFVTRARFDERVNKAHEIIIECPVNGILNHELWISIDG  207

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggk  1193
             +  ++V NL W+FRGN+T+MV+ + V+VFWDVHDW+F      + +G  +FIFK      
Sbjct  208   MVLIQVNNLQWKFRGNDTIMVNKLPVQVFWDVHDWIF-----GIGSGHALFIFKP-----  257

Query  1194  gegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                  D+    +    S      FC   YAWK E
Sbjct  258   -----DSPHSGEQRHFSGEGLTGFCLFLYAWKIE  286



>ref|XP_004490568.1| PREDICTED: uncharacterized protein LOC101492045 [Cicer arietinum]
Length=310

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 191/310 (62%), Gaps = 14/310 (5%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGH  572
              R+  +S +Q    N   +  +E   S   QS VTC + A +A   R +++ W K+L+ H
Sbjct  6     FRSQSVSTSQ-GSYNLAEKTTEEPVSSKVAQSTVTCFYQANVAGFWRNVSVLWCKNLMNH  64

Query  573   ALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPD  752
             +L I V++   ++ ++CKID+K W FW KKG K+F V+  +V+VYWD R+AKF+ SPEP 
Sbjct  65    SLHITVDSVGGESQFSCKIDVKPWHFWSKKGYKTFEVEGNQVEVYWDLRSAKFTGSPEPS  124

Query  753   SDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGR  932
             SD+YVAL +  EV++LLGD K +A+KRTKSRP +VDA L+ KKE+V+AK+ F T+     
Sbjct  125   SDYYVALVSDEEVMLLLGDYKKKAYKRTKSRPALVDAMLLVKKENVFAKKSFATKARFDE  184

Query  933   GKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVH  1112
              ++E  II+E+      +PEMWIS+DG+  + V NL W+FRGN+TVMV+   V+VFWDVH
Sbjct  185   KRKESEIIVESLTGATIDPEMWISIDGVVLLHVKNLQWKFRGNQTVMVNKQPVQVFWDVH  244

Query  1113  DWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPP---------EF  1265
             DW+F+   S    G G+FIFK G       +E  S  +    D  S            EF
Sbjct  245   DWLFSGSGS----GTGLFIFKPGPTEAENEKEGGSAVEGCESDDGSVAYYSTLNIATFEF  300

Query  1266  CHVFYAWKTE  1295
             C V YA+K E
Sbjct  301   CLVLYAYKIE  310



>ref|XP_003544282.1| PREDICTED: uncharacterized protein LOC100810973 [Glycine max]
 gb|KHN40039.1| hypothetical protein glysoja_009416 [Glycine soja]
Length=305

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 184/288 (64%), Gaps = 12/288 (4%)
 Frame = +3

Query  456   KEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDL  635
             +E   S   QS VTC + A +    R +++ W K+L+ H+L I V++   +  Y+CKID+
Sbjct  22    EEPLPSKVAQSTVTCFYQANVVGFWRNVSVLWCKNLMNHSLHITVDSVGGEVQYSCKIDV  81

Query  636   KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQK  815
             K W FW KKG K+F VD  +V++YWD R+AKF+ SPEP SD+YVAL +  EVV+LLGD K
Sbjct  82    KPWHFWSKKGYKTFEVDGNQVELYWDLRSAKFTGSPEPSSDYYVALVSDEEVVLLLGDYK  141

Query  816   SEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEM  995
              +A+KRTKSRP +VDA ++ KKE+V AK+ F T+      +++  I++++   GP++PEM
Sbjct  142   KKAYKRTKSRPALVDAMMLLKKENVLAKKSFSTKARFNEKRKDSEIVVDSSTGGPSDPEM  201

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             WIS+DGI  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F    S   +G G+FIFK
Sbjct  202   WISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF----SGSGSGHGLFIFK  257

Query  1176  QgnggkgegeeDNSLPQKSCDDSQS--------RPPEFCHVFYAWKTE  1295
              G       +E +++     DD              EFC V YA+K E
Sbjct  258   PGPPEAESEKEGSAVEGCESDDGSVGYFSTMNIATFEFCLVLYAYKIE  305



>gb|EPS70677.1| hypothetical protein M569_04081, partial [Genlisea aurea]
Length=300

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 186/288 (65%), Gaps = 21/288 (7%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S T Q+ VTC++ A IA  LR +T+ W+K+L+ H+LS+ V++   +   TCKIDLK W F
Sbjct  21    SKTPQTTVTCVYQAHIAGSLRNVTVLWAKNLMNHSLSLSVDSVDPEVVSTCKIDLKPWYF  80

Query  651   WGKKGLKSFNVD-QERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             W KKG ++F VD   +++VYWD R+AKFS SPEP SD+YVAL    EV +LLGD K + F
Sbjct  81    WAKKGYRTFEVDGSSQIEVYWDLRSAKFSGSPEPFSDYYVALVAEDEVALLLGDLKKKVF  140

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISV  1007
             KRTK+RP +V+A + +KKE+V+ K+ F TR    + K++H+I++E+ + GP EPEMWIS+
Sbjct  141   KRTKARPALVEAVIFYKKENVFGKKSFSTRAKFDQMKQDHDIVVESSILGPREPEMWISI  200

Query  1008  DGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgng  1187
             DGI  + V NL+W+FRGN+TV+V+   ++VFWDVH W+F        +G GVFIFK    
Sbjct  201   DGIVLIHVTNLHWKFRGNQTVIVNKQPIQVFWDVHSWLF----CVPGSGHGVFIFKSSEN  256

Query  1188  gkgegeeDNSLPQKSCDDSQ----SR--------PPEFCHVFYAWKTE  1295
                   + +S     CDDS+    SR          +F    YAWK E
Sbjct  257   EGESDNDSSS----HCDDSECSNSSRYFSTQSYSKKDFSLFLYAWKIE  300



>ref|XP_007049429.1| Uncharacterized protein TCM_002465 [Theobroma cacao]
 gb|EOX93586.1| Uncharacterized protein TCM_002465 [Theobroma cacao]
Length=311

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 167/243 (69%), Gaps = 4/243 (2%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCK  626
             E+      S   QS VT ++   I    R +TI W K+L+ HALSI+V +   D  Y+CK
Sbjct  24    EEPHPHTNSKNAQSAVTLVYQTNILGYWRNVTIMWCKNLMNHALSIMVNSMEGDAQYSCK  83

Query  627   IDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLG  806
             IDLK W FW KKG KSF V+ ++VDVYWD R+AKF++ PEP +++YVAL    EVV+LLG
Sbjct  84    IDLKPWHFWSKKGYKSFEVEGKQVDVYWDLRSAKFTTGPEPAAEYYVALVADEEVVLLLG  143

Query  807   DQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTE  986
             D K +A+KRTKSRP +V+  L +K+E+V+AK+ F TR      ++EH+I++E+  +G  +
Sbjct  144   DYKKKAYKRTKSRPALVEPLLFYKQENVFAKKSFATRARFDERRKEHDIVVESSTNGFKD  203

Query  987   PEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             PEMWIS+DG+  + V NL W+FRGN+TV+VD   V+V WDVHDW+F    +S   G G+F
Sbjct  204   PEMWISMDGVVLIHVRNLQWKFRGNQTVLVDKQPVQVLWDVHDWLF----TSAGTGHGLF  259

Query  1167  IFK  1175
             IFK
Sbjct  260   IFK  262



>ref|XP_003615564.1| hypothetical protein MTR_5g069570 [Medicago truncatula]
 gb|AES98522.1| DUF868 family protein [Medicago truncatula]
Length=309

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 187/293 (64%), Gaps = 16/293 (5%)
 Frame = +3

Query  453   QKEAEE---SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTC  623
             QK  EE   S   QS VTC++ A +A   R +++ W K+L+ H L + V++   D+ ++C
Sbjct  21    QKTIEEPVPSKVAQSTVTCLYQANVAGFWRNVSVLWCKNLMNHTLHVTVDSVGGDSQFSC  80

Query  624   KIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILL  803
             KID+K W FW KKG K+F V+   V+VYWD R+AKF+ SPEP SD+YVAL    EVV+LL
Sbjct  81    KIDVKPWPFWSKKGYKTFEVEGNHVEVYWDLRSAKFTGSPEPSSDYYVALVLDEEVVLLL  140

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+A L+ KKE+V+ K+ F T+      ++E+ I++++     T
Sbjct  141   GDYKKKAYKRTKSRPALVEAMLLVKKENVFGKKSFSTKARFDEKRKENEIVVDSLTGNST  200

Query  984   -EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              +PEMWIS+DGI  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F    S   +GPG
Sbjct  201   NDPEMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF----SGSGSGPG  256

Query  1161  VFIFKQgnggkgegeeDNSLPQKSCDDS--------QSRPPEFCHVFYAWKTE  1295
             +FIFK G       +E +++     DD          +   EFC V YA+K E
Sbjct  257   LFIFKPGPVEDESEKEGSAVQSCESDDGSLGYHSTLNNATFEFCLVLYAYKIE  309



>ref|XP_009778863.1| PREDICTED: uncharacterized protein LOC104228156 [Nicotiana sylvestris]
Length=309

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/298 (47%), Positives = 189/298 (63%), Gaps = 24/298 (8%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             P+NP+             QS VTC++ + I    R +T+ WSK+L+ H++++ V++   D
Sbjct  27    PVNPKNA-----------QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESD  75

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
              H TCKIDLK W FW KKG K F VD  +++ YWD R+AKFS SPEP SDFYVAL +  E
Sbjct  76    YHQTCKIDLKPWHFWAKKGYKIFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEE  135

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K +A+K+TKSRP +VDA L +KKE V+ K+ F TR    + K+E +I++E+ 
Sbjct  136   VVLLLGDYKKKAYKKTKSRPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESS  195

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
              SGP +PEMWIS+DGI  + + NL W+FRGNETV+V+   V+VFWDVH W+F     S  
Sbjct  196   TSGPRDPEMWISIDGIVLIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLF----CSPG  251

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCHVFYAWKTE  1295
             +G G+FIFK G        E++S+   S C D        S S+   FC   YAWK E
Sbjct  252   SGHGLFIFKPGASEDDSDREESSVGGGSDCSDHSKYYSTLSYSKASPFCLFLYAWKIE  309



>ref|XP_006366122.1| PREDICTED: uncharacterized protein LOC102584925 [Solanum tuberosum]
Length=308

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 190/298 (64%), Gaps = 24/298 (8%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             P+NP+             QS VTC++ + I    R +T+ WSK+L+ H++++ V++   D
Sbjct  26    PVNPKNA-----------QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESD  74

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
              H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP SDFYVAL +  E
Sbjct  75    YHQTCKIDLKPWHFWAKKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEE  134

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K +A+K+TKSRP +VDA L +KKE V+ K+ F TR    + K+E +I++E+ 
Sbjct  135   VVLLLGDYKKKAYKKTKSRPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESS  194

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
              +GP +PEMWIS+DGI  + + NL W+FRGNETV+V+   V+VFWDVH W+F     S  
Sbjct  195   TTGPRDPEMWISIDGIVLIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLF----CSPG  250

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCHVFYAWKTE  1295
             +G G+FIFK G       +E +S+   S C D        S S+   FC   YAWK E
Sbjct  251   SGHGLFIFKPGASEDDSDKEGSSVGGGSDCSDQSKYYSTLSYSKASPFCLFLYAWKIE  308



>ref|XP_004252365.1| PREDICTED: uncharacterized protein LOC101249896 [Solanum lycopersicum]
Length=308

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 190/298 (64%), Gaps = 24/298 (8%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             P+NP+             QS VTC++ + I    R +T+ WSK+L+ H++++ V++   D
Sbjct  26    PVNPKNA-----------QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESD  74

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
              H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP SDFYVAL +  E
Sbjct  75    YHQTCKIDLKPWHFWAKKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEE  134

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K +A+K+TKSRP +VDA L +KKE V+ K+ F TR    + K+E +I++E+ 
Sbjct  135   VVLLLGDYKKKAYKKTKSRPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESS  194

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
              +GP +PEMWIS+DGI  + + NL W+FRGNETV+V+   V+VFWDVH W+F     S  
Sbjct  195   TTGPRDPEMWISIDGIVLIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLF----CSPG  250

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCHVFYAWKTE  1295
             +G G+FIFK G       +E +S+   S C D        S S+   FC   YAWK E
Sbjct  251   SGHGLFIFKPGASEDDSDKEGSSVGGGSDCSDQSKYYSTLSYSKSSPFCLFLYAWKIE  308



>ref|XP_002524594.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37802.1| conserved hypothetical protein [Ricinus communis]
Length=311

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 185/283 (65%), Gaps = 14/283 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYTCKIDLKTWQFW  653
             T QS VTC++   I+     +T+ W K+L+ H+L++++ NP S    Y+CKIDLK W FW
Sbjct  33    TPQSTVTCVYQIHISGYWCNVTVLWCKNLMNHSLNLILNNPESGQIFYSCKIDLKPWLFW  92

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
              KKG KSF+++  +VD++WD R+A+FSSSPEP  D+YVAL + GEVV+LLGD K +A+K+
Sbjct  93    SKKGCKSFDLEGSQVDIHWDLRSARFSSSPEPYGDYYVALVSDGEVVLLLGDLKKKAYKK  152

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDG  1013
             TKSRP +VD TL +KKE+V+AK+ F TR      K+EH+I +E+  +GP +PEMWIS+DG
Sbjct  153   TKSRPALVDPTLFYKKENVFAKKSFSTRAKFDERKQEHDIAVESSTAGPKDPEMWISIDG  212

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK------  1175
             I  + V NL W+FRGN+TV+V+   V+VFWDVHDW+FN    +   G G+FIFK      
Sbjct  213   IVVIHVKNLQWKFRGNQTVIVNKQPVQVFWDVHDWLFN----TTGTGHGLFIFKPRSGDS  268

Query  1176  --QgnggkgegeeDNSLPQKSCDDSQSRP-PEFCHVFYAWKTE  1295
                 +        D S   K      + P PEF    YAWK E
Sbjct  269   DDDRDDSTHGTNSDTSDGSKYFSTKSTTPIPEFSLFLYAWKIE  311



>ref|XP_011022881.1| PREDICTED: uncharacterized protein LOC105124530 [Populus euphratica]
Length=309

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 178/284 (63%), Gaps = 13/284 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S T Q+ VTC + A +A   R +T+ W K+ + H L++++ N   +    CKIDLK W F
Sbjct  30    STTPQNTVTCAYQAYVAGYWRNLTVFWCKNHMNHTLNLIINNLEGEVCRNCKIDLKPWLF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF ++  +VD++WDFR+AKF+ SPEP SD+YVA+ +  E+V+ LGD K +A+K
Sbjct  90    WSKKGSKSFELEGCQVDLHWDFRSAKFAGSPEPASDYYVAVVSDEEIVLSLGDYKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             R  +RPP+V+A L  KKE V+ K+ F TR      K EH+II+E+   GP +PEMWIS+D
Sbjct  150   RANARPPLVEAILYLKKEHVFHKKTFSTRAKFDEKKHEHDIIVESSTGGPRDPEMWISMD  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg  1190
             GI  + V NL W+FRGN+TVM+    V+VFWDVHDW+F    S+   G G+FIFK G   
Sbjct  210   GIIMIHVRNLQWKFRGNQTVMLSRQPVQVFWDVHDWLF----SAPGTGHGLFIFKPGVSE  265

Query  1191  kgegeeDNSLPQKS---------CDDSQSRPPEFCHVFYAWKTE  1295
               +  + +S   +S            S S  PEFC   YAWK E
Sbjct  266   SEDDRDSSSYGAQSDTSDGSMYFSTRSVSATPEFCLFLYAWKIE  309



>ref|XP_003556772.1| PREDICTED: uncharacterized protein LOC100806502 [Glycine max]
Length=315

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 182/288 (63%), Gaps = 19/288 (7%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S + QS VT I+ A +A   R +++ W K+L+ H L++ V++   D  YTCKI +K W F
Sbjct  34    SKSSQSTVTFIYQANVAGYSRHVSVLWCKNLMNHTLNLKVDSTRGDFSYTCKIQVKPWYF  93

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             W KKG KSF VD  +V+VYWD R+A+F  SSPEP SD+Y+A+ +  EVV+LLGDQK +A+
Sbjct  94    WNKKGYKSFEVDGHQVEVYWDLRSARFVGSSPEPGSDYYLAMVSDEEVVLLLGDQKKKAY  153

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISV  1007
             KR K RP +V+A L+ K+ESV+AK+ F T+      ++E++I++E+   G  EPEMWIS+
Sbjct  154   KRMKMRPSIVEALLLVKRESVFAKKSFATKARFDEKRKENDIVVESSTFGNKEPEMWISI  213

Query  1008  DGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgng  1187
             DGI  + V NL W FRGN+TVMV+   V+VFWDVHDW+F    S   +GPG+FIFK G  
Sbjct  214   DGIVLIHVKNLQWNFRGNQTVMVNKQPVQVFWDVHDWLF----SVPGSGPGLFIFKAGPV  269

Query  1188  gkgegeeDNSLPQKSCDDSQSR------------PPEFCHVFYAWKTE  1295
                  +E+     + CD                 P E C V YA+K E
Sbjct  270   EVESEKEERV--NEGCDSDNGSCASGYYSTLSYAPSESCLVLYAYKLE  315



>ref|XP_009592922.1| PREDICTED: uncharacterized protein LOC104089679 [Nicotiana tomentosiformis]
Length=309

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 188/298 (63%), Gaps = 24/298 (8%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             P+NP+             QS VTC++ + I    R +T+ WSK+L+ H++++ V++   D
Sbjct  27    PVNPKNA-----------QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESD  75

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
              H TCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP SDFYVAL +  E
Sbjct  76    YHQTCKIDLKPWHFWAKKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEE  135

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD K +A+K+TKSRP +VDA L +KKE V+ K+ F TR    + K+E +I++E+ 
Sbjct  136   VVLLLGDYKKKAYKKTKSRPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESS  195

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
              SG  +PEMWIS+DGI  + + NL W+FRGNETV+V+   V+V WDVH W+F     S  
Sbjct  196   TSGLRDPEMWISIDGIVLIHIKNLQWKFRGNETVLVNKQPVQVLWDVHAWLF----CSPG  251

Query  1149  AGPGVFIFKQgnggkgegeeDNSLPQKS-CDD--------SQSRPPEFCHVFYAWKTE  1295
             +G G+FIFK G        E++S+   S C D        S S+   FC   YAWK E
Sbjct  252   SGHGLFIFKPGASEDDSDREESSVGGGSDCSDHSKYYSTLSYSKASPFCLFLYAWKIE  309



>ref|XP_002310533.1| hypothetical protein POPTR_0007s04630g [Populus trichocarpa]
 gb|EEE90983.1| hypothetical protein POPTR_0007s04630g [Populus trichocarpa]
Length=309

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 178/284 (63%), Gaps = 13/284 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S T Q+ VTC + A +A   R +T+ W K+ + H L++++ N   +    CKIDLK W F
Sbjct  30    STTPQNTVTCAYQAYVAGYWRNLTVFWCKNHMNHTLNLIINNLEGEVCCNCKIDLKPWLF  89

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKG KSF ++  +VD++WDFR+AKF+ SPEP SD+YVA+ +  E+V+ LGD K +A+K
Sbjct  90    WSKKGSKSFELEGCQVDLHWDFRSAKFAGSPEPASDYYVAVVSDEEIVLSLGDYKKKAYK  149

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVD  1010
             R  +RPP+V+A L  KKE V+ K+ F TR      K EH+II+E+   GP +PEMWIS+D
Sbjct  150   RANARPPLVEAILYLKKEHVFHKKTFSTRAKFDEKKHEHDIIVESSTGGPRDPEMWISMD  209

Query  1011  GIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg  1190
             GI  + V NL W+FRGN+TVM+    V+VFWDVHDW+F    ++   G G+FIFK G   
Sbjct  210   GIIMIHVRNLQWKFRGNQTVMLSRQPVQVFWDVHDWLF----TAPGTGHGLFIFKPGVSE  265

Query  1191  kgegeeDNSLPQKS---------CDDSQSRPPEFCHVFYAWKTE  1295
               +  + +S   +S            S S  PEFC   YAWK E
Sbjct  266   SEDDRDSSSYGAQSDTSDGSMYFSTRSVSATPEFCLFLYAWKIE  309



>ref|XP_010465151.1| PREDICTED: uncharacterized protein LOC104745569 [Camelina sativa]
Length=285

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 175/286 (61%), Gaps = 25/286 (9%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN---PSEDNHYTCKIDLKTWQFWG  656
             S V+ I++ +IA+  + I +TWSK++  H+L+I  EN     +++H   KIDL    FW 
Sbjct  6     SSVSLIYVVEIANTTQNIDVTWSKTISSHSLTIKAENLKDEQQNHHQEVKIDLSGSSFWA  65

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKGLK    +  RVDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K EA  RT
Sbjct  66    KKGLKRLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEALNRT  125

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWISVD  1010
             K +P   +A LV K E V+ KR F TRT  G G  +RE+ ++IET LSGP +PEMWI+VD
Sbjct  126   KKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWITVD  185

Query  1011  GIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgng  1187
             G+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK   G
Sbjct  186   GVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPKAG  241

Query  1188  gkgegeeDNSLPQKSC------------DDSQSRPPEFCHVFYAWK  1289
              +      N                   DDS    P++CHV YA K
Sbjct  242   FESRSLSYNGGYDDGDGGDVEGDVNVVEDDSS---PKYCHVLYAVK  284



>ref|XP_007146005.1| hypothetical protein PHAVU_006G004800g [Phaseolus vulgaris]
 gb|ESW17999.1| hypothetical protein PHAVU_006G004800g [Phaseolus vulgaris]
Length=315

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 173/254 (68%), Gaps = 5/254 (2%)
 Frame = +3

Query  417   AQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN  596
              Q  P+  R  ++     + + QS VTCI+   +A   R +++ W K+L+ H L++ V++
Sbjct  16    GQAPPLVERISEEPLPLPNRSSQSTVTCIYQTNVAGCWRNVSVLWCKNLMNHTLNLKVDS  75

Query  597   PSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS-SPEPDSDFYVAL  773
                +  YTCKID+K W FW KKG KSF +D  +V+VYWD R+A+FS  +PEP SD+YVA+
Sbjct  76    TGGEFSYTCKIDVKPWYFWNKKGYKSFELDGHQVEVYWDLRSARFSGGAPEPISDYYVAM  135

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
              +  EVV+LLGD K +A+KR K RP +V+A L+ K+ESV+AK+ F T+      +RE++I
Sbjct  136   VSEEEVVLLLGDYKKKAYKRMKMRPSIVEAMLLVKRESVFAKKSFATKARFDEKRRENDI  195

Query  954   IIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
             ++E+   G  EPEMWIS+DG+  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F   
Sbjct  196   VVESSTFGNKEPEMWISIDGLVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF---  252

Query  1134  SSSVAAGPGVFIFK  1175
              S   +GPG+FIFK
Sbjct  253   -SMSGSGPGLFIFK  265



>ref|XP_010552346.1| PREDICTED: uncharacterized protein LOC104822715 isoform X2 [Tarenaya 
hassleriana]
Length=250

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 160/236 (68%), Gaps = 8/236 (3%)
 Frame = +3

Query  585   VVENPSED-NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDF  761
             + ENP +D NH+T KIDL  W FWGKKGLK+   D  R+DVYWDFR AKFS+ PEP S F
Sbjct  16    IAENPKDDRNHHTVKIDLSGWSFWGKKGLKTLEADGTRIDVYWDFRQAKFSNVPEPSSGF  75

Query  762   YVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTML-GRGK  938
             YVAL +   VV+ +GD  +EA KRT+ RP   +A LV KKE VY KR F TRT   G G+
Sbjct  76    YVALVSQDVVVLTIGDLVNEAMKRTRKRPSAREAALVCKKEHVYGKRVFYTRTAFDGTGR  135

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHD  1115
             REH ++IET LSGP EPEMWI+VDG+ ++RVMNLNWRFRGNE V V + VAVE++WD+HD
Sbjct  136   REHEVVIETSLSGPEEPEMWITVDGVAAMRVMNLNWRFRGNEVVTVKEGVAVEIYWDIHD  195

Query  1116  WMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYA  1283
             W+F    SS     G+F+FKQ    +G     N    ++ +  +    E+C+V YA
Sbjct  196   WLFGSCGSSC----GLFVFKQKLVSEGRSLSFNGGVDEN-EGGEDSLSEYCYVLYA  246



>ref|XP_006299636.1| hypothetical protein CARUB_v10015817mg [Capsella rubella]
 gb|EOA32534.1| hypothetical protein CARUB_v10015817mg [Capsella rubella]
Length=288

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 178/286 (62%), Gaps = 22/286 (8%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH-----YTCKIDLKTWQF  650
             S V+ I++ +IA+  + + +TWSK++  H+L+I +EN  ++ H        KIDL    F
Sbjct  6     SSVSLIYVVEIANTSQNVDVTWSKTISSHSLTIKIENLKDEQHNHHNQQQVKIDLSGSSF  65

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKGLK+   +  RVDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K+EA K
Sbjct  66    WAKKGLKNLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSHNAVVLTIGDLKNEALK  125

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWIS  1004
             RTK  P   +A LV K+E V+ KR F TRT  G G  +RE+ ++IET LSGP +PEMWI+
Sbjct  126   RTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWIT  185

Query  1005  VDGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
             VDG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK  
Sbjct  186   VDGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPK  241

Query  1182  nggkgegeeDN----------SLPQKSCDDSQSRPPEFCHVFYAWK  1289
             +G +      N                 +D     P++CHV YA K
Sbjct  242   SGFESRSLSFNGGYGDGDADVDDHGDVVEDDDDSSPKYCHVLYAVK  287



>ref|XP_002884958.1| hypothetical protein ARALYDRAFT_478708 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61217.1| hypothetical protein ARALYDRAFT_478708 [Arabidopsis lyrata subsp. 
lyrata]
Length=292

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 178/281 (63%), Gaps = 19/281 (7%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN---PSEDNHYTCKIDLKTWQFWG  656
             S V+ +++ +IA   + + +TWSK++  H+L+I +EN      ++H   KIDL    FW 
Sbjct  6     SSVSLLYVVEIAKTTQNVDVTWSKTMSSHSLTIKIENLKDEQHNHHQPVKIDLSGSSFWA  65

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKGLKS   +  RVDVYWDFR AKFS+ PEP S FYV+L +    ++ +GD K+EA KRT
Sbjct  66    KKGLKSLEANGARVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNATILTMGDLKNEALKRT  125

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWISVD  1010
             K  P   +A LV K+E V+ KR F TRT  G G  +RE+ ++IET LSGP++PEMWI+VD
Sbjct  126   KKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPSDPEMWITVD  185

Query  1011  GIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgng  1187
             G+ ++R+MNLNWRFRGNE + V D V++E+FWDVHDW+F    SS     G+F+FK   G
Sbjct  186   GVPAIRIMNLNWRFRGNEVLTVSDGVSLEIFWDVHDWLFETSGSS----SGLFVFKPKAG  241

Query  1188  gkgegeeDNSLPQKSC-------DDSQSRPPEFCHVFYAWK  1289
              + +    N              DD  S  P++CHV YA K
Sbjct  242   FESKSLSFNGGYGDGEGEDHDVEDDDSS--PKYCHVLYAVK  280



>gb|KHN43917.1| hypothetical protein glysoja_025956 [Glycine soja]
Length=243

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 168/245 (69%), Gaps = 11/245 (4%)
 Frame = +3

Query  582   IVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSS-PEPDSD  758
             ++V+N  E+N YTCKIDL++ Q WGKKGLKSF +   RVD++WDFR AKFS++ P+P S 
Sbjct  1     MIVDNTLEENKYTCKIDLESGQSWGKKGLKSFEITGARVDIFWDFRRAKFSATGPQPYSG  60

Query  759   FYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGK  938
             +YVAL    EV++LLGD + +A++RTKS+P + +A L+ K+++VY K+ FCTR +L  GK
Sbjct  61    YYVALVYKKEVLLLLGDLEKDAYERTKSKPSLDEAALLCKRDNVYGKKMFCTRAILEDGK  120

Query  939   REHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDW  1118
              EH+++IE  L GP +PEMWIS+DG+ + R+MNL+WRFRGNE +MV+N+ V++FWDVHDW
Sbjct  121   TEHDVVIEASLCGPDDPEMWISIDGMLASRIMNLHWRFRGNEILMVNNLPVQIFWDVHDW  180

Query  1119  MFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPE-------FCHVF  1277
             +F +D   +  GP  F+FK                ++S   ++    E       FCH  
Sbjct  181   LFTND---LGLGPAFFVFKPVFLETTSDSNSIECLERSGGSNKRELLEENSSTQGFCHYL  237

Query  1278  YAWKT  1292
             YAW+T
Sbjct  238   YAWRT  242



>gb|EYU45840.1| hypothetical protein MIMGU_mgv1a019714mg [Erythranthe guttata]
Length=313

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 196/316 (62%), Gaps = 22/316 (7%)
 Frame = +3

Query  396   RNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHA  575
             R+  +S +  +P   +  +     ++A  Q+ VTC++   IA   R +T+ W K+L+ ++
Sbjct  4     RSQSLSTSDAQPFPQKLSNDPVTNKAA--QTTVTCVYQTHIAGFWRNVTVLWGKNLMNYS  61

Query  576   LSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
             LSI V++  ++  YTCKIDLK W FW KKG K+F VD  +++ YWD R+AKFS SPEP S
Sbjct  62    LSISVDSVEKEGVYTCKIDLKPWHFWAKKGYKAFEVDGNQMEAYWDLRSAKFSGSPEPVS  121

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             DFYV L +  EVV+LLGD K +A+KRTK+RP +VDA L +KKE+V+ K+ F TR    R 
Sbjct  122   DFYVVLVSEEEVVLLLGDLKKKAYKRTKARPALVDAMLFYKKENVFGKKSFSTRAKFDRK  181

Query  936   KREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHD  1115
             K+EH I++E+  SGP +PEMWIS+DGI  V ++NL W+FRGN+TV+V+   ++VFWDVH 
Sbjct  182   KKEHEIVVESSTSGPKDPEMWISIDGIVLVHIVNLQWKFRGNQTVLVNKQPIQVFWDVHA  241

Query  1116  WMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLP--------QKSCDD--------SQ  1247
             W+F    S+     G+FIFK G G     EE             +  C +        S 
Sbjct  242   WLFCGPGSN----HGLFIFKNGEGEGESDEEVEGEEDENGSKGDESECSENSKYFSTHSY  297

Query  1248  SRPPEFCHVFYAWKTE  1295
             S+  +FC   YAWK E
Sbjct  298   SKDSKFCLFLYAWKIE  313



>ref|XP_009135291.1| PREDICTED: uncharacterized protein LOC103859505 [Brassica rapa]
Length=291

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 176/289 (61%), Gaps = 25/289 (9%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED----NHYTCKIDLKTWQFW  653
             S V+ ++  +IAD  + I  TWS+++  H+L+I  EN   +    +H   KIDL    FW
Sbjct  6     SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             GKKGLKS   +  +VDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K+EA +R
Sbjct  66    GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLG--RGKREHNIIIETDLSGPTEPEMWISV  1007
             TK +P   +A LV K+E V+ KR F TRT  G    +RE+ ++IET LSGP +PEM+I+V
Sbjct  126   TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  1008  DGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgn  1184
             DG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK   
Sbjct  186   DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPKV  241

Query  1185  ggkgegeeDNSLPQKSCDDSQS--------------RPPEFCHVFYAWK  1289
             G +      N       DD  S                P++CHV YA K
Sbjct  242   GDESRTLSFNGGYDGENDDGNSGGDNDNCDDGGDGDESPKYCHVLYAVK  290



>ref|XP_010500251.1| PREDICTED: uncharacterized protein LOC104777658 [Camelina sativa]
Length=288

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/286 (46%), Positives = 173/286 (60%), Gaps = 22/286 (8%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT-----CKIDLKTWQF  650
             S V+ I++ +IA+  + + +TWSK++  H+L+I   NP+++          KIDL    F
Sbjct  6     SSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTNNPTDEQQNHHQQQQVKIDLSGSSF  65

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKGLKS   +  RVDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K EA  
Sbjct  66    WAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKMEALN  125

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWIS  1004
             RTK +P   +A LV K E V+ KR F TRT  G G  +RE+ ++IET LSGP +PEMWI+
Sbjct  126   RTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWIT  185

Query  1005  VDGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
             VDG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK  
Sbjct  186   VDGVSAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPK  241

Query  1182  nggkgegeeDNSLPQKSC----------DDSQSRPPEFCHVFYAWK  1289
              G +      N                 D      P++CHV YA K
Sbjct  242   AGFESRSLSYNGGYVDGDGDGDVEGDVNDLEDDSSPKYCHVLYAVK  287



>ref|XP_006407245.1| hypothetical protein EUTSA_v10022027mg [Eutrema salsugineum]
 gb|ESQ48698.1| hypothetical protein EUTSA_v10022027mg [Eutrema salsugineum]
Length=282

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 175/280 (63%), Gaps = 16/280 (6%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN----PSEDNHYTCKIDLKTWQFW  653
             S V+ +++ +IA+  + + +TWSK++  H+L+I +EN       ++H+  KIDL    FW
Sbjct  6     SSVSLLYVVEIANSTQNVDVTWSKTISSHSLTIKIENLKKEEQNNHHHQVKIDLGGSSFW  65

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
              KKGLKS   +  RVDVYWDFR  KFS+ PEP S FYV+L +   VV+ +GD K+EAF+R
Sbjct  66    AKKGLKSLEANGTRVDVYWDFRQTKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKNEAFQR  125

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLG--RGKREHNIIIETDLSGPTEPEMWISV  1007
             TK +P   +A LV K+E V+ KR F TRT  G    +RE+ ++IET LSGP +PEMWI+V
Sbjct  126   TKKKPSATEAALVSKQERVHGKRVFYTRTSFGGEASRRENEVVIETSLSGPNDPEMWITV  185

Query  1008  DGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgn  1184
             DG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK   
Sbjct  186   DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFESSGSS----SGLFVFKPKT  241

Query  1185  ggkgegeeDNSL-----PQKSCDDSQSRPPEFCHVFYAWK  1289
             G   +    N                    ++CHV YA K
Sbjct  242   GFDSKTLSFNGGYGGENDDFGDCGDDDSSTKYCHVLYAVK  281



>ref|NP_683561.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02790.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT68366.1| hypothetical protein At3g13229 [Arabidopsis thaliana]
 gb|AAV63905.1| hypothetical protein At3g13229 [Arabidopsis thaliana]
 gb|AEE75321.1| uncharacterized protein AT3G13229 [Arabidopsis thaliana]
Length=289

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/281 (47%), Positives = 178/281 (63%), Gaps = 19/281 (7%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN---PSEDNHYTCKIDLKTWQFWG  656
             S V+ I++ +IA   + + +TWSK+   H+L+I +EN     +++H   KIDL    FW 
Sbjct  6     SSVSLIYVVEIAKTPQNVDVTWSKTTSSHSLTIKIENVKDEQQNHHQPVKIDLSGSSFWA  65

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             KKGLKS   +  RVDVYWDFR AKFS+ PEP S FYV+L +    V+ +GD ++EA KRT
Sbjct  66    KKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNATVLTIGDLRNEALKRT  125

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWISVD  1010
             K  P   +A LV K+E V+ KR F TRT  G G  +RE+ ++IET LSGP++PEMWI+VD
Sbjct  126   KKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPSDPEMWITVD  185

Query  1011  GIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgng  1187
             G+ ++R+MNLNWRFRGNE V V D V++E+FWDVHDW+F    SS     G+F+FK   G
Sbjct  186   GVPAIRIMNLNWRFRGNEVVTVSDGVSLEIFWDVHDWLFEPSGSS----SGLFVFKPKAG  241

Query  1188  gkgegeeDNSLPQKSC-------DDSQSRPPEFCHVFYAWK  1289
              + +    N              DD  S  P++CHV YA K
Sbjct  242   FESKCLSFNGGYGDGEGEDHDVEDDDSS--PKYCHVLYAVK  280



>ref|NP_199638.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97007.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAZ52778.1| hypothetical protein At5g48270 [Arabidopsis thaliana]
 gb|ABE65575.1| hypothetical protein At5g48270 [Arabidopsis thaliana]
 gb|AED95644.1| uncharacterized protein AT5G48270 [Arabidopsis thaliana]
Length=322

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 185/306 (60%), Gaps = 25/306 (8%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             NP+   Q ++  S +  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NPKTVAQLKSAASPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK +   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVES  202

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               +G  EPEMWISVDGI  V V NL W+FRGN+ VMVD   V V++DVHDW+F   SS  
Sbjct  203   S-NGAAEPEMWISVDGIVVVNVKNLQWKFRGNQMVMVDRTPVMVYYDVHDWLFA--SSET  259

Query  1146  AAGPGVFIFKQgnggkgegeeDNSLPQKSCDDS--QSRP--------------PEFCHVF  1277
             AA  G+F+FK           D S       DS   S P               +FC   
Sbjct  260   AASSGLFLFKP---VPVGAMVDESFSDAEEGDSGGGSSPLSRYNSASSGFGPLHDFCLFL  316

Query  1278  YAWKTE  1295
             YAWK E
Sbjct  317   YAWKLE  322



>emb|CDY66553.1| BnaCnng51410D [Brassica napus]
Length=282

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 175/280 (63%), Gaps = 16/280 (6%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED----NHYTCKIDLKTWQFW  653
             S V+ ++  +IAD  + I  TWS+++  H+L+I  EN   +    +H   KIDL    FW
Sbjct  6     SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             GKKGLKS   +  +VDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K+EA +R
Sbjct  66    GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLG--RGKREHNIIIETDLSGPTEPEMWISV  1007
             TK +P   +A LV K+E V+ KR F TRT  G    +RE+ ++IET LSGP +PEM+I+V
Sbjct  126   TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  1008  DGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK---  1175
             DG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK   
Sbjct  186   DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPKV  241

Query  1176  --QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWK  1289
               +       G   ++       D     P++CHV YA K
Sbjct  242   GDESRTLSFNGGGGDNDNGDDGGDDGDESPKYCHVLYAVK  281



>ref|XP_009392096.1| PREDICTED: uncharacterized protein LOC103978120 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 181/301 (60%), Gaps = 21/301 (7%)
 Frame = +3

Query  438   PRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY  617
             P     ++  E  T Q  V  I+ A +  + R +T+ W+K+L+ H+LS+ ++  + ++  
Sbjct  4     PAATAHRDPAEEPTPQCSVISIYRAMVGGVPRNVTVVWTKNLMNHSLSVSIDKSNGESPL  63

Query  618   TCKIDLKTWQFWGK-KGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVV  794
             TCK+DLK W FW K KG KSF+ D ER+DV+W+ R+AKFS  PEP  ++YVAL  G EVV
Sbjct  64    TCKVDLKPWPFWSKLKGSKSFDDDSERLDVFWNLRSAKFSDGPEPLENYYVALVCGEEVV  123

Query  795   ILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLS  974
             +LLGD K +A+++T+SRP + D TL+ KKE+V+ K+CF +R      K+EH+II+   +S
Sbjct  124   MLLGDLKKKAYRKTRSRPSLEDVTLLSKKENVFGKKCFSSRVKFDDRKKEHDIIVVNSIS  183

Query  975   GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
             G  +PEMWIS+DGI  + V NL W+FRGNETV V+ V V+VFWDVH W+F    S    G
Sbjct  184   GHKDPEMWISIDGIVLIHVSNLQWKFRGNETVWVEQVPVQVFWDVHGWLFRGPGS----G  239

Query  1155  PGVFIFKQgnggkgegeeDNSLPQ--------------KSCDDSQSRPPEFCHVFYAWKT  1292
               +FIFK G           S  +               SC    S+  EFC   YAW+ 
Sbjct  240   HALFIFKPGLPASAAAGNRGSSGKPTSSRRNNSESSLVSSCGGGGSQ--EFCFFLYAWRM  297

Query  1293  E  1295
             +
Sbjct  298   D  298



>ref|XP_004502142.1| PREDICTED: uncharacterized protein LOC101513281 [Cicer arietinum]
Length=316

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 167/242 (69%), Gaps = 13/242 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDN-------HYTCKIDL  635
             T QS VTCI+   IA   R +T+ W K+L+ H L++ V++   +N       HY CKI++
Sbjct  34    TAQSTVTCIYQTNIAGHWRNVTVLWCKNLMNHTLNLKVDSTRGENNNNINQFHYNCKIEV  93

Query  636   KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEVVILLGDQ  812
             K W FW KKG KSF VD + VDVYWD R+AKF  SSPEP SD+YVAL +  +VV+LLGD 
Sbjct  94    KPWYFWNKKGYKSFEVDGQHVDVYWDLRSAKFCGSSPEPCSDYYVALVSDEDVVLLLGDY  153

Query  813   KSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT-EP  989
             K +A+KR K RP +V+ATL+ K+E+V+AK+ F T+      ++E +I++E+  +    +P
Sbjct  154   KKKAYKRLKMRPAIVEATLLVKRENVFAKKSFSTKAKFDEKRKESDIVVESSTAANNKDP  213

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EMWIS+DGI  + V NL W+FRGN+TVMV+   V+VFWDVHDW+F    S   +GPG+FI
Sbjct  214   EMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLF----SVSGSGPGLFI  269

Query  1170  FK  1175
             FK
Sbjct  270   FK  271



>ref|XP_010487075.1| PREDICTED: uncharacterized protein LOC104765102 isoform X1 [Camelina 
sativa]
Length=289

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 171/287 (60%), Gaps = 23/287 (8%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT-----CKIDLKTWQF  650
             S V+ I++ +IA+  + + +TWSK++  H+L+I   N  ++          KIDL    F
Sbjct  6     SSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTGNLKDEQQNHHQQQQVKIDLSGSSF  65

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKGLKS   +  RVDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K EA  
Sbjct  66    WAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEALN  125

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWIS  1004
             RTK +P   +A LV K E V+ KR F TRT  G G  +RE+ ++IET LSGP +PEMWI+
Sbjct  126   RTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWIT  185

Query  1005  VDGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
             VDG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK  
Sbjct  186   VDGVSAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPK  241

Query  1182  nggkgegeeDNSLPQKSC-----------DDSQSRPPEFCHVFYAWK  1289
              G +      N                  D      P++CHV YA K
Sbjct  242   AGFESRSLSYNGAGYGDGDGDGDVEGDVNDVEDDSSPKYCHVLYAVK  288



>emb|CDX82547.1| BnaA03g32740D [Brassica napus]
Length=291

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 173/289 (60%), Gaps = 25/289 (9%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED----NHYTCKIDLKTWQFW  653
             S V+ ++  +IAD  + I  TWS+++  H+L+I  EN   +    +H   KIDL    FW
Sbjct  6     SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             GKKGLKS   +  +VDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K+EA +R
Sbjct  66    GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLG--RGKREHNIIIETDLSGPTEPEMWISV  1007
             TK +P   +A LV K+E V+ KR F TRT  G    +RE+ ++IET LSGP +PEM+I+V
Sbjct  126   TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  1008  DGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgn  1184
             DG+ ++R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK   
Sbjct  186   DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPKV  241

Query  1185  ggkgegeeDNS--------------LPQKSCDDSQSRPPEFCHVFYAWK  1289
             G +      N                            P++CHV YA K
Sbjct  242   GDESRTLSFNGGYDGENDDGNSGGDNDNGDDGGDGDESPKYCHVLYAVK  290



>emb|CDY48744.1| BnaA02g30050D [Brassica napus]
Length=304

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 178/282 (63%), Gaps = 11/282 (4%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R IT+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+ + V+V+WD RAAK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGKFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+   G  
Sbjct  149   GDLKHKAYKRTKSRPALVEGYIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-HGGD  207

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEMWISVDGI  + V NL W+FRGN+ V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  208   DPEMWISVDGIVIMHVKNLQWKFRGNQMVLVDKTHVMVYYDVHDWLFG--SSESTASSGL  265

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWK  1289
             F+FK    G    +  N     S         +FC   YAWK
Sbjct  266   FVFKPVAVGGMVDDRYN-----SASSGYGTLNDFCLFLYAWK  302



>ref|XP_002865625.1| hypothetical protein ARALYDRAFT_917720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41884.1| hypothetical protein ARALYDRAFT_917720 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 185/306 (60%), Gaps = 25/306 (8%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             NP+   Q ++  + +  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NPKTVAQLKSAATPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G K+F+V+   V+V+WD R+AK +   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKAFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      K+EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQKKEHEVVVES  202

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               +G  +PEMWISVDGI  V V NL W+FRGN+ V+VD   V V++DVHDW+F   SS  
Sbjct  203   S-NGAADPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFA--SSET  259

Query  1146  AAGPGVFIFKQgnggkgegeeDNSLPQKSCDDS--QSRP--------------PEFCHVF  1277
             AA  G+F+FK           D S       DS   S P               +FC   
Sbjct  260   AATSGLFLFKP---VPVGAMVDESFSDAEEGDSGGGSSPLSRYNSASSGYGPLHDFCLFL  316

Query  1278  YAWKTE  1295
             YAWK E
Sbjct  317   YAWKLE  322



>gb|KHN46178.1| hypothetical protein glysoja_022820 [Glycine soja]
Length=248

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 168/252 (67%), Gaps = 12/252 (5%)
 Frame = +3

Query  564   IGHALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSP  743
             + H+L + V++   +  Y+CKID+K W FW KKG K+F VD  +V++YWD R+AKF+ SP
Sbjct  1     MNHSLHVTVDSVGGEVQYSCKIDVKPWHFWSKKGYKTFEVDGNQVELYWDLRSAKFAGSP  60

Query  744   EPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTM  923
             EP SD+YVAL +  EVV+LLGD K +A+KRTKSRP +VDA L+ KKE+V+AK+ F T+  
Sbjct  61    EPSSDYYVALVSDEEVVLLLGDYKKKAYKRTKSRPALVDAMLLVKKENVFAKKSFSTKAR  120

Query  924   LGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFW  1103
                 ++++ I++++   GP++PEMWIS+DGI  + V NL W+FRGN+TVMV+   V+VFW
Sbjct  121   FDEKRKDNEIVVDSLTGGPSDPEMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFW  180

Query  1104  DVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQS--------RPP  1259
             DVHDW+F    S   +GPG+FIFK G       +E +++     DD              
Sbjct  181   DVHDWLF----SGSGSGPGLFIFKPGPPEAESEKEGSAVEGCESDDGSVGYFSTMNIATF  236

Query  1260  EFCHVFYAWKTE  1295
             EFC V YA+K E
Sbjct  237   EFCLVLYAYKIE  248



>ref|XP_010495442.1| PREDICTED: uncharacterized protein LOC104772538 [Camelina sativa]
Length=322

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 186/303 (61%), Gaps = 19/303 (6%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             NP+   Q ++  + +  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NPKTVAQLKSAATPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK +   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVES  202

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               +G  EPEMWISVDGI  V V NL W+FRGN+ V+VD   V V++DVHDW+F   +S  
Sbjct  203   S-NGAAEPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFA--TSET  259

Query  1146  AAGPGVFIFKQgnggkg------------egeeDNSLPQKSCDDSQSRP-PEFCHVFYAW  1286
              A  G+F+FK    G               G   + L + +   S   P  +FC   YAW
Sbjct  260   TATSGLFLFKPVAVGAMVDDCFSDAEEGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAW  319

Query  1287  KTE  1295
             K E
Sbjct  320   KLE  322



>ref|XP_010487076.1| PREDICTED: uncharacterized protein LOC104765102 isoform X2 [Camelina 
sativa]
Length=289

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 170/287 (59%), Gaps = 23/287 (8%)
 Frame = +3

Query  486   SYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT-----CKIDLKTWQF  650
             S V+ I++ +IA+  + + +TWSK++  H+L+I   N  ++          KIDL    F
Sbjct  6     SSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTGNLKDEQQNHHQQQQVKIDLSGSSF  65

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W KKGLKS   +  RVDVYWDFR AKFS+ PEP S FYV+L +   VV+ +GD K EA  
Sbjct  66    WAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEALN  125

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG--KREHNIIIETDLSGPTEPEMWIS  1004
             RTK +P   +A LV K E V+ KR F TRT  G G  +RE+ ++IET LSGP +PEMWI+
Sbjct  126   RTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWIT  185

Query  1005  VDGIESVRVMNLNWRFRGNETVMV-DNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
             VDG+  +R+MNLNWRFRGNE V V D V+VE+FWDVHDW+F    SS     G+F+FK  
Sbjct  186   VDGVPLIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSS----SGLFVFKPK  241

Query  1182  nggkgegeeDNSLPQKSC-----------DDSQSRPPEFCHVFYAWK  1289
              G +      N                  D      P++CHV YA K
Sbjct  242   AGFESRSLSYNGAGYGDGDGDGDVEGDVNDVEDDSSPKYCHVLYAVK  288



>ref|XP_010484925.1| PREDICTED: uncharacterized protein LOC104763219 [Camelina sativa]
Length=322

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 186/303 (61%), Gaps = 19/303 (6%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             NP+   Q ++  + +  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NPKTVAQLKSAATPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK +   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNIVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVES  202

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               +G  EPEMWISVDGI  V V NL W+FRGN+ V+VD   V V++DVHDW+F   +S  
Sbjct  203   S-NGAAEPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFA--TSET  259

Query  1146  AAGPGVFIFKQgnggkg------------egeeDNSLPQKSCDDSQSRP-PEFCHVFYAW  1286
              A  G+F+FK    G               G   + L + +   S   P  +FC   YAW
Sbjct  260   TATSGLFLFKPVAVGAMVDDCFSDAEDGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAW  319

Query  1287  KTE  1295
             K E
Sbjct  320   KLE  322



>gb|KFK31309.1| hypothetical protein AALP_AA6G096000 [Arabis alpina]
Length=326

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 169/253 (67%), Gaps = 9/253 (4%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             NP+   Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NPKTVAQLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKMSGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFMYSKKESIFGKKTFATRARFDEQRKEHEVVVES  202

Query  966   DLSGPT---EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDS  1136
                G     EPEMWISVDGI  V V NL W+FRGN+ V+VD   V V++DVHDW+F    
Sbjct  203   SNGGVAEEREPEMWISVDGIVLVHVRNLQWKFRGNQMVVVDRTPVMVYYDVHDWLFG---  259

Query  1137  SSVAAGPGVFIFK  1175
             SS  A  G+F+FK
Sbjct  260   SSETAASGLFVFK  272



>ref|XP_010445941.1| PREDICTED: uncharacterized protein LOC104728686 [Camelina sativa]
Length=322

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 190/317 (60%), Gaps = 19/317 (6%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGH  572
             +R+   + A     NP+   Q ++  + +  S VTC + A +A   R +T+ WSK+L+ H
Sbjct  9     IRSQPTAFAAKITDNPKTVAQLKSAATPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNH  68

Query  573   ALSIVVENPSEDNHYTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SP  743
             +L+++V +   D +Y CKIDL K WQFW K+G  SF+V+   V+V+WD R+AK +   SP
Sbjct  69    SLTVMVSSLDNDMNYCCKIDLVKPWQFWSKRGSNSFDVEGNFVEVFWDLRSAKLAGNGSP  128

Query  744   EPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTM  923
             EP SD+YVA+ +  EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR  
Sbjct  129   EPVSDYYVAVVSDEEVVLLLGDLKEKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRAR  188

Query  924   LGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFW  1103
                 ++EH +++E+  +G  EPEMWISVDGI  V V NL W+FRGN+ V+VD   V V++
Sbjct  189   FDEQRKEHEVVVESS-NGAAEPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYY  247

Query  1104  DVHDWMFNDDSSSVAAGPGVFIFKQgnggkg------------egeeDNSLPQKSCDDSQ  1247
             DVHDW+F   +S   A  G+F+FK    G               G   + L + +   S 
Sbjct  248   DVHDWLFA--TSETTATSGLFLFKPVAVGAMVDDCFSDAEEGDSGGGSSPLSRYNSASSG  305

Query  1248  SRP-PEFCHVFYAWKTE  1295
               P  +FC   YAWK E
Sbjct  306   YGPLHDFCLFLYAWKLE  322



>ref|XP_003601505.1| hypothetical protein MTR_3g082430 [Medicago truncatula]
 gb|AES71756.1| DUF868 family protein [Medicago truncatula]
Length=293

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/291 (44%), Positives = 184/291 (63%), Gaps = 15/291 (5%)
 Frame = +3

Query  456   KEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYTCKID  632
             +E   + T QS VTC++   I    R I++ W K+LI H L++ V++   E  H  CKI+
Sbjct  7     EEPLPTKTAQSTVTCLYQTSIGGQWRNISVLWCKNLINHTLNLKVDSARGEQFHQNCKIE  66

Query  633   LKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSS-PEPDSDFYVALATGGEVVILLGD  809
             +K W FW +KG +SF+VD  ++DVYWD R+AKF+ + PEP SD+YV L +  EVV+LLGD
Sbjct  67    VKPWCFWNRKGYRSFDVDGNQIDVYWDLRSAKFAGNCPEPCSDYYVMLVSDEEVVLLLGD  126

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              K +A+KR K R  +V+ATL+ K+E+V+AK+ F T+      ++E +I++E+  +G  +P
Sbjct  127   YKKKAYKRMKMRQALVEATLLVKRENVFAKKSFSTKAKFDEKRKESDIVVESSTAGNKDP  186

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EMWIS+DGI  + + NL W+FRGN+TVMV+   V VFWDV+DW+F    S   +GPG+FI
Sbjct  187   EMWISIDGIVLIHIKNLQWKFRGNQTVMVNKQPVHVFWDVYDWLF----SVSGSGPGLFI  242

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSR---------PPEFCHVFYAWKTE  1295
             FK G       +E+  L  +S D S +          P E C V  A+K E
Sbjct  243   FKPGPTEVESDKEEKGLEGESDDGSATSGYYSTKSYTPFESCLVLCAYKLE  293



>ref|XP_006281899.1| hypothetical protein CARUB_v10028103mg [Capsella rubella]
 gb|EOA14797.1| hypothetical protein CARUB_v10028103mg [Capsella rubella]
Length=322

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 185/303 (61%), Gaps = 19/303 (6%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             +P+   Q ++  + +  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    SPKTVAQLKSAATPSPHSTVTCGYQAHVAGYFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK +   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAIVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEGFIYFKKESIFGKKSFSTRARFDEQRKEHEVVVES  202

Query  966   DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSV  1145
               +G  EPEMWISVDGI  V V NL W+FRGN+ V+VD   + V++DVHDW+F   +S  
Sbjct  203   S-NGAAEPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPIMVYYDVHDWLFA--TSET  259

Query  1146  AAGPGVFIFKQgnggkg------------egeeDNSLPQKSCDDSQSRP-PEFCHVFYAW  1286
              A  G+F+FK    G                   + L + +   S   P  +FC   YAW
Sbjct  260   TATSGLFLFKPVAVGSMVDECYSDEEEGDSAGGSSPLSRYNSASSGYGPLHDFCLFLYAW  319

Query  1287  KTE  1295
             K E
Sbjct  320   KLE  322



>ref|XP_006395202.1| hypothetical protein EUTSA_v10005686mg [Eutrema salsugineum]
 gb|ESQ32488.1| hypothetical protein EUTSA_v10005686mg [Eutrema salsugineum]
Length=329

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 185/309 (60%), Gaps = 24/309 (8%)
 Frame = +3

Query  435   NPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH  614
             N +   Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +
Sbjct  23    NTKTVAQLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMN  82

Query  615   YTCKIDL-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGG  785
             Y CKIDL K WQFW K+G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  
Sbjct  83    YCCKIDLVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAVVSDE  142

Query  786   EVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET  965
             EVV+LLGD K +A+KRTKSRP +V+A +  KKES++ K+ F TR      +++H +++E+
Sbjct  143   EVVLLLGDLKQKAYKRTKSRPALVEAFIYFKKESIFGKKTFSTRARFDEQRKDHEVVVES  202

Query  966   DLSGPT-----EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFND  1130
                G +     +PEMWISVDGI  V V NL W+FRGN+ V+VD   V V++DVHDW+F  
Sbjct  203   SNGGVSTREEKDPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFG-  261

Query  1131  DSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRP--------------PEFC  1268
              SS   A  G+F+FK    G    +  +   +   +   S P               +FC
Sbjct  262   -SSESTASSGLFVFKPVAVGAMVDDGFSDAEEGDSNGGGSSPLSRYNSASSGYGPLHDFC  320

Query  1269  HVFYAWKTE  1295
                YAWK E
Sbjct  321   LFLYAWKLE  329



>emb|CDY05690.1| BnaC02g38470D [Brassica napus]
Length=300

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 175/285 (61%), Gaps = 21/285 (7%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R IT+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD RAAK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGNFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+  +G  
Sbjct  149   GDSKHKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-NGGD  207

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEMWISVDGI  + V NL W+FRGN+ V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  208   DPEMWISVDGIVIMHVKNLQWKFRGNQMVLVDKTHVMVYYDVHDWLFG--SSESTASSGL  265

Query  1164  FIFKQgnggkgegeeDNSLP---QKSCDDSQSRPPEFCHVFYAWK  1289
             F+               S P     S         +FC   YAWK
Sbjct  266   FV------------GGGSSPLSRYNSASSGYGTLHDFCLFLYAWK  298



>ref|XP_009387555.1| PREDICTED: uncharacterized protein LOC103974443 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 179/299 (60%), Gaps = 21/299 (7%)
 Frame = +3

Query  441   RREDQKEAEESATDQSYVTC----IHLAKIADLLRTITITWSKSLIGHALSIVVENPSED  608
             R    K AEE+A  ++   C     + AKI  + R +T+ WSK+L+ H+LS+ +E  S  
Sbjct  10    RDPADKHAEEAAGGKTPPQCSVISTYRAKIGGVPRIVTVVWSKNLMNHSLSVSIEKGSS-  68

Query  609   NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGE  788
                TCK+DLK W F  KKG KSF+VD +++DV W+FR AKFS  PEP   +YVAL    E
Sbjct  69    --LTCKVDLKPWPFRSKKGSKSFDVDGKQIDVSWNFRLAKFSDGPEPTEGYYVALVCDEE  126

Query  789   VVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD  968
             VV+LLGD+K +A+K+T+SRP + +ATLV KKE+V+ K+CF  R       +EH+I++   
Sbjct  127   VVLLLGDRKKKAYKKTRSRPSLEEATLVSKKENVFGKKCFAARVRFDGRNKEHDIVVANS  186

Query  969   LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
             ++   +PEMWIS+DG+  + V +L W+FRGNETV V+ V V+V WDVHDW+F    S   
Sbjct  187   IAEHKDPEMWISIDGVILIHVNHLQWKFRGNETVWVEQVPVQVLWDVHDWLFRGPGS---  243

Query  1149  AGPGVFIFKQgn-ggkgegeeDNSLPQKSCDD---------SQSRPPEFCHVFYAWKTE  1295
              G  +F+FK G      E + D   P  S  +              PEFC   YAWK E
Sbjct  244   -GHALFMFKPGLPALAAEEKHDGGDPVSSNTESSMVSSGGGGDDGSPEFCFFLYAWKME  301



>gb|EPS70399.1| hypothetical protein M569_04363 [Genlisea aurea]
Length=272

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/284 (43%), Positives = 178/284 (63%), Gaps = 29/284 (10%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             + K  + +  + S VTC++ A IA   R +T+ W+K+L+ ++LSI +E   +    TC+I
Sbjct  16    ENKSVQNNHNNNSSVTCMYRAFIAGFWRNVTVFWNKNLMNYSLSISIEGCRDS---TCRI  72

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K+WQFW KKG K+F VD ++V+ YWD R+AKFS S +P SD+YVAL +  EVV+LLGD
Sbjct  73    DVKSWQFWAKKGYKTFEVDGKQVEAYWDLRSAKFSGSSQPLSDYYVALISDEEVVLLLGD  132

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
             ++ +A+KR+KSRP + D  ++ K E  + KR F TR      +RE  I++E+ +SG  EP
Sbjct  133   KRKKAYKRSKSRPALSDPIMLSKTEHAFGKRSFSTRASFD-NRREQEIVVESSVSGSKEP  191

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNV-AVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             EMWIS+DGI  + V NL W+FRGN+TV++    AV+V+WDVH W+F+ +      G G+F
Sbjct  192   EMWISIDGIVVIHVRNLQWKFRGNQTVVIGKQEAVQVYWDVHAWLFSGN-----GGYGLF  246

Query  1167  IFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVF-YAWKTE  1295
             +FK G   + E   D                  C +F YAWK E
Sbjct  247   LFKAGVAEEEEEGSD------------------CRLFLYAWKIE  272



>ref|XP_009129718.1| PREDICTED: uncharacterized protein LOC103854529 [Brassica rapa]
Length=322

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 165/244 (68%), Gaps = 6/244 (2%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R IT+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD RAAK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGNFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+   G  
Sbjct  149   GDLKHKAYKRTKSRPALVEGYIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-HGGD  207

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEMWISVDGI  + V NL W+F GN+ V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  208   DPEMWISVDGIVIMHVTNLQWKFWGNQMVLVDKTHVMVYYDVHDWLFG--SSESTASSGL  265

Query  1164  FIFK  1175
             F+FK
Sbjct  266   FVFK  269



>emb|CDX86317.1| BnaA06g30340D [Brassica napus]
Length=307

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 179/285 (63%), Gaps = 10/285 (4%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+  +   
Sbjct  149   GDLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-NDEK  207

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             + EMWIS+DGI  V V NL W+FRGN  V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  208   DQEMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFG--SSESTASSGL  265

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRP-PEFCHVFYAWKTE  1295
             F+FK        G   + L + +   S   P  EFC   YAWK E
Sbjct  266   FLFKP---DGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  307



>ref|XP_009151628.1| PREDICTED: uncharacterized protein LOC103874941 isoform X2 [Brassica 
rapa]
Length=312

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 179/298 (60%), Gaps = 20/298 (7%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  18    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  77

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  78    LVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLL  137

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+  +   
Sbjct  138   GDLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-NDEK  196

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             + EMWIS+DGI  V V NL W+FRGN  V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  197   DQEMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFG--SSESTASSGL  254

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRP--------------PEFCHVFYAWKTE  1295
             F+FK    G    +E  S  +       S P               EFC   YAWK E
Sbjct  255   FLFKPVAVGAMMVDEYFSDAEDGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  312



>gb|KHN09942.1| hypothetical protein glysoja_043621 [Glycine soja]
Length=251

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 163/257 (63%), Gaps = 19/257 (7%)
 Frame = +3

Query  564   IGHALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKF-SSS  740
             + H L++ V++   D  YTCKI +K W FW KKG KSF VD  +V+VYWD R+A+F  SS
Sbjct  1     MNHTLNLKVDSTRGDFSYTCKIQVKPWYFWNKKGYKSFEVDGHQVEVYWDLRSARFVGSS  60

Query  741   PEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRT  920
             PEP SD+Y+A+ +  EVV+LLGDQK +A+KR K RP +V+A L+ K+ESV+AK+ F T+ 
Sbjct  61    PEPGSDYYLAMVSDEEVVLLLGDQKKKAYKRMKMRPSIVEALLLVKRESVFAKKSFATKA  120

Query  921   MLGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVF  1100
                  ++E++I++E+   G  EPEMWIS+DGI  + V NL W FRGN+TVMV+   V+VF
Sbjct  121   RFDEKRKENDIVVESSTFGNKEPEMWISIDGIVLIHVKNLQWNFRGNQTVMVNKQPVQVF  180

Query  1101  WDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSR---------  1253
             WDVHDW+F    S   +GPG+FIFK G       +E+     + CD              
Sbjct  181   WDVHDWLF----SVPGSGPGLFIFKAGPVEVESEKEERV--NEGCDSDNGSCASGYYSTL  234

Query  1254  ---PPEFCHVFYAWKTE  1295
                P E C V YA+K E
Sbjct  235   SYAPSESCLVLYAYKLE  251



>ref|XP_009151627.1| PREDICTED: uncharacterized protein LOC103874941 isoform X1 [Brassica 
rapa]
Length=323

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 179/298 (60%), Gaps = 20/298 (7%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L+++V +   D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  EVV+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKES++ K+ F TR      ++EH +++E+  +   
Sbjct  149   GDLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESS-NDEK  207

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             + EMWIS+DGI  V V NL W+FRGN  V+VD   V V++DVHDW+F   SS   A  G+
Sbjct  208   DQEMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFG--SSESTASSGL  265

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRP--------------PEFCHVFYAWKTE  1295
             F+FK    G    +E  S  +       S P               EFC   YAWK E
Sbjct  266   FLFKPVAVGAMMVDEYFSDAEDGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  323



>gb|EYU21422.1| hypothetical protein MIMGU_mgv1a022950mg [Erythranthe guttata]
Length=311

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 184/297 (62%), Gaps = 15/297 (5%)
 Frame = +3

Query  438   PRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY  617
             P +    E     T QS VTC++ A IA   R +T+ WSK+++ ++L I VE+  ++   
Sbjct  19    PAQRLTNEPVTQKTAQSTVTCVYQAHIAGFWRNVTVLWSKNVMNYSLCISVESVDDEQAS  78

Query  618   TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVI  797
             TCKIDLK W FW KKG K+F VD  ++D YWD ++AKFS SPEP +++YV L +  EVV+
Sbjct  79    TCKIDLKPWHFWAKKGYKTFEVDGNQLDAYWDLKSAKFSGSPEPFAEYYVVLVSEEEVVL  138

Query  798   LLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSG  977
             LLGD K +A+KR K+RP +VDA + +KKE V+ K+ F TR    + KREH+I++E+  SG
Sbjct  139   LLGDSKKKAYKRAKARPGLVDAVMFYKKEHVFGKKSFSTRAAFDQKKREHDIVVESSTSG  198

Query  978   PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP  1157
             P EPEMWIS+DGI  + V NL W+FRGN+TV+V+   V+VFWDVH W+F     +  +  
Sbjct  199   PREPEMWISIDGIVLIHVRNLQWKFRGNQTVLVNKQPVQVFWDVHAWLF----CAPGSNH  254

Query  1158  GVFIFKQgng----------gkgegeeDNSLPQK-SCDDSQSRPPEFCHVFYAWKTE  1295
             G+FIFK G                   D S P +     S S+  +FC   YAWK E
Sbjct  255   GLFIFKPGAAECDSDLDEEDENKGDGSDCSGPSRYYSTQSYSKASDFCLFLYAWKIE  311



>gb|KDP22998.1| hypothetical protein JCGZ_01720 [Jatropha curcas]
Length=721

 Score =   244 bits (623),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 162/236 (69%), Gaps = 16/236 (7%)
 Frame = +3

Query  618   TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVI  797
             TCKIDLK W FW KKG KSF ++  +VD++WD R+A+F  SPEP SDFYVAL + GEVV+
Sbjct  492   TCKIDLKPWIFWTKKGCKSFELEGSQVDIHWDLRSARFCGSPEPCSDFYVALVSDGEVVL  551

Query  798   LLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSG  977
             LLGD K +A+KRTK+RP + +A L +KKE+V+AK+ F TR    + K+EH+I++E+  +G
Sbjct  552   LLGDHKKKAYKRTKARPALSEAVLFYKKENVFAKKSFSTRAKFDQQKQEHDIVVESSTTG  611

Query  978   PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP  1157
               +PEMWIS+DG+  + V NL W+FRGN+TVMV+   V+VFWDVHDW+FN+     A G 
Sbjct  612   HKDPEMWISIDGLVVIHVKNLQWKFRGNQTVMVNTQPVQVFWDVHDWLFNN----AATGH  667

Query  1158  GVFIFKQgnggkgegeeDNSLPQKSCDDSQSRP----------PEFCHVFYAWKTE  1295
             G+FIFK   G     ++ +S P+ + D+S S            PEFC   YAWK E
Sbjct  668   GLFIFKP--GAPECDDDKDSSPRAASDNSDSSKYFSAKSNASTPEFCLFLYAWKIE  721



>dbj|BAK07193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=315

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 177/291 (61%), Gaps = 23/291 (8%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVE---------NPSEDNH  614
             +  SAT Q Y   ++L +I    R +T  W+KS+I  + +I ++            +D  
Sbjct  35    SSSSATAQCYAMTVYLVRINGAQRLVTAVWNKSIINQSFTITIDRHGDGASSCGGGDDGT  94

Query  615   YTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEV  791
              + K++LK W FW KKGLKSF +D  R+D++WD R+AKF +SSPEP S ++VAL +  +V
Sbjct  95    LSLKVELKPWPFWSKKGLKSFFLDGHRLDIFWDLRSAKFPASSPEPASGYFVALVSQEQV  154

Query  792   VILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDL  971
             V+ LGD K +A+KR+K RP + DA  + ++ESV+ +R F  R  L   K++H+I+IE  L
Sbjct  155   VLTLGDLKKDAYKRSKCRPSLEDAVPLCRRESVFGRRSFVARAWLNASKKDHDIVIEASL  214

Query  972   SGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAA  1151
             +GP EPEM I+VDG   V+V NL W+FRGNETV+V+   V+V WDVHDW+F        A
Sbjct  215   AGPREPEMAITVDGRALVQVKNLQWKFRGNETVLVNQSPVQVLWDVHDWIF--------A  266

Query  1152  GPG---VFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             GPG   VF FK   G   E + D++    +     + P ++    +AWKT+
Sbjct  267   GPGSQAVFAFKP--GAPPEVDSDDAAELDNGSGIPADPADYSFFLHAWKTD  315



>ref|XP_002977922.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
 gb|EFJ21260.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
Length=294

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 156/231 (68%), Gaps = 7/231 (3%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  K+    R IT+TW K+L+G  LS+ V++P+   HYTCK+D+K W FW K+
Sbjct  27    QNLVTCVYQTKLWGHCRLITVTWCKNLMGQGLSVNVDDPA--CHYTCKVDMKPWFFWKKQ  84

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+  VD ++V+V+WD  +AK+   PEP   FY+A+ + GEV +LLGD   EA+K+T++
Sbjct  85    GSKAMEVDGQKVEVFWDLSSAKYLCGPEPQDGFYLAIVSDGEVALLLGDMVREAYKKTQA  144

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RPP ++A L+ ++E V+ KR + T+   G   + H+I+IE   SG  EP +++ VD    
Sbjct  145   RPPTIEAMLLSRREHVFGKRYYTTKAQFGESGKTHDIMIECHTSGAREPRLYVRVDRQLV  204

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             ++V  L W+FRGN+T++VD + VEVFWDVH+W+FN      + G  VF+F+
Sbjct  205   IQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNP-----SLGNAVFMFQ  250



>ref|XP_002986948.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
 gb|EFJ12030.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
Length=297

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 156/231 (68%), Gaps = 7/231 (3%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  K+    R IT+TW K+L+G  LS+ V++P+   HYTCK+D+K W FW K+
Sbjct  30    QNLVTCVYQTKLWGHCRLITVTWCKNLMGQGLSVNVDDPA--CHYTCKVDMKPWFFWKKQ  87

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+  VD ++V+V+WD  +AK+   PEP   FY+A+ + GEV +LLGD   EA+K+T++
Sbjct  88    GSKAMEVDGQKVEVFWDLSSAKYLCGPEPQDGFYLAIVSDGEVALLLGDMVREAYKKTQA  147

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             RPP ++A L+ ++E V+ KR + T+   G   R H+I+IE   +G  EP +++ VD    
Sbjct  148   RPPTIEAMLLSRREHVFGKRYYTTKAQFGESGRTHDIMIECHTNGAREPRLYVRVDRQLV  207

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             ++V  L W+FRGN+T++VD + VEVFWDVH+W+FN      + G  VF+F+
Sbjct  208   IQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNP-----SLGNAVFMFQ  253



>ref|XP_006848668.1| hypothetical protein AMTR_s00305p00015080 [Amborella trichopoda]
 gb|ERN10249.1| hypothetical protein AMTR_s00305p00015080 [Amborella trichopoda]
Length=297

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 163/289 (56%), Gaps = 13/289 (4%)
 Frame = +3

Query  444   REDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTC  623
             R+DQ         Q+  T ++  KIA   R I  TW KSL+ H  +I +E+       T 
Sbjct  17    RDDQYSLR---AGQTLATNVYRTKIAGKCRLIVATWCKSLLAHGFTISLEDQEAKAQSTY  73

Query  624   KIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILL  803
             KI+L  W FW K+GLK+F V+  RVD++WD R AKF + PEP  D+YVALA+ GEVV++L
Sbjct  74    KIELAPWCFWRKQGLKTFTVEGTRVDLFWDLRNAKFYTEPEPKCDYYVALASEGEVVLVL  133

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDL---S  974
             GD K EA+++ +SRP ++D  L+ +KE +YAKR F TR         H I IE      S
Sbjct  134   GDMKKEAYRKARSRPSLIDPILISRKEHIYAKRKFITRAKFSERAAAHEISIECTCGSNS  193

Query  975   GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
                +PEM I +DG    RV +L W+FRGNET+ V+ +A+EVFWDVHDW+F     S    
Sbjct  194   AGLDPEMTIRIDGNLVTRVRHLQWKFRGNETIFVNKIAIEVFWDVHDWLF-----SPGLR  248

Query  1155  PGVFIFKQgnggkgegeeD--NSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
               +FIF+           +  +       + S    P+FC   +AWKTE
Sbjct  249   HSLFIFRPSTSNPSSTLMNVGHGGSMNGSEVSMGGSPDFCLYLHAWKTE  297



>ref|XP_001772274.1| predicted protein [Physcomitrella patens]
 gb|EDQ62927.1| predicted protein [Physcomitrella patens]
Length=284

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 165/278 (59%), Gaps = 14/278 (5%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  +   Q+ VTC++  K+A   R ++ITW K+LIG  LS+   N   D H  CK+D+K 
Sbjct  21    AGSNKVTQNLVTCLYQTKLAGKCRPLSITWCKNLIGQGLSV---NVDVDQH-MCKVDMKP  76

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+GLKSF VD  +V+V+WD  +AK+   P P   F+VA+ + GEVV+LLGD  SE
Sbjct  77    WMFWKKQGLKSFEVDGIKVEVFWDLSSAKYICGPVPSDSFFVAVVSDGEVVLLLGDMYSE  136

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWI  1001
             A+K+TK+RP  ++A LV + E V+ K+   T+     G + H+I+IE  +S  +EP M+I
Sbjct  137   AYKKTKARPASIEAILVSRSEHVFGKKYHSTKAQFEEGGKAHDIVIECQISPSSEPRMYI  196

Query  1002  SVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
              VD    V+V  L W+FRGN+T++VD   VEVFWDVH+W+FN        G  VF+F+  
Sbjct  197   RVDREIVVQVKRLAWKFRGNQTIIVDGNPVEVFWDVHNWLFNPR-----VGHAVFMFQTC  251

Query  1182  nggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                         L + +   S S P  F  V YAWK +
Sbjct  252   LSSDKPW-----LKEVAACSSTSGPSGFSLVLYAWKND  284



>ref|XP_010689671.1| PREDICTED: uncharacterized protein LOC104903342 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 187/318 (59%), Gaps = 29/318 (9%)
 Frame = +3

Query  417   AQLRPMNPRREDQKEAEESATDQS---YVTCIHLAKIADLLRTITITWSKSLIGHALSIV  587
               +R  + +   ++  EE  T +S    V+ + L  IA   R +++ W K+++  + SI+
Sbjct  3     TNIRAQSMKGPPERITEEPMTLKSSLCTVSSVFLTNIAGYWRNVSVLWCKNMMNISFSII  62

Query  588   VENPSED--NHYTCKIDLKTWQFWGKKGLKSFNVDQE---------RVDVYWDFRAAKFS  734
             ++    D     TCK++LK W FW +KG KSF ++ +         ++D+YWD R+AKFS
Sbjct  63    IDGFEGDLETQTTCKVELKPWHFWSRKGYKSFEINIQHKLAEESYHQLDIYWDLRSAKFS  122

Query  735   -SSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFC  911
              SSPEP SD+Y+AL +  EVV+LLGD K +A+KRTK RP +VDA    KKE VYAK+ F 
Sbjct  123   GSSPEPCSDYYLALVSDEEVVLLLGDNKKKAYKRTKKRPALVDAIQSLKKEIVYAKKSFA  182

Query  912   TRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAV  1091
             TR     GK EH+++IE+  SGP +PEMWIS+DGI  + V NL W+FRGNE V+V+   +
Sbjct  183   TRARFTEGKGEHDVVIESSTSGPKDPEMWISIDGIVLIHVKNLQWKFRGNEMVVVNKTPI  242

Query  1092  EVFWDVHDWMFNDDSSSVAAGPGVFIFK--------QgnggkgegeeDNSLPQK--SCDD  1241
             +V WDVH W+F    S+   G G+F+FK           G    G  DNS      S   
Sbjct  243   QVLWDVHAWLF----SNPGTGCGLFVFKPGAPEVEFDREGSNRSGNSDNSFGSMFYSTQS  298

Query  1242  SQSRPPEFCHVFYAWKTE  1295
             +Q++  +FC +  AWK +
Sbjct  299   TQTKIVDFCLLLQAWKID  316



>gb|ABR17303.1| unknown [Picea sitchensis]
Length=270

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 163/276 (59%), Gaps = 13/276 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++L  ++   R IT+TW K+L+G  LS+ V++PS      C++D+K+W FW KK
Sbjct  3     QNMVTCLYLTTLSGQTRLITVTWCKNLMGQGLSVNVDDPSY--QCLCRVDMKSWLFWKKK  60

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K F +   +VDV+WD  +A++ S+PEP   ++VA+ +  EV +LLGD   EAFK+T +
Sbjct  61    GSKRFELGTTKVDVFWDLSSARYGSAPEPLEGYFVAVVSNEEVALLLGDMCKEAFKKTHA  120

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
             +PP  +  L+ +KE V+ K C+ T+       R H+I+IE    GP EP++ + +D    
Sbjct  121   KPPA-ETVLISRKEHVFGKNCYTTKAQFCNSGRIHDIVIECQTGGPREPKLCVRIDKQLV  179

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK-----Qgng  1187
             V+V +L W+FRGN+T+ VD + +E+FWDVHDW+FN      + G  VF+FK     +   
Sbjct  180   VQVKHLIWKFRGNQTISVDGLPIEMFWDVHDWLFNP-----SLGHAVFMFKTITSGEVQE  234

Query  1188  gkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                     +S   K    SQ     F  + YAWK +
Sbjct  235   PSLSKPVSHSFKHKELAQSQGNGYGFSLLMYAWKND  270



>ref|XP_004515862.1| PREDICTED: uncharacterized protein LOC101502004 [Cicer arietinum]
Length=305

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/286 (41%), Positives = 162/286 (57%), Gaps = 16/286 (6%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             S   QS    ++  K+AD  R ITITW K+L+ H LSI VE P  +  Y+CK++LK W F
Sbjct  25    SRAGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSISVEGPEGEAQYSCKVELKPWYF  84

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W K+G K F V+ + VDV+WD +AAKF+   EP S++YVA+    EVV+L+GD K +A++
Sbjct  85    WRKQGSKRFLVEGKAVDVFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLLVGDLKKDAYR  144

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD-------LSGPTEP  989
             RT  RP ++D  LV KKE ++ K+ F TR       + H I IE         + G  +P
Sbjct  145   RTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGKWHEISIECKNRGNGDCVYGSVQP  204

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EM I +DG   + V +L W+FRGNE+V +  + +EV+WDVHDW+F     S      +FI
Sbjct  205   EMEIRIDGHLVIHVKHLQWKFRGNESVHLSKMRIEVYWDVHDWLF-----SPGLKHALFI  259

Query  1170  FKQgnggkgegeeDNSLPQKSCDD----SQSRPPEFCHVFYAWKTE  1295
             FK             S   ++C+     S S   EFC   YAWK E
Sbjct  260   FKPILSSTSLSSSPLSTQARNCESVEGFSVSGSTEFCLFLYAWKVE  305



>ref|XP_010551974.1| PREDICTED: uncharacterized protein LOC104822443 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551975.1| PREDICTED: uncharacterized protein LOC104822443 isoform X2 [Tarenaya 
hassleriana]
Length=346

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 163/242 (67%), Gaps = 14/242 (6%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDL-KTWQFWGK  659
             QS VTC + A IA   R +T+ WSK+++ H+L+++V +   D +Y CKIDL K WQFW K
Sbjct  43    QSTVTCGYQAHIAGYFRNVTVLWSKNVMHHSLTLMVSSLDNDMNYCCKIDLVKPWQFWSK  102

Query  660   KGLKSFNVDQERVDVYWDFRAAKFSSS--PEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             KG KSF V+   V+++WD R+AK S +  PEP SD+Y+A+ +  EVV+LLGD K +A+KR
Sbjct  103   KGSKSFTVEGNLVEIFWDLRSAKLSGNGCPEPVSDYYIAVVSDEEVVLLLGDLKKKAYKR  162

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT--------EP  989
             TKSRP +VD  + +KKESV++K+ F TR      ++EH +++E+  SG            
Sbjct  163   TKSRPALVDPFMCYKKESVFSKKTFSTRASFDERRKEHEVVVESSCSGGGDGDDGGDEAA  222

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EMWI VDG+  V V NL W+FRGN+TV+VD  AV+V++DVHDW+F    S   A  G+F+
Sbjct  223   EMWIRVDGVVVVHVRNLQWKFRGNQTVLVDKTAVQVYYDVHDWLFG---SQGMAANGLFV  279

Query  1170  FK  1175
             FK
Sbjct  280   FK  281



>ref|XP_001770719.1| predicted protein [Physcomitrella patens]
 gb|EDQ64543.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 150/238 (63%), Gaps = 9/238 (4%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  +   Q+ VTC++  K+A   R ++ITW K+LIG  LS+   N   D H  CK+D+K 
Sbjct  21    AGSNKVTQNLVTCLYQTKLAGKCRPLSITWFKNLIGQGLSV---NVDVDQH-MCKVDMKP  76

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+GLKSF VD  +V+VYWD  +A +   P P   F+VA+ + GEVV+LLGD  +E
Sbjct  77    WMFWKKQGLKSFEVDDIKVEVYWDLSSANYICGPVPSDSFFVAVVSAGEVVLLLGDMYNE  136

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWI  1001
             A+K+TK++P  ++A  V + E V+ KR  CT+     G + H+I+IE  +   +EP M++
Sbjct  137   AYKKTKAKPASIEAIRVSRSEHVFGKRYHCTKAQFEEGGKAHDIVIECQIRPSSEPRMYV  196

Query  1002  SVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
              VD    V+V  L W+FRGN+T++VD   VEVFWDVH W+FN       AG  VF+F+
Sbjct  197   RVDQQIVVQVKRLMWKFRGNQTIVVDGAPVEVFWDVHSWLFNP-----RAGHAVFMFQ  249



>ref|XP_009359202.1| PREDICTED: uncharacterized protein LOC103949811 [Pyrus x bretschneideri]
Length=310

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 166/288 (58%), Gaps = 22/288 (8%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  KIA   R IT+TW K+L+ H LS+ V+  + D  Y CK++LK W FW 
Sbjct  30    SGQSVFMSVYSTKIAGQCRLITVTWCKNLLLHGLSVSVQGQNRDEEYRCKVELKPWYFWR  89

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK +AF++T
Sbjct  90    KQGSKQFTVDGSAVDVVWDLKAAKFNGETEPQSDYYVAIVCEDEVVLLVGDQKKDAFRKT  149

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-TDLSGPTEPEMWISVDG  1013
               RP +++  LV ++E ++ KR F TR  L   +  H I+IE ++ S  ++PE+ I +DG
Sbjct  150   GCRPSLIEPILVSRREHLFGKRKFSTRIKLHEKENFHEILIECSNGSDGSDPELEIKIDG  209

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIFK----  1175
             I++VRV  L+W+FRGN+ V V+   VE+FWDVHDW+F        +GP  G FIFK    
Sbjct  210   IQAVRVKRLHWKFRGNDCVDVNRNRVEIFWDVHDWLF-------CSGPRHGKFIFKPVSA  262

Query  1176  -QgnggkgegeeDNSLPQK-------SCDDSQSRPPEFCHVFYAWKTE  1295
                         D  L +K         D++      F    YAWK E
Sbjct  263   EHTAEPPSLSAVDQPLTEKVGSGVGDEHDNAGGASSVFTLFVYAWKVE  310



>emb|CDY19961.1| BnaA09g02900D [Brassica napus]
Length=306

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 172/285 (60%), Gaps = 11/285 (4%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L++++ +  +D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMISSLDKDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD RAAK S   SPEP S++YVA+ +  E+V+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGTFVEVFWDLRAAKLSGNGSPEPVSEYYVAVVSDEEIVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKESV+ K+ F TR    R   +        +    
Sbjct  149   GDLKHKAYKRTKSRPALVEGFIYFKKESVFGKKTFSTR---ARFDEQRKEHEVVVVMEEK  205

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEM ISVDG+  V V NL W+FRGN+ V+VD   V V++DVHDW+F   S S     G+
Sbjct  206   DPEMRISVDGVVVVHVKNLQWKFRGNQMVLVDKTPVMVYYDVHDWLFG-SSESTTTRSGL  264

Query  1164  FIFKQgnggkgegeeDNSLPQ-KSCDDSQSRPPEFCHVFYAWKTE  1295
             F+FK           D+ L +  S         EFC V YAWK E
Sbjct  265   FLFKP---VVVGAMVDDPLSRYNSASSGYGTLHEFCLVLYAWKLE  306



>gb|KDO82205.1| hypothetical protein CISIN_1g020915mg [Citrus sinensis]
Length=320

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/313 (38%), Positives = 171/313 (55%), Gaps = 39/313 (12%)
 Frame = +3

Query  453   QKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             +++A++ AT     QS    ++  K+A   R IT+TW K+L+ H LS+ VE P  D HY 
Sbjct  15    ERQADDPATVARSGQSVFMSVYRTKLAGECRLITVTWCKNLLLHGLSVSVEGPDGDEHYR  74

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K   VD   VD++WD +AAKF+   EP SD+YVA+    EVV+L
Sbjct  75    CKVELKPWYFWRKQGSKHITVDSRAVDIFWDLKAAKFNGETEPRSDYYVAIVCEEEVVLL  134

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLS--  974
             LGD K +AF++T  RP +++ TLV +KE V+ K+ F TR         H+I +E + +  
Sbjct  135   LGDLKKDAFRKTGCRPSLIEPTLVSRKEHVFGKKKFSTRVKFQEKAPLHDISVECNNNIN  194

Query  975   -----GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSS  1139
                  G  +PE+ I VDG  +V V +L+W+FRGNE + +    VEV+WDVHDW+F     
Sbjct  195   CDSNLGGFDPELEIRVDGKRAVHVRHLHWKFRGNEFINISKTRVEVYWDVHDWLF-----  249

Query  1140  SVAAGP--GVFIFKQgnggkgegeeDN-SLPQKSC------------------DDSQSRP  1256
                +GP  G+FIFK          +   S P+ S                   D++    
Sbjct  250   --GSGPRHGLFIFKPVAVTSLSASKSTPSSPESSAAKLAEFCSHDPSSAENDDDNAAGVS  307

Query  1257  PEFCHVFYAWKTE  1295
               FC   YAWK E
Sbjct  308   SGFCLFLYAWKVE  320



>ref|XP_008340356.1| PREDICTED: uncharacterized protein LOC103403320 [Malus domestica]
Length=310

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 153/236 (65%), Gaps = 10/236 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  KIA   R IT+TW K+L+ H LS+ V+  + D  Y CK++LK W FW 
Sbjct  30    SGQSVFMSVYSTKIAGRCRLITVTWCKNLLLHGLSVSVQGQNRDEEYRCKVELKPWYFWR  89

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK +AF++T
Sbjct  90    KQGSKQFTVDGITVDVVWDLKAAKFNGETEPQSDYYVAIVCEEEVVLLVGDQKKDAFRKT  149

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-TDLSGPTEPEMWISVDG  1013
               RP +++  LV ++E ++ KR F TR      +  H I+IE ++ S  ++PE+ I +DG
Sbjct  150   GCRPSLIEPILVSRREHLFGKRKFSTRIKFHEKENFHEILIECSNGSDGSDPELEIKIDG  209

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIFK  1175
             I++VRV  L+W+FRGN+ V V+   VEVFWDVHDW+F        +GP  G+FIFK
Sbjct  210   IQAVRVKRLHWKFRGNDCVDVNRNRVEVFWDVHDWLF-------CSGPRHGMFIFK  258



>ref|XP_006438240.1| hypothetical protein CICLE_v10033962mg [Citrus clementina]
 gb|ESR51480.1| hypothetical protein CICLE_v10033962mg [Citrus clementina]
Length=320

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 169/313 (54%), Gaps = 39/313 (12%)
 Frame = +3

Query  453   QKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             +++A++ AT     QS    ++  K+A   R IT+TW K+L+ H LS+ VE P  D HY 
Sbjct  15    ERQADDPATVARSGQSVFMSVYRTKLAGECRLITVTWCKNLLLHGLSVSVEGPDGDEHYR  74

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K   VD   VD++WD +AAKF+   EP SD+YVA+    EVV+L
Sbjct  75    CKVELKPWYFWRKQGSKHITVDSRAVDIFWDLKAAKFNGETEPRSDYYVAIVCEEEVVLL  134

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLS--  974
             LGD K +AF++T  RP +++ TLV +KE V+ K+ F TR         H+I +E + +  
Sbjct  135   LGDLKKDAFRKTGCRPSLIEPTLVSRKEHVFGKKKFSTRVKFQEKAPLHDISVECNNNIN  194

Query  975   -----GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSS  1139
                  G  +PE+ I VDG  +V V +L+W+FRGNE + +    VEV+WDVHDW+F     
Sbjct  195   CDSNLGGFDPELEIRVDGKRAVHVRHLHWKFRGNEFINISKTRVEVYWDVHDWLF-----  249

Query  1140  SVAAGP--GVFIFK-------------------QgnggkgegeeDNSLPQKSCDDSQSRP  1256
                +GP  G+FIFK                              D S  +   D++    
Sbjct  250   --GSGPRHGLFIFKPVAVTSSSASKSTPSSPESSAAKLAEFCSHDPSSAENDDDNAAGVS  307

Query  1257  PEFCHVFYAWKTE  1295
               FC   YAWK E
Sbjct  308   SGFCLFLYAWKVE  320



>ref|XP_011071966.1| PREDICTED: uncharacterized protein LOC105157288 [Sesamum indicum]
Length=312

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 161/292 (55%), Gaps = 22/292 (8%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + + Q+    ++  K+AD  R IT+TW K+L+ H LS+ VE P  D+ YTCK++LK W F
Sbjct  26    ARSGQNVFMSVYRTKMADQCRLITVTWCKNLLLHGLSVSVEGPDGDSQYTCKVELKPWYF  85

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W K+G K FNVD + VDV+WD R AKF+   EP SD+YVA+    EVV+LLG+ + EA++
Sbjct  86    WKKQGSKRFNVDGKPVDVFWDLRVAKFNGETEPTSDYYVAVVCDDEVVLLLGNLRKEAYR  145

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-----TDLSGPTEPEM  995
             +T  RP ++D  LV +KE ++ KR F TR         H I IE     ++ S   EPEM
Sbjct  146   KTGCRPALIDPMLVSRKEHIFGKRKFITRVKFHDKGSFHEISIECKNKTSNPSDGAEPEM  205

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
              I +DG   + V +L W+FRGNE+V ++   +EVFWDVHDW+F     S      +FIFK
Sbjct  206   EIRIDGHLVIHVKHLQWKFRGNESVHLNKARIEVFWDVHDWLF-----SPGLRHALFIFK  260

Query  1176  Qgn------------ggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                                      S    S     S  P+FC   YAWK E
Sbjct  261   PTLLSMSSSTPPSSLPSTPLSSRTGSSSSTSDGFGGSGAPDFCLFLYAWKVE  312



>ref|XP_010039142.1| PREDICTED: uncharacterized protein LOC104427810 [Eucalyptus grandis]
 gb|KCW49205.1| hypothetical protein EUGRSUZ_K02785 [Eucalyptus grandis]
Length=318

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 168/304 (55%), Gaps = 31/304 (10%)
 Frame = +3

Query  459   EAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLK  638
             +A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  +N YTCK++LK
Sbjct  21    QAAVTRSGQSVFMSVYRTKIADQCRFITITWCKNLMLHGLSVSVEGPEGENQYTCKVELK  80

Query  639   TWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKS  818
              W FW K+G K F V+ + VD++WD +AAKF+   EP+S++YVA+    EVV+L+GD K 
Sbjct  81    PWYFWRKQGSKHFTVEGKVVDIFWDLKAAKFNGETEPNSEYYVAVVCDEEVVLLVGDLKK  140

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET-----------  965
             +A+++T  RP ++D  LV KKE ++ K+ F TR         H I IE            
Sbjct  141   DAYRKTGCRPALIDPILVSKKEHIFGKKKFSTRAKFYEKDGCHEISIECKNRNSSRGSIG  200

Query  966   ---DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDS  1136
                 L+G  EPEM I +DG  ++ V +L W+FRGNE++ V+ + VEV+WDVHDW+F    
Sbjct  201   NGGSLNG-IEPEMEIRIDGQLAIHVKHLQWKFRGNESIYVNKLRVEVYWDVHDWLF----  255

Query  1137  SSVAAGPGVFIFK----------QgnggkgegeeDNSLPQKSCDD-SQSRPPEFCHVFYA  1283
              S      +FIFK            +          +    S D  S S   EFC   YA
Sbjct  256   -SPGLRHALFIFKPIVSSISASSASSPYASTPLSSQTESSGSVDGISASGSAEFCLFLYA  314

Query  1284  WKTE  1295
             WK E
Sbjct  315   WKVE  318



>emb|CDY00069.1| BnaC09g02320D [Brassica napus]
Length=308

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/284 (44%), Positives = 175/284 (62%), Gaps = 7/284 (2%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L++++ +  +D +Y+CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMISSLDKDMNYSCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD RAAK S   SPEP S++YVA+ +  E+V+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGTFVEVFWDLRAAKLSGNGSPEPVSEYYVAVVSDEEIVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKESV+ K+ F TR    R   +        +    
Sbjct  149   GDFKHKAYKRTKSRPALVEGFIYFKKESVFGKKTFSTR---ARFDEQRKEHEVVVVMEEK  205

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEM ISVDG+  V V NL W+FRGN+ V+VD   V V++DVHDW+F    S+ ++  G+
Sbjct  206   DPEMRISVDGVVVVHVKNLQWKFRGNQMVLVDKTPVMVYYDVHDWLFGSSESTTSSRSGL  265

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             F+FK   G  G G    S    S         EFC V YAWK E
Sbjct  266   FLFKPEGGDSGGGSSPLSR-YNSASSGYGTLHEFCLVLYAWKHE  308



>ref|XP_003525519.1| PREDICTED: uncharacterized protein LOC100779755 [Glycine max]
 gb|KHN34360.1| hypothetical protein glysoja_016688 [Glycine soja]
Length=326

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 162/304 (53%), Gaps = 34/304 (11%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + + QS    ++  K+AD  R ITITW K+L+ H LS+ VE P  +  YTCK++LK W F
Sbjct  28    TRSGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGEEQYTCKVELKPWYF  87

Query  651   WGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFK  830
             W K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K EA++
Sbjct  88    WRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLLLGDLKKEAYR  147

Query  831   RTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE--------TDLSGPTE  986
             RT  RP ++D  LV KKE ++ K+ F TR       R H I IE         D  G   
Sbjct  148   RTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGRWHEISIECKNKGNYNVDSLGGVH  207

Query  987   PEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             PEM I +DG   + V +L W+FRGNE++ +  + VEV+WDVHDW+F     S      +F
Sbjct  208   PEMEIRIDGHLVIHVKHLQWKFRGNESIHLSKMRVEVYWDVHDWLF-----SPGLKHALF  262

Query  1167  IFK--------------------QgnggkgegeeDNSLPQKSCDD-SQSRPPEFCHVFYA  1283
             IFK                      +        D +    S +  S S   EFC   YA
Sbjct  263   IFKPILSSSTTTTTTTSMSYSSPSLSSSSPPLSNDQTRNSGSVEGFSVSGSSEFCLFLYA  322

Query  1284  WKTE  1295
             WK E
Sbjct  323   WKVE  326



>ref|XP_008793736.1| PREDICTED: uncharacterized protein LOC103709963 [Phoenix dactylifera]
 ref|XP_008804211.1| PREDICTED: uncharacterized protein LOC103717555 [Phoenix dactylifera]
Length=315

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 174/314 (55%), Gaps = 36/314 (11%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVE-----  593
             P  P  +D      + + QS VT ++  KIA   R IT+TW K ++ H LS+ VE     
Sbjct  13    PGEPMADDPTSIAATKSGQSIVTSVYRTKIAGHCRLITVTWCKDVLVHGLSVSVEERSDS  72

Query  594   ------NPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDS  755
                   N + + H +CK++L+ W FW K G K F+V+ + VDV+WD ++AKFS  PEP S
Sbjct  73    VDETNININTNQHMSCKVELRPWYFWRKHGSKRFHVEGKPVDVFWDLKSAKFSGEPEPQS  132

Query  756   DFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG  935
             ++YVA+ +  EVV+LLGD  +EA++RT SRP  +DATLV +KE V+ +R F T+      
Sbjct  133   NYYVAVVSDEEVVLLLGDLNTEAYRRTGSRPATIDATLVSRKEHVFGRRRFATKAKFSEK  192

Query  936   KREHNIIIETDLSGP-------TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVE  1094
              + H I+IE    G         +PEM I +DG  ++ V +L W+FRGN++V V+   VE
Sbjct  193   GKLHEILIECSSDGSGSSIGGNMDPEMVIKIDGHVAIHVRHLQWKFRGNQSVTVNKARVE  252

Query  1095  VFWDVHDWMFNDDSSSVAAGP--GVFIFKQgnggkgegeeDNSL-----PQKSCDDSQSR  1253
             V+WDVHDW+F       + GP   +FIFK     +      +SL        + D S   
Sbjct  253   VYWDVHDWIF-------SPGPRHALFIFKPSPLLRPSAPTSSSLSSFDGKNATVDGSSG-  304

Query  1254  PPEFCHVFYAWKTE  1295
                FC   YAWK E
Sbjct  305   ---FCLFLYAWKLE  315



>gb|KEH31766.1| protein phosphatase 2c, putative [Medicago truncatula]
Length=312

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 165/292 (57%), Gaps = 22/292 (8%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + + QS    ++  K+AD  R ITITW K+L+ H LSI VE P  +  YTCK++LK W F
Sbjct  26    TRSGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSISVEGPEGEAQYTCKVELKPWYF  85

Query  651   WGKKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             W K+G K F VD  + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K +A+
Sbjct  86    WRKQGSKRFIVDGNKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLLLGDLKKDAY  145

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD----------LSG  977
             +RT  RP ++D  LV KKE ++ K+ F TR       + H I IE            + G
Sbjct  146   RRTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGKWHEISIECKNRGNGGGDSVIVG  205

Query  978   PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP  1157
               +PEM I +DG   + V +L W+FRGNE+V +  + +EV+WDVHDW+F     S     
Sbjct  206   SVQPEMEIRIDGHLVIHVKHLQWKFRGNESVHLSKMRIEVYWDVHDWLF-----SPGLKH  260

Query  1158  GVFIFK--QgnggkgegeeDNSLPQKSCDD----SQSRPPEFCHVFYAWKTE  1295
              +FIFK    +          S+  ++C+     S S   EFC   YAWK E
Sbjct  261   ALFIFKPILSSTISSSSSSPLSIQARNCESVEGFSVSGSSEFCLFLYAWKVE  312



>gb|KDP31019.1| hypothetical protein JCGZ_11395 [Jatropha curcas]
Length=309

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 162/291 (56%), Gaps = 18/291 (6%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  +N YTCK++LK 
Sbjct  24    ATITRSGQSVFMSVYRTKIADQCRLITITWCKNLLLHGLSVSVEGPEGENQYTCKVELKP  83

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD + VD++WD +AAKF+   EP+S++YVA+    EVV+LLGD K +
Sbjct  84    WYFWRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPNSEYYVAVVCDEEVVLLLGDLKKD  143

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT------  983
             A+++T SRP ++D  LV +KE ++ K+ F TR       R H I IE     P       
Sbjct  144   AYRKTGSRPALIDPILVSRKEHIFGKKKFSTRIKFHEKGRLHEISIECKNRTPNSNSGNG  203

Query  984   -EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              EPE+ I +DG  ++ V +L W+FRGN+   ++ + VEV+WDVHDW+F     S      
Sbjct  204   IEPELEIRIDGHLAIHVKHLQWKFRGNQAFNLNKLRVEVYWDVHDWLF-----SPGLRHA  258

Query  1161  VFIFKQgnggkgegeeDNSLPQKSCDD------SQSRPPEFCHVFYAWKTE  1295
             +FIFK              L  +          +     +FC   YAWK E
Sbjct  259   LFIFKPILLTSSRSSPSTPLSSQIGSSSSLEGVNGGGSSDFCLFLYAWKVE  309



>ref|XP_002511308.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51910.1| conserved hypothetical protein [Ricinus communis]
Length=325

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 152/248 (61%), Gaps = 15/248 (6%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  D  YTCK++LK 
Sbjct  23    ATITRSGQSVFMSVYRTKIADQCRLITITWCKNLLLHGLSVSVEGPEGDGQYTCKVELKP  82

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K +
Sbjct  83    WYFWRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPISEYYVAVVCNEEVVLLLGDLKKD  142

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE----------TDL  971
             A+++T  RP ++D  LV +KE ++ K+ FCTR       R H I IE            +
Sbjct  143   AYRKTGCRPALIDPILVSRKEHIFGKKKFCTRVKFHGKGRLHEISIECKNRSDPSNGNSV  202

Query  972   SGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAA  1151
             S   EPE+ I +DG  ++ V +L+W+FRGN++  ++ + VEV+WDVHDW+F     S   
Sbjct  203   SNGVEPELEIRIDGHLAIHVKHLHWKFRGNQSFNLNKLRVEVYWDVHDWLF-----SPGL  257

Query  1152  GPGVFIFK  1175
                +FIFK
Sbjct  258   RHALFIFK  265



>ref|XP_007155488.1| hypothetical protein PHAVU_003G205700g [Phaseolus vulgaris]
 gb|ESW27482.1| hypothetical protein PHAVU_003G205700g [Phaseolus vulgaris]
Length=324

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 162/299 (54%), Gaps = 32/299 (11%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  K+AD  R ITITW K+L+ H LS+ VE P  +  YTCK+++K W FW 
Sbjct  32    SGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGEEQYTCKVEVKPWYFWR  91

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K EA++RT
Sbjct  92    KQGSKRFIVDGKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLLLGDLKKEAYRRT  151

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET--------DLSGPTEPE  992
               RP ++D  LV KKE ++ K+ F TR       R H I IE          LSG  +PE
Sbjct  152   GCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGRWHEISIECKNKGNNGDSLSG-VQPE  210

Query  993   MWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIF  1172
             M I +DG   + V +L W+FRGNE++ +  + VEV+WDVHDW+F     S      +FIF
Sbjct  211   MEIRIDGHLVIHVKHLQWKFRGNESIHLSKMRVEVYWDVHDWLF-----SPGLKHALFIF  265

Query  1173  K-----------------QgnggkgegeeDNSLPQKSCDD-SQSRPPEFCHVFYAWKTE  1295
             K                            D +    S +  S S   EFC   YAWK E
Sbjct  266   KPILSSSTTASSMSSSSPSLTSSSPPLSTDQTRSSGSVEGFSVSGSSEFCLFLYAWKVE  324



>ref|XP_003571347.2| PREDICTED: uncharacterized protein LOC100832869 [Brachypodium 
distachyon]
Length=327

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 153/243 (63%), Gaps = 27/243 (11%)
 Frame = +3

Query  504   HLAKIADLLRTITITWSKSLIGHALSIVVENP----------SEDNHYTC----KIDLKT  641
             +LAKI+   R ++  W KS+I  + +I ++ P          SED+  +     K+++K 
Sbjct  53    YLAKISGAERLVSAVWHKSIINQSFTITIDRPPCGGGGDDAGSEDDDGSTLISYKVEMKP  112

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFS-SSPEPDSDFYVALATGGEVVILLGDQKS  818
             W FW KKGLKSF +D +RVD+ WD R A+F+ SSPEP   +YVAL    EVV++ GDQK 
Sbjct  113   WPFWSKKGLKSFYLDGDRVDLVWDLRTARFTTSSPEPAHGYYVALVNNEEVVLVFGDQKK  172

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMW  998
             EA+KR K+RP ++D   V ++ESV  +R F  R  L   K  H+I +E+ L+GP EPEM 
Sbjct  173   EAYKRAKTRPSLIDPVPVCRRESVVGRRSFVGRAKLTGKKEYHDIAVESLLAGPREPEMS  232

Query  999   ISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG----VF  1166
             I+V+G   VRV NL W+FRGNETV+VD V V+V WDVHDW+F        AGPG    VF
Sbjct  233   IAVEGHVVVRVKNLQWKFRGNETVIVDEVPVQVLWDVHDWIF--------AGPGATQAVF  284

Query  1167  IFK  1175
             + K
Sbjct  285   VLK  287



>ref|XP_010102967.1| hypothetical protein L484_018986 [Morus notabilis]
 gb|EXB94485.1| hypothetical protein L484_018986 [Morus notabilis]
Length=324

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/253 (43%), Positives = 153/253 (60%), Gaps = 15/253 (6%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCK  626
              DQ +   + + QS V  ++  K+AD  R ITITW K+L+ H LS+ VE P  D+ YTCK
Sbjct  17    HDQHQTAVTRSGQSVVMSMYRTKVADRCRLITITWCKNLMLHGLSVSVEGPEGDSQYTCK  76

Query  627   IDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLG  806
             ++LK W FW K G K F V+ + ++++WD +AAKF+   EP S++YVA+    EVV+LLG
Sbjct  77    VELKPWYFWRKHGHKKFVVEGKEMNIFWDLKAAKFNGETEPASEYYVAVVCDEEVVLLLG  136

Query  807   DQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT-  983
             D K +A+K+T  RP ++D  LV +KE V+ K+ F TR       + H I IE    G + 
Sbjct  137   DLKKDAYKKTGCRPALIDPILVSRKEHVFGKKKFSTRAKFHEKGKVHEISIECKNKGGSV  196

Query  984   ---------EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDS  1136
                      EPEM I +DG   + V +L W+FRGNE++ V+ + VEV+WDVHDW+F    
Sbjct  197   SNGNFPSGVEPEMEIRLDGHILIHVKHLQWKFRGNESIHVNKLRVEVYWDVHDWLF----  252

Query  1137  SSVAAGPGVFIFK  1175
              S      +FIFK
Sbjct  253   -SPGLRHALFIFK  264



>gb|EAY84891.1| hypothetical protein OsI_06256 [Oryza sativa Indica Group]
Length=315

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 153/237 (65%), Gaps = 18/237 (8%)
 Frame = +3

Query  498   CIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH-------YTCKIDLKTWQFWG  656
              ++ AKI    R +T  W ++LI  + +I ++               + K++LK W FW 
Sbjct  48    SVYRAKINGAPRHVTAVWHRTLINQSFTISIDGGGGGGAGAGDDGALSHKVELKPWPFWS  107

Query  657   KKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             K+G K+ +VD +R+D+ WD R+AKF +SSPEP + +YVAL +  EVV+LLGD K +AFKR
Sbjct  108   KRGAKTLDVDGDRLDIVWDLRSAKFPASSPEPAAGYYVALVSRDEVVLLLGDGKKDAFKR  167

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDG  1013
             T+SRP + DA LV ++ESV  +R F  R  L  G+++H I++++ ++GP EPEM I+VDG
Sbjct  168   TRSRPSLDDAVLVSRRESVSGRRTFAARAPLAAGRKDHEIVVDSAIAGPREPEMRITVDG  227

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP---GVFIFK  1175
             +  V V +L W+FRGNETV+VD   V+V WDVHDW+F       A GP    VF+FK
Sbjct  228   VVLVHVRSLQWKFRGNETVIVDQSPVQVLWDVHDWIF-------AGGPAAQAVFVFK  277



>ref|NP_001046211.1| Os02g0198800 [Oryza sativa Japonica Group]
 dbj|BAD25468.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08125.1| Os02g0198800 [Oryza sativa Japonica Group]
 dbj|BAG97293.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 153/236 (65%), Gaps = 18/236 (8%)
 Frame = +3

Query  501   IHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH-------YTCKIDLKTWQFWGK  659
             ++ AKI    R +T  W ++LI  + +I ++               + K++LK W FW K
Sbjct  62    VYRAKINGAPRHVTAVWHRTLINQSFTISIDGGGGGGAGAGDDGALSHKVELKPWPFWSK  121

Query  660   KGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             +G K+ +VD +R+D+ WD R+AKF +SSPEP + +YVAL +  EVV+LLGD K +AFKRT
Sbjct  122   RGAKTLDVDGDRLDIVWDLRSAKFPASSPEPAAGYYVALVSRDEVVLLLGDGKKDAFKRT  181

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             +SRP + DA LV ++ESV  +R F  R  L  G+++H I++++ ++GP EPEM I+VDG+
Sbjct  182   RSRPSLDDAVLVSRRESVSGRRTFAARAPLAAGRKDHEIVVDSAIAGPREPEMRITVDGV  241

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP---GVFIFK  1175
               V V +L W+FRGNETV+VD   V+V WDVHDW+F       A GP    VF+FK
Sbjct  242   VLVHVRSLQWKFRGNETVIVDQSPVQVLWDVHDWIF-------AGGPAAQAVFVFK  290



>gb|EMT16711.1| hypothetical protein F775_12417 [Aegilops tauschii]
Length=313

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 170/290 (59%), Gaps = 23/290 (8%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVEN--------PSEDNHY  617
             +  SAT Q     ++L +I      +T  W+K++I  + +I ++           +D   
Sbjct  35    SSSSATAQCSTMTVYLVRINGTEHLVTAVWNKNIINQSFTITIDRHGDGAGSGGGDDGAL  94

Query  618   TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVALATGGEVV  794
             + K++LK W FW KKGLKSF +D  R+DV+WD R+AKF +SSPEP S ++ AL +  +VV
Sbjct  95    SLKVELKPWPFWSKKGLKSFFLDGHRLDVFWDLRSAKFPASSPEPASGYFGALVSQEQVV  154

Query  795   ILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLS  974
             + LGD K +A+KR+K RP + DA  + ++E+V+ +R F  R  L   +++H+I+IE  L+
Sbjct  155   LTLGDLKKDAYKRSKCRPSLEDAVPLCRRETVFGRRSFVARGWLDTSRKDHDIVIEASLA  214

Query  975   GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
             GP EPEM I+VDG   V+V NL W+FRGNETV+VD   V+V WDVHDW+F        AG
Sbjct  215   GPREPEMAITVDGRALVQVKNLQWKFRGNETVLVDQSPVQVLWDVHDWIF--------AG  266

Query  1155  PG---VFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             PG   VF FK    G       +    +S       P ++    +AWKT+
Sbjct  267   PGSQAVFAFKP---GAPPEVNSDEAGLESGSGIPGDPGDYSFFLHAWKTD  313



>gb|KHN10445.1| hypothetical protein glysoja_030881 [Glycine soja]
Length=330

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 150/255 (59%), Gaps = 16/255 (6%)
 Frame = +3

Query  444   REDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYT  620
               D      + + QS    ++  K+AD  R ITITW K+L+ H LS+ VE P  E+ +YT
Sbjct  21    HHDHDHGAVTRSGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGEEQYYT  80

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+L
Sbjct  81    CKVELKPWYFWRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLL  140

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSG-  977
             LGD K EA++RT  RP ++D  LV KKE ++ K+ F TR       R H I IE    G 
Sbjct  141   LGDLKKEAYRRTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGRWHEISIECKNKGN  200

Query  978   ---------PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFND  1130
                        +PEM I +DG   + V +L W+FRGNE++ +  + VEV+WDVHDW+F  
Sbjct  201   NNYNVDSLNGVQPEMEIRIDGHLVIHVKHLQWKFRGNESIHLSKMRVEVYWDVHDWLF--  258

Query  1131  DSSSVAAGPGVFIFK  1175
                S      +FIFK
Sbjct  259   ---SPGLKHALFIFK  270



>ref|XP_003549823.1| PREDICTED: uncharacterized protein LOC100802860 isoform X1 [Glycine 
max]
Length=331

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 150/255 (59%), Gaps = 16/255 (6%)
 Frame = +3

Query  444   REDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYT  620
               D      + + QS    ++  K+AD  R ITITW K+L+ H LS+ VE P  E+ +YT
Sbjct  22    HHDHDHGAVTRSGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGEEQYYT  81

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+L
Sbjct  82    CKVELKPWYFWRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLL  141

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSG-  977
             LGD K EA++RT  RP ++D  LV KKE ++ K+ F TR       R H I IE    G 
Sbjct  142   LGDLKKEAYRRTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGRWHEISIECKNKGN  201

Query  978   ---------PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFND  1130
                        +PEM I +DG   + V +L W+FRGNE++ +  + VEV+WDVHDW+F  
Sbjct  202   NNYNVDSLNGVQPEMEIRIDGHLVIHVKHLQWKFRGNESIHLSKMRVEVYWDVHDWLF--  259

Query  1131  DSSSVAAGPGVFIFK  1175
                S      +FIFK
Sbjct  260   ---SPGLKHALFIFK  271



>ref|XP_010663087.1| PREDICTED: uncharacterized protein LOC100243254 [Vitis vinifera]
Length=329

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 165/313 (53%), Gaps = 40/313 (13%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  ++ YTCK++LK 
Sbjct  22    AAVTRSGQSVFMYVYRTKIADQCRLITITWCKNLLLHGLSVAVEGPDGESQYTCKVELKP  81

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K +
Sbjct  82    WYFWRKQGSKRFVVDDKPVDIFWDLKAAKFNGETEPSSEYYVAVVCNEEVVLLLGDLKKD  141

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD-----------  968
             A+++T  RP ++D  LV KKE ++ K+ F T+       R H+I IE             
Sbjct  142   AYRKTGCRPALIDPILVSKKEHIFGKKKFSTKAKFHERGRFHDISIECKNRSGGSGGSMG  201

Query  969   ---LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSS  1139
                  G  +PEM I +DG   + V +L W+FRGNE++ V+ + VEV+WDVHDW+F     
Sbjct  202   NGNSCGRVDPEMEIRIDGHLVIHVKHLQWKFRGNESIHVNKLRVEVYWDVHDWLF-----  256

Query  1140  SVAAGPGVFIFKQgnggkgegeeDNSLPQK-----------------SCDDSQ----SRP  1256
             S      +FIFK             S                     SCD ++       
Sbjct  257   SPGLRHALFIFKPLMSSTSPTSISISTSSSLPLSSLTSTTPLSSQTGSCDAAEGFNAGGS  316

Query  1257  PEFCHVFYAWKTE  1295
              EFC   YAWK E
Sbjct  317   SEFCLFLYAWKVE  329



>ref|XP_010929912.1| PREDICTED: uncharacterized protein LOC105051269 [Elaeis guineensis]
Length=314

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/306 (39%), Positives = 169/306 (55%), Gaps = 27/306 (9%)
 Frame = +3

Query  438   PRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSED---  608
             P  +D      + + +S +T ++  KIA   R IT+TW K ++ H LS+ V   S++   
Sbjct  16    PMADDPASIAATKSGRSVMTSVYRTKIAGHCRLITVTWCKDVLVHGLSVSVAERSDNADE  75

Query  609   -------NHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYV  767
                    N ++CK++L+ W FW K G K F+V+ + VDV+WD + AKFS  P+P S++YV
Sbjct  76    TNTNTNTNQHSCKVELRPWYFWRKHGSKRFHVEGKPVDVFWDLKNAKFSGEPQPQSNYYV  135

Query  768   ALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREH  947
             A+ +  EVV+LLGD   EA++RT SRP  +DATLV +KE V+ K+ F TR       + H
Sbjct  136   AVVSDEEVVLLLGDLNMEAYRRTGSRPATIDATLVSRKEHVFGKKRFATRAKFSENGKLH  195

Query  948   NIIIETDLSGP-------TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWD  1106
              I+IE    G         +PEM I +DG  ++ V +L W+FRGN++V V+   VEV+WD
Sbjct  196   EILIECKSGGSGSSIGGNMDPEMVIKIDGHVAIHVRHLQWKFRGNQSVTVNKARVEVYWD  255

Query  1107  VHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeD---NSLPQKSCDDSQSRPPEFCHVF  1277
             VHDW+F+   S       +FIFK               NS   K+ D   S    FC   
Sbjct  256   VHDWLFSPGPSH-----ALFIFKPSPLRHSSTPTSSSLNSFQGKNADVDGS--SGFCLFL  308

Query  1278  YAWKTE  1295
             YAWK E
Sbjct  309   YAWKLE  314



>gb|EMS50536.1| hypothetical protein TRIUR3_22811 [Triticum urartu]
Length=320

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 171/297 (58%), Gaps = 30/297 (10%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPS-------------  602
             +  SAT Q     ++L +I      +T  W+K++I  + +I ++                
Sbjct  35    SSSSATVQCSTMTVYLVRINGTEHLVTAVWNKNIINQSFTITIDRHGDGTGSGRGGDGGR  94

Query  603   --EDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKF-SSSPEPDSDFYVAL  773
               ++   T K++LK W FW KKGLKSF +D  R+DV+WD R+AKF +SSPEP S ++VAL
Sbjct  95    YLKEGLETLKVELKPWPFWSKKGLKSFFLDGHRLDVFWDLRSAKFPASSPEPASGYFVAL  154

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
              +  +VV+ LGD K +A+KR+K RP + DA  + ++E+V+ +R F  R  L   +++ +I
Sbjct  155   VSQEQVVLTLGDLKKDAYKRSKCRPSLEDAVPLCRRETVFGRRSFVARAWLDASRKDRDI  214

Query  954   IIETDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
             +IE  L+GP EPEM I+VDG   V+V NL W+FRGNETV+VD   V+V WDVHDW+F   
Sbjct  215   VIEVSLAGPREPEMAITVDGRALVQVKNLQWKFRGNETVLVDQSPVQVLWDVHDWIF---  271

Query  1134  SSSVAAGPG---VFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                  AGPG   VF FK    G     + +    +S       P ++    +AWKT+
Sbjct  272   -----AGPGSQAVFAFKP---GAPPEVDSDEAGLESGSGIPGDPADYSFFLHAWKTD  320



>ref|XP_007224142.1| hypothetical protein PRUPE_ppa016161mg [Prunus persica]
 gb|EMJ25341.1| hypothetical protein PRUPE_ppa016161mg [Prunus persica]
Length=308

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 165/284 (58%), Gaps = 20/284 (7%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             QS    ++  KIA   R ITITW K+L+ H LS+ V+    D  Y CK++LK W FW K+
Sbjct  32    QSVFMSVYSTKIAGQCRLITITWCKNLLLHGLSVSVQGQDGDEDYRCKVELKPWYFWRKQ  91

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK +A++RT  
Sbjct  92    GSKQFLVDGSTVDVVWDLKAAKFNGETEPRSDYYVAIVCEEEVVLLVGDQKKDAYRRTGC  151

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT--EPEMWISVDGI  1016
             RP +++  LV +KE ++ K+ + TR      +  H I+IE +    T  +PE+ I +DG 
Sbjct  152   RPSLIEPILVSRKEHLFGKKRYSTRIKFHEKESFHEILIECNNISATGADPELEIKIDGS  211

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIFK---Qg  1181
              ++ V +L+W+FRGNE V ++   VEV+WDVHDW+F       ++GP  G+FIFK     
Sbjct  212   IALHVKHLHWKFRGNECVDINKTKVEVYWDVHDWLF-------SSGPRHGMFIFKPISSS  264

Query  1182  nggkgegeeDNSLPQKSC------DDSQSRPPEFCHVFYAWKTE  1295
             +    +  ++ +L +KS       DD       F    YAWK E
Sbjct  265   SPETAQSTQEQALTEKSSCAAEEEDDKAGGSSVFSLFVYAWKVE  308



>emb|CBI14939.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 152/241 (63%), Gaps = 8/241 (3%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  ++ YTCK++LK 
Sbjct  42    AAVTRSGQSVFMYVYRTKIADQCRLITITWCKNLLLHGLSVAVEGPDGESQYTCKVELKP  101

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EVV+LLGD K +
Sbjct  102   WYFWRKQGSKRFVVDDKPVDIFWDLKAAKFNGETEPSSEYYVAVVCNEEVVLLLGDLKKD  161

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET-DLSGPT--EPE  992
             A+++T  RP ++D  LV KKE ++ K+ F T+       R H+I IE  + SG +    E
Sbjct  162   AYRKTGCRPALIDPILVSKKEHIFGKKKFSTKAKFHERGRFHDISIECKNRSGGSGGSME  221

Query  993   MWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIF  1172
             M I +DG   + V +L W+FRGNE++ V+ + VEV+WDVHDW+F     S      +FIF
Sbjct  222   MEIRIDGHLVIHVKHLQWKFRGNESIHVNKLRVEVYWDVHDWLF-----SPGLRHALFIF  276

Query  1173  K  1175
             K
Sbjct  277   K  277



>ref|XP_009111832.1| PREDICTED: uncharacterized protein LOC103837244 [Brassica rapa]
Length=322

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 173/298 (58%), Gaps = 21/298 (7%)
 Frame = +3

Query  453   QKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKID  632
             Q ++  + T  S VTC + A +A   R +T+ WSK+L+ H+L++++ +  +D +Y CKID
Sbjct  29    QLKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMISSLDKDMNYCCKID  88

Query  633   L-KTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILL  803
             L K WQFW K+G KSF+V+   V+V+WD RAAK S   SPEP S++YVA+ +  E+V+LL
Sbjct  89    LVKPWQFWSKRGSKSFDVEGTFVEVFWDLRAAKLSGNGSPEPVSEYYVAVVSDEEIVLLL  148

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT  983
             GD K +A+KRTKSRP +V+  +  KKESV+ K+ F TR    R   +        +    
Sbjct  149   GDLKHKAYKRTKSRPALVEGFIYFKKESVFGKKTFSTR---ARFDEQRKEHEVVVVMEEK  205

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             +PEM ISVDG+  V V NL W+FRGN+ V+VD   V V++DVHDW+F   S S     G+
Sbjct  206   DPEMRISVDGVVVVHVKNLQWKFRGNQMVLVDKTPVMVYYDVHDWLFG-SSESTTTRSGL  264

Query  1164  FIFKQgnggkgegeeDNSLPQKSCDDSQSRP--------------PEFCHVFYAWKTE  1295
             F+FK    G    E  +   +       S P               EFC V YAWK E
Sbjct  265   FLFKPVVVGAMVDEFFSDAEEGGDSGGGSSPLSRYNSASSGYGTLHEFCLVLYAWKLE  322



>ref|XP_007044827.1| Uncharacterized protein TCM_010569 [Theobroma cacao]
 gb|EOY00659.1| Uncharacterized protein TCM_010569 [Theobroma cacao]
Length=321

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 170/314 (54%), Gaps = 39/314 (12%)
 Frame = +3

Query  450   DQKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY  617
             DQ++A+E A+     QS    ++  K+A   R IT+TW ++L+ H LS+ V+ P  D HY
Sbjct  15    DQRQADEPASVGRSGQSVFMSVYRTKLAGQCRLITVTWCRNLLLHGLSVSVQGPDGDEHY  74

Query  618   TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVI  797
              CK++LK W FW K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+
Sbjct  75    RCKVELKPWYFWRKQGSKHFIVDGRTVDVVWDLKAAKFNGETEPRSDYYVAIVCEDEVVL  134

Query  798   LLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSG  977
             LLGDQK +A+++T  RP +++  LV ++E ++ KR F TR         H+I +E +   
Sbjct  135   LLGDQKKDAYRKTGCRPSLIEPMLVSRREHIFGKRKFSTRVKFNDKGTFHDISVECNNCI  194

Query  978   PT-------EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDS  1136
              +       +P + I VDG  +++V +L W+FRGNE++ V    VEVFWDVHDW+F    
Sbjct  195   SSNSSSDGFDPVLEIRVDGKVAIQVKHLQWKFRGNESINVGKSGVEVFWDVHDWLF----  250

Query  1137  SSVAAGP--GVFIFKQgnggkgeg------------------eeDNSLPQKSCD-DSQSR  1253
                 +GP  G+FIF                              +  +   S D D+ + 
Sbjct  251   ---GSGPRHGLFIFNPIPSSSVSPSSISAPSSPPTSSWTSMPVSNQEVNSASGDYDNAAG  307

Query  1254  PPEFCHVFYAWKTE  1295
               +FC   YAWK E
Sbjct  308   SSKFCLFLYAWKVE  321



>gb|ACF81406.1| unknown [Zea mays]
 gb|AFW66165.1| hypothetical protein ZEAMMB73_127655 [Zea mays]
Length=301

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 168/283 (59%), Gaps = 27/283 (10%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSE-DNHYTCKIDLKTWQFWGK  659
             Q     + LAKI    R +T  WSKSLI  + ++ +E P + D   T +++LK W FW K
Sbjct  34    QCSTVSVFLAKINGAARHVTAVWSKSLINQSFTVSIERPGDGDGPVTHRVELKPWPFWSK  93

Query  660   KGLKSFNVDQ-ERVDVYWDFRAAKFS---SSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             KG K+ +V   +RVD++WD R+AKF+   SSPEP   +YVAL +  EVV+LLGD K +A+
Sbjct  94    KGGKALDVGGGDRVDMFWDLRSAKFAAAGSSPEPAGGYYVALVSNDEVVLLLGDCKKDAY  153

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCF-CTRTMLGRGKREHNIIIETDLSGPT---EPEM  995
             KRTK+RP + DA LV ++ESV+ +R F     +  R  +EH I+IE  L+      +PEM
Sbjct  154   KRTKARPSLEDAVLVCRRESVFGRRSFAARARLDARRSKEHEIVIEYALAAAGSSRDPEM  213

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG---VF  1166
             WI+VDG   + V +L W+FRGNET++VD   V+V WDVHDW+F        AGPG   VF
Sbjct  214   WITVDGSVLLHVKSLQWKFRGNETLLVDEEPVQVIWDVHDWLF--------AGPGTQAVF  265

Query  1167  IFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             +FK G   + + +   +  Q    D       FC    AW+TE
Sbjct  266   VFKPGAPPEIQEDSGGNAIQGDGTD-------FCFFLQAWRTE  301



>ref|XP_008239343.1| PREDICTED: uncharacterized protein LOC103337946 [Prunus mume]
Length=324

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 150/244 (61%), Gaps = 17/244 (7%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             +  S    ++ AKIAD  R ITITW K+L+ H LS+ +E P  +N  TCK++LK W FW 
Sbjct  27    SGHSVYMSVYRAKIADQCRLITITWCKNLLLHGLSVSLEGPDGENQQTCKVELKPWYFWR  86

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F VD + VD++WD ++AKF+   EP S++YVA+    EVV+LLGD K +A+++T
Sbjct  87    KQGSKRFVVDGKAVDIFWDLKSAKFNGGTEPKSEYYVAVVCDEEVVLLLGDLKKDAYRKT  146

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-----------TDLSGPT  983
               RP ++D TLV KKE ++ K+ F T+       R H I IE             L+G  
Sbjct  147   GYRPALIDPTLVSKKEHIFGKKKFSTKAKFYERGRLHEIAIECKNRAGSISNGNSLNG-V  205

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             EPE+ I VDG   V V +L W+FRGNE++ ++ + +EV+WDVHDW+F     S      +
Sbjct  206   EPELEIRVDGHLVVHVKHLQWKFRGNESIHINKLRIEVYWDVHDWLF-----SPGLRHAL  260

Query  1164  FIFK  1175
             FIFK
Sbjct  261   FIFK  264



>ref|XP_007208899.1| hypothetical protein PRUPE_ppa026898mg [Prunus persica]
 gb|EMJ10098.1| hypothetical protein PRUPE_ppa026898mg [Prunus persica]
Length=324

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 150/244 (61%), Gaps = 17/244 (7%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             +  S    ++ AKIAD  R ITITW K+L+ H LS+ +E P  +N  TCK++LK W FW 
Sbjct  27    SGHSVYMSVYRAKIADQCRLITITWCKNLLLHGLSVSLEGPDGENQQTCKVELKPWYFWR  86

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F VD + VD++WD ++AKF+   EP S++YVA+    EVV+LLGD K +A+++T
Sbjct  87    KQGSKRFVVDGKAVDIFWDLKSAKFNGGTEPKSEYYVAVVCDEEVVLLLGDLKKDAYRKT  146

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-----------TDLSGPT  983
               RP ++D TLV KKE ++ K+ F T+       R H I IE             L+G  
Sbjct  147   GYRPALIDPTLVSKKEHIFGKKKFSTKAKFYERGRLHEIAIECKNRAGSISNGNSLNG-V  205

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGV  1163
             EPE+ I VDG   V V +L W+FRGNE++ ++ + +EV+WDVHDW+F     S      +
Sbjct  206   EPELEIRVDGHLVVHVKHLQWKFRGNESIHINKLRIEVYWDVHDWLF-----SPGLRHAL  260

Query  1164  FIFK  1175
             FIFK
Sbjct  261   FIFK  264



>ref|XP_010090262.1| hypothetical protein L484_006168 [Morus notabilis]
 gb|EXB39200.1| hypothetical protein L484_006168 [Morus notabilis]
Length=299

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/279 (38%), Positives = 159/279 (57%), Gaps = 15/279 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  ++      ITITWSKSL+G  L++ +++ S  N   CK+D+K W F  ++
Sbjct  28    QNLVTCVYQCRLRGKSCLITITWSKSLMGQGLTVGIDDSS--NQCLCKVDIKPWLFSKRR  85

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G KS      ++D+YWD  +AKF S PEP   +YVA+    ++V+LLGD + EAFK+T +
Sbjct  86    GSKSLEAYSSKIDIYWDLSSAKFGSGPEPLEGYYVAVVVDRQMVLLLGDLRKEAFKKTGA  145

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P   DA  V KKE ++ KR F T+       + H++ IE D  G ++P + I VDG   
Sbjct  146   NPVASDAVFVAKKEHIFGKRVFTTKAQFCNNGQSHDLAIECDTIGVSDPCLVIRVDGKNL  205

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             ++V  L W+FRGN T++VD +A+EVFWD+H+W+F       + G  VF+FK     +   
Sbjct  206   MQVKRLRWKFRGNHTILVDGLAIEVFWDLHNWLFG-----ASLGNAVFMFKTCLSAEKLW  260

Query  1203  eeD-----NSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
                     NS+P    +   DS+     F  + YAWK E
Sbjct  261   ASQPLSDPNSMPWSFSQRFTDSKGLGLGFSLILYAWKNE  299



>ref|NP_001131873.1| hypothetical protein [Zea mays]
 ref|XP_008676536.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80479.1| unknown [Zea mays]
 gb|AFW66164.1| hypothetical protein ZEAMMB73_127655 [Zea mays]
Length=309

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 168/283 (59%), Gaps = 27/283 (10%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSE-DNHYTCKIDLKTWQFWGK  659
             Q     + LAKI    R +T  WSKSLI  + ++ +E P + D   T +++LK W FW K
Sbjct  42    QCSTVSVFLAKINGAARHVTAVWSKSLINQSFTVSIERPGDGDGPVTHRVELKPWPFWSK  101

Query  660   KGLKSFNVDQ-ERVDVYWDFRAAKFS---SSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             KG K+ +V   +RVD++WD R+AKF+   SSPEP   +YVAL +  EVV+LLGD K +A+
Sbjct  102   KGGKALDVGGGDRVDMFWDLRSAKFAAAGSSPEPAGGYYVALVSNDEVVLLLGDCKKDAY  161

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCF-CTRTMLGRGKREHNIIIETDLSGPT---EPEM  995
             KRTK+RP + DA LV ++ESV+ +R F     +  R  +EH I+IE  L+      +PEM
Sbjct  162   KRTKARPSLEDAVLVCRRESVFGRRSFAARARLDARRSKEHEIVIEYALAAAGSSRDPEM  221

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG---VF  1166
             WI+VDG   + V +L W+FRGNET++VD   V+V WDVHDW+F        AGPG   VF
Sbjct  222   WITVDGSVLLHVKSLQWKFRGNETLLVDEEPVQVIWDVHDWLF--------AGPGTQAVF  273

Query  1167  IFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             +FK G   + + +   +  Q    D       FC    AW+TE
Sbjct  274   VFKPGAPPEIQEDSGGNAIQGDGTD-------FCFFLQAWRTE  309



>ref|XP_009628338.1| PREDICTED: uncharacterized protein LOC104118721 [Nicotiana tomentosiformis]
Length=319

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 147/226 (65%), Gaps = 9/226 (4%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYTCKIDLKTWQFW  653
             + QS    ++  KIAD  R IT+TW K+L+ H LS+ VE   S D+ YTCK++LK W FW
Sbjct  25    SGQSIFMSVYRTKIADQCRLITVTWCKNLLLHGLSVSVEGSNSGDSQYTCKVELKPWYFW  84

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
              K+G K F VD + VD+YWD +AAKF+   EP SD+YVA+    EV++LLGD K +A+++
Sbjct  85    RKQGSKHFLVDNKPVDIYWDLKAAKFNGETEPSSDYYVAVVCDEEVILLLGDLKKDAYRK  144

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET----DLSGPT----EP  989
             T  RP +++ TLV +KE ++ K+ F TR       R H I IE     + SG +    +P
Sbjct  145   TGCRPALIEPTLVSRKEHIFGKKKFSTRVKFHDKGRMHEISIECKNRINSSGISIDGVDP  204

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFN  1127
             EM I +DG   + V +L W+FRGNE++ ++ V +EV+WDVHDW+FN
Sbjct  205   EMEIRIDGKLFIHVKHLQWKFRGNESIHLNKVRIEVYWDVHDWIFN  250



>ref|XP_002282388.2| PREDICTED: probable protein phosphatase 2C 14 [Vitis vinifera]
Length=710

 Score =   218 bits (555),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 167/289 (58%), Gaps = 19/289 (7%)
 Frame = +3

Query  459   EAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLK  638
             +A  + + QS    ++  KIA   R ITITW K L+ H LS+ V+ P  D+HY  K++LK
Sbjct  431   QAAVTRSSQSVFMSVYRTKIAGQCRLITITWCKDLLLHGLSVSVQGPDGDSHYQSKVELK  490

Query  639   TWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKS  818
              W FW K+G K F VD + VDV WD +AAKF+   EP SD+YVA+    EVV+LLGD K 
Sbjct  491   PWYFWRKQGSKHFTVDGKTVDVVWDLKAAKFNGETEPRSDYYVAIVCEEEVVLLLGDLKK  550

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-------TDLSG  977
             +A+++T  RP +++ TLV +KE ++ K+ F T+         H I IE          SG
Sbjct  551   DAYRKTGCRPALIEPTLVSRKEHLFGKKKFSTKVKFHEKGNFHEISIECNNSLNKNSSSG  610

Query  978   PTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP  1157
               + EM I +DG  +  V +L W+FRGNE+V V+   VEV+WDVHDW+F       ++GP
Sbjct  611   EFDHEMEIRIDGRLANHVKHLQWKFRGNESVYVNKTRVEVYWDVHDWLF-------SSGP  663

Query  1158  --GVFIFKQ-gnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
               G+FIFK   +      +  +S   + C  S+ R  +FC   YAWK E
Sbjct  664   RQGLFIFKPISSSTLLSTQIADSTAGEEC--SEGRSSKFCSFLYAWKVE  710



>ref|XP_004236272.1| PREDICTED: uncharacterized protein LOC101245536 [Solanum lycopersicum]
Length=319

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 154/251 (61%), Gaps = 21/251 (8%)
 Frame = +3

Query  459   EAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLK  638
              A  + + QS    ++  KIAD  R IT+TW K+L+ H LS+ V+  S D  YTCK++LK
Sbjct  20    HAAVTRSGQSIFMSVYRTKIADQCRLITVTWCKNLLLHGLSVSVDGSSGDGQYTCKVELK  79

Query  639   TWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKS  818
              W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EV++LLGD K 
Sbjct  80    PWYFWRKQGSKHFLVDSKPVDIFWDLKAAKFNGETEPSSEYYVAVVCDEEVILLLGDLKK  139

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET----DLSGPT-  983
             +A+++T  RP +++  LV +KE V+ K+ F TR       R H I IE     + SG + 
Sbjct  140   DAYRKTGCRPALIEPILVSRKEHVFGKKKFLTRVKFHDKGRMHEISIECKNRINSSGISI  199

Query  984   ---EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
                +PEM I +DG   + V +L W+FRGNE++ ++ V +EV+WDVHDW+FN         
Sbjct  200   DGVDPEMEIRIDGKLFIHVKHLQWKFRGNESIHLNKVRIEVYWDVHDWIFN---------  250

Query  1155  PG----VFIFK  1175
             PG    +FIFK
Sbjct  251   PGLRHALFIFK  261



>ref|XP_006484324.1| PREDICTED: uncharacterized protein LOC102618638 [Citrus sinensis]
Length=742

 Score =   218 bits (555),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 169/313 (54%), Gaps = 39/313 (12%)
 Frame = +3

Query  453   QKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             +++A++ AT     QS    ++  K+A   R IT+TW K+L+ H LS+ VE P  D HY 
Sbjct  437   ERQADDPATVARSGQSVFMSVYRTKLAGECRLITVTWCKNLLLHGLSVSVEGPDGDEHYR  496

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K   VD   VD++WD +AAKF+   EP SD+YVA+    EVV+L
Sbjct  497   CKVELKPWYFWRKQGSKHITVDSRAVDIFWDLKAAKFNGETEPRSDYYVAIVCEEEVVLL  556

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLS--  974
             LGD K +AF++T  RP +++ TLV +KE V+ K+ F TR         H+I +E + +  
Sbjct  557   LGDLKKDAFRKTGCRPSLIEPTLVSRKEHVFGKKKFSTRVKFQEKAPLHDISVECNNNIN  616

Query  975   -----GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSS  1139
                  G  +PE+ I VDG  +V V +L+W+FRGNE + +    VEV+WDVHDW+F     
Sbjct  617   CDSNLGGFDPELEIRVDGKRAVHVRHLHWKFRGNEFINISKTRVEVYWDVHDWLF-----  671

Query  1140  SVAAGP--GVFIFK-------------------QgnggkgegeeDNSLPQKSCDDSQSRP  1256
                +GP  G+FIFK                              D S  +   D++    
Sbjct  672   --GSGPRHGLFIFKPVAVTSSSASKSTPSSPESSAAKLAEFCSHDPSSAENDDDNAAGVS  729

Query  1257  PEFCHVFYAWKTE  1295
               FC   YAWK E
Sbjct  730   SGFCLFLYAWKVE  742



>gb|AFK39419.1| unknown [Lotus japonicus]
Length=322

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 160/296 (54%), Gaps = 28/296 (9%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  K+AD  R ITITW K+L+ H LS+ VE P  ++ Y CK++LK W FW 
Sbjct  32    SGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGESQYNCKVELKPWYFWR  91

Query  657   KKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             K+G K F +D  + VDV+WD + AKF+   EP S++YVA+    EVV+LLGD K EA++R
Sbjct  92    KQGSKRFIIDGTKAVDVFWDLKGAKFNGETEPISEYYVAVVCDEEVVLLLGDLKKEAYRR  151

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT--------EP  989
             T  RP ++D  LV KKE ++ K+ F TR       R H I IE    G +        +P
Sbjct  152   TGCRPALIDPILVSKKEHIFGKKRFSTRAKFHEKGRWHEISIECKSRGRSFSNGDSGVQP  211

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EM I +DG   + V +L W+FRGNE++ +  + VEV+WD HDW+F     S      +FI
Sbjct  212   EMEIRIDGHLVIHVKHLQWKFRGNESIRLSKMRVEVYWDAHDWLF-----SPGLKHALFI  266

Query  1170  FK-------------QgnggkgegeeDNSLPQKSCDD-SQSRPPEFCHVFYAWKTE  1295
             FK                          ++  +S +  S S   EFC   YAWK E
Sbjct  267   FKPVLSSTSSLPSCSSPLSSVSSPLSAQTMSSESVEGFSVSGSSEFCLFLYAWKVE  322



>ref|XP_004970997.1| PREDICTED: uncharacterized protein LOC101768022 [Setaria italica]
Length=312

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 44/305 (14%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP--------------  599
             A  + + QS VT ++ A IA   R +T+TW ++L+ H LS+ +E                
Sbjct  25    AAATRSGQSAVTLVYRAGIAGHDRLVTVTWCRNLLTHGLSVSIEGSAGAGKDKTGREWGE  84

Query  600   ----------SEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEP  749
                       S+     CK++++ W FW K G K F VD + +DV WD R+A++S  PEP
Sbjct  85    AGGGGGGGAASKSCSSACKVEMQPWHFWRKYGAKQFQVDGKAIDVVWDLRSARYSDEPEP  144

Query  750   DSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLG  929
              SD+YVA+ +G EVV+LLG+ K EAF+RT SRP + DA LV KKE V++K+ F T+    
Sbjct  145   LSDYYVAVVSGEEVVLLLGNLKKEAFRRTGSRPSLQDAVLVCKKEHVFSKKRFLTKARFH  204

Query  930   RGKREHNIIIET---DLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVF  1100
                + H+I IE    +L+G  + +M I +DG  +V V +L W+FRGNE + +D + V+V+
Sbjct  205   EKGKLHDISIECSSGNLNGGVDVDMVIKIDGSVNVLVRHLQWKFRGNECISIDQLKVQVY  264

Query  1101  WDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFY  1280
             WD HDW+F     +      +FIFK              LP  S D       +FC   Y
Sbjct  265   WDAHDWLFGTGMRN-----ALFIFKP------------ELPSTSADFHTDECSDFCLFLY  307

Query  1281  AWKTE  1295
             AWK E
Sbjct  308   AWKVE  312



>ref|XP_006344483.1| PREDICTED: uncharacterized protein LOC102586788 [Solanum tuberosum]
Length=319

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 154/251 (61%), Gaps = 21/251 (8%)
 Frame = +3

Query  459   EAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLK  638
              A  + + QS    ++  KIAD  R IT+TW K+L+ H LS+ V+  S D  YTCK++LK
Sbjct  20    HAAVTRSGQSIFMSVYRTKIADQCRLITVTWCKNLLLHGLSVSVDGSSGDGQYTCKVELK  79

Query  639   TWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKS  818
              W FW K+G K F VD + VD++WD +AAKF+   EP S++YVA+    EV++LLGD K 
Sbjct  80    PWYFWRKQGSKHFLVDSKPVDIFWDLKAAKFNGETEPSSEYYVAVVCDEEVILLLGDLKK  139

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIET----DLSGPT-  983
             +A+++T  RP +++  LV +KE V+ K+ F TR       R H I IE     + SG + 
Sbjct  140   DAYRKTGCRPALIEPILVSRKEHVFGKKKFSTRVKFHDKGRMHEISIECKNRINSSGISI  199

Query  984   ---EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
                +PEM I +DG   + V +L W+FRGNE++ ++ V +EV+WDVHDW+FN         
Sbjct  200   DGVDPEMEIRIDGKLFIHVKHLQWKFRGNESIHLNKVRIEVYWDVHDWIFN---------  250

Query  1155  PG----VFIFK  1175
             PG    +FIFK
Sbjct  251   PGLRHALFIFK  261



>ref|XP_008372607.1| PREDICTED: uncharacterized protein LOC103435955, partial [Malus 
domestica]
Length=470

 Score =   213 bits (541),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 150/240 (63%), Gaps = 10/240 (4%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A E  + QS    ++  KIA   R IT+ W K+L+ H LS+ V+  + D    CKI+LK 
Sbjct  210   AGEIRSGQSMFMSVYSTKIAGQCRLITVNWCKNLLLHGLSVSVQGQNRDEECRCKIELKP  269

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK  
Sbjct  270   WYFWRKQGSKQFTVDGSAVDVVWDLKAAKFNGETEPQSDYYVAIVCEDEVVLLVGDQKKA  329

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-TDLSGPTEPEMW  998
             AF++T  RP +++  LV  +E ++ KR F TR      +  H I+IE ++ S  ++PE+ 
Sbjct  330   AFRKTACRPSLIEPILVSMREHLFGKRKFSTRIKFHEKENFHEILIECSNGSDGSDPELE  389

Query  999   ISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIF  1172
             I +DGI++VRV  L+W+FRGN+ V V+   VEVFWDVHDW+F        +GP  G+FIF
Sbjct  390   IKIDGIQAVRVKRLHWKFRGNDCVDVNRNRVEVFWDVHDWLF-------CSGPRHGLFIF  442



>ref|XP_010912954.1| PREDICTED: uncharacterized protein LOC105038765 [Elaeis guineensis]
Length=310

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/307 (39%), Positives = 170/307 (55%), Gaps = 23/307 (7%)
 Frame = +3

Query  423   LRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVV----  590
               P  P  +D      + + +S VT ++   IA   R  T+TW K ++ H LSI V    
Sbjct  11    FNPGEPTADDPTSISATKSGKSIVTSVYQTMIAGHCRLFTVTWCKDVLVHELSISVVEDS  70

Query  591   ENPSEDN------HYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPD  752
              N  E N        +CK++L+ W FW K+G K F+V+ + VDV+WD ++AKFS  PEP 
Sbjct  71    NNVGETNINSSGKQQSCKVELRPWYFWRKQGWKRFHVEGKPVDVFWDLKSAKFSGEPEPR  130

Query  753   SDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGR  932
             S++YVA  +G EVV+LLGD   EA++RT  RP  +DATLV +KE+V+ K+ F TR     
Sbjct  131   SNYYVAAVSGDEVVLLLGDLNKEAYRRTGCRPATLDATLVSRKENVFGKKRFVTRARFSE  190

Query  933   GKREHNIIIETDLS---GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFW  1103
               + H I+IE   S      +PEM I VD   ++ V +L W+FRGN+++ V+   VEV+W
Sbjct  191   KGKLHEILIECSSSIGRSNKDPEMVIKVDAHVAIHVSHLQWKFRGNQSITVNKARVEVYW  250

Query  1104  DVHDWMFNDDSSSVAAGP--GVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPE-FCHV  1274
             DVHDW+F       + GP   +FIFK  +  +      +SL      +S +     FC  
Sbjct  251   DVHDWLF-------SPGPRHALFIFKPRSVLQSSTSSSSSLSSFDGKNSNADGSSGFCLF  303

Query  1275  FYAWKTE  1295
              YAWK E
Sbjct  304   LYAWKLE  310



>ref|XP_006382769.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
 gb|ERP60566.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
Length=299

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 164/290 (57%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITITWSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITITWSKNLMGQGLSVGIDDSA--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  +AKF S PEP   FYVA+    ++V++LGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSSAKFGSGPEPFEGFYVAVVVDRQMVLILGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ K+ FCT+       + H+++IE D  G ++P
Sbjct  135   MRKEAFKKTGATPIPSNAVFVAKREHVFGKKVFCTKARFCDNGQIHDLVIECDTIGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +A+EVFWDVH+W+F       + G  VF+
Sbjct  195   CLLVRVDCKTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHNWLFG-----ASVGNAVFM  249

Query  1170  FKQgnggkgegeeD-----NSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK     +           N LP    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCTSAEKLWSSQPLSDPNVLPWSFSQRFLDSKSQNLGFSLILYAWKHE  299



>ref|XP_007207341.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
 gb|EMJ08540.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
Length=299

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 162/290 (56%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S T Q+ VTC++  ++      IT+TWSK+L+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSNTSRTAQNLVTCVYQCRLRGRSCLITVTWSKNLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++++LLGD
Sbjct  75    DIKPWLFSKRRGFKSLEAYSSKIDIYWDLSSAKFGSGPEPLGGYYVGVVVDRQMLLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ KR F T+       + H+++IE D  G  +P
Sbjct  135   MRKEAFKKTSASPVPSNAVCVAKREHVFGKRGFTTKAQFSNNGQVHDLVIECDTLGVNDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+
Sbjct  195   CLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSPGNAVFM  249

Query  1170  FKQgngg----kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
             FK           +   D S  Q    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWASQPLSDPSALQWSFSQRFSDSKSQGLGFSLILYAWKNE  299



>ref|XP_008218232.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218233.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218234.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218235.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
Length=299

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 162/290 (56%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S T Q+ VTC++  ++      IT+TWSK+L+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSNTSRTAQNLVTCVYQCRLRGRSCLITVTWSKNLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++++LLGD
Sbjct  75    DIKPWLFSKRRGFKSLEAYSSKIDIYWDLSSAKFGSGPEPLGGYYVGVVVDRQMLLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ KR F T+       + H+++IE D  G  +P
Sbjct  135   MRKEAFKKTSASPVPSNAVCVAKREHVFGKRGFTTKAQFSNNGQLHDLVIECDTLGVNDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+
Sbjct  195   CLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSPGNAVFM  249

Query  1170  FKQgngg----kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
             FK           +   D S  Q    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWASQPLSDPSALQWSFSQRFSDSKSQGLGFSLILYAWKNE  299



>ref|XP_011005698.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005699.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005700.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
Length=299

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 164/290 (57%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITI WSK+L+G  LS+V+++ +  NH  CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITIIWSKNLMGQGLSVVIDDSA--NHCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  +AKF S PEP   FYVA+    ++ +LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSSAKFGSGPEPSEGFYVAVVVDSQMALLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ K+ F T+       + H+++IE D  G ++P
Sbjct  135   MRKEAFKKTGATPIPSNAVFVAKREHVFGKKAFRTKARFCDNGQIHDLVIECDTIGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVE+FWDVH+W+F       + G  VF+
Sbjct  195   CLLLRVDCKTVMQVKQLRWKFRGNHTILVDGLAVELFWDVHNWLFG-----TSVGNAVFM  249

Query  1170  FKQgnggkgegeeD-----NSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK  +  +           N LP    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCSSAERLWASQPLSDPNVLPWSFSQRFLDSRSQNLGFSLILYAWKHE  299



>ref|XP_006433029.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 ref|XP_006471721.1| PREDICTED: uncharacterized protein LOC102630218 isoform X1 [Citrus 
sinensis]
 ref|XP_006471722.1| PREDICTED: uncharacterized protein LOC102630218 isoform X2 [Citrus 
sinensis]
 gb|ESR46269.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 gb|KDO41101.1| hypothetical protein CISIN_1g022287mg [Citrus sinensis]
Length=299

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 166/290 (57%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  +   Q+ VT ++ A+I      ITITWSK+L+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSNAAKNAQNLVTSVYQARIRGRSCLITITWSKNLMGQGLSVGIDDAS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS       +D+YWD  +AKF S PEP   FYV++    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCIIDIYWDLSSAKFGSGPEPLEGFYVSVVVDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E ++ K+ F T+     G + H+++IE D  G  +P
Sbjct  135   MRKEAFKKTNATPVPSNAVFVAKREHLFGKKVFFTKAQFCNGGQIHDLVIECDTHGMNDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VDG   ++V +L W+FRGN T++VD + VEVFWDVH+W+F       + G  VF+
Sbjct  195   CLMVRVDGKSVMKVKHLRWKFRGNHTILVDGLPVEVFWDVHNWLFG-----ASVGNAVFM  249

Query  1170  FK-----QgnggkgegeeDNSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK     +     G   + N+LP    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWASGPLSDPNTLPWSFSQRFLDSKSQSLGFSLILYAWKNE  299



>ref|XP_007030623.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
 gb|EOY11125.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
Length=300

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 161/291 (55%), Gaps = 16/291 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      IT+TWSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITVTWSKNLMGQGLSVGIDDSA--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  +AKF S PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSSAKFGSGPEPLEGFYVGVVADKQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EA+K+T + P    A  V KKE V+ K+ F T+       + H++IIE D  G  +P
Sbjct  135   MRKEAYKKTGATPVPSTAVYVAKKEHVFGKKVFGTKAQFCDNGQIHDLIIECDTIGVNDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +DG   ++V  L W+FRGN T++VD +AVEV+WDVH+W+F       + G  VF+
Sbjct  195   CLIIRLDGKTLMQVKRLRWKFRGNHTILVDGMAVEVYWDVHNWLFG-----ASLGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSC---------DDSQSRPPEFCHVFYAWKTE  1295
             FK     + +      +P  S           DS+S+   F  + YAWK E
Sbjct  250   FKTFLAAEEKLWVSQPIPNPSTLQWSFSQRFQDSKSQNLGFSLILYAWKNE  300



>ref|XP_002319062.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
 gb|EEE94985.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
Length=299

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 163/290 (56%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITITWSK+L+G  LS+ +++ +  NH  CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITITWSKNLMGQGLSVGIDDSA--NHCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  +AKF S PEP   FYVA+    ++ +LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSSAKFGSGPEPSEGFYVAVVVDRQMALLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +   V K+E V+ K+ F T+       + H+++IE D  G ++P
Sbjct  135   MRKEAFKKTGATPIPSNTVFVAKREHVFGKKAFRTKAQFCDNGQIHDLVIECDTIGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVE+FWDVH+W+F       + G  VF+
Sbjct  195   CLLLRVDCKTVMQVKQLRWKFRGNHTILVDGLAVELFWDVHNWLFG-----TSVGNAVFM  249

Query  1170  FKQgnggkgegeeD-----NSLPQKSCD---DSQSRPPEFCHVFYAWKTE  1295
             FK  +  +           N LP+       DS+S+   F  + YAWK E
Sbjct  250   FKTCSSAEKLWASQPLSDPNGLPRSFSQRFLDSRSQNLGFSLILYAWKHE  299



>ref|XP_003601156.1| hypothetical protein MTR_3g076610 [Medicago truncatula]
 gb|AES71407.1| protein phosphatase 2c, putative [Medicago truncatula]
Length=339

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 157/310 (51%), Gaps = 50/310 (16%)
 Frame = +3

Query  501   IHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFN  680
             ++  K+A   R ITITW K+L+ H LS+ VENP ++  Y+CK++LK W FW K+G K F 
Sbjct  35    VYRTKLAGHCRLITITWCKNLMLHGLSVTVENPEKETQYSCKVELKPWYFWRKQGSKRFT  94

Query  681   VDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVD  860
             VD + VDV+WD ++AKF+   EP S++YVA+    EVV+LLGD K EA++RT  RP ++D
Sbjct  95    VDGKAVDVFWDLKSAKFNGETEPTSEYYVAVVCDQEVVLLLGDLKKEAYRRTGCRPSLID  154

Query  861   ATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGP--------------------  980
               LV KKE ++ KR F T+       R H I I+    G                     
Sbjct  155   PILVSKKEHIFGKRKFSTKAKFHEKGRCHEISIKCKNKGSNSGNNVVGDGDSVMIGGGVQ  214

Query  981   TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              +PEM I  DG   V V +L W+FRGNE + ++ + VEV+WDVHDW+F     S      
Sbjct  215   VQPEMEIRFDGHLVVHVKHLQWKFRGNELIHLNKMRVEVYWDVHDWLF-----SPGLKHA  269

Query  1161  VFIFKQgnggkgeg-----------------eeDNSLPQKSCDDSQSR--------PPEF  1265
             +FIFK                             N     +CD  + R          E+
Sbjct  270   LFIFKPVFTCHSMSPFSLFSPSLSCSSSSTTPLSNETRSSTCDSVEGRSVSDSLSSSSEY  329

Query  1266  CHVFYAWKTE  1295
             C   YAWK E
Sbjct  330   CLFLYAWKVE  339



>ref|XP_009798084.1| PREDICTED: uncharacterized protein LOC104244370 [Nicotiana sylvestris]
Length=370

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 155/248 (63%), Gaps = 22/248 (9%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENP-SEDNHYTCKIDLKTWQ  647
             + + QS    ++  KIAD  R IT+TW K+L+ H LS+ VE   S D+ YTCK++LK W 
Sbjct  74    TRSGQSIFMSVYRTKIADQCRLITVTWCKNLLLHGLSVSVEGSNSGDSQYTCKVELKPWY  133

Query  648   FWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             FW K+G K F VD + VD+YWD +AAKF+   EP S++YVA+    EV++LLGD K +A+
Sbjct  134   FWRKQGSKHFLVDNKPVDIYWDLKAAKFNGETEPSSEYYVAVVCDEEVILLLGDLKKDAY  193

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE----TDLSGPT----  983
             ++T  RP +++ TLV +KE ++ K+ F TR       R H I IE     + SG +    
Sbjct  194   RKTGCRPALIEPTLVSRKEHIFGKKRFSTRVKFHDKGRMHEISIECKNRINSSGISIDGV  253

Query  984   EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG-  1160
             +PEM I +DG   + V +L W+FRGNE++ ++ V +EV+WDVHDW+FN         PG 
Sbjct  254   DPEMEIRIDGKLFIHVKHLQWKFRGNESIHLNKVRIEVYWDVHDWIFN---------PGL  304

Query  1161  ---VFIFK  1175
                +FIF+
Sbjct  305   RHALFIFR  312



>emb|CDX85324.1| BnaC07g26350D [Brassica napus]
Length=278

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 159/276 (58%), Gaps = 29/276 (11%)
 Frame = +3

Query  510   AKIADLLRTIT--------ITWSKSLIGHALSIVVENPSEDNHYTCKIDL-KTWQFWGKK  662
             AKI D  +T+            S +L+ H+L+++V +   D +Y CKIDL K WQFW K+
Sbjct  18    AKITDTTKTVAQLKSAATPTPHSTNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFWSKR  77

Query  663   GLKSFNVDQERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             G KSF+V+   V+V+WD R+AK S   SPEP SD+YVA+ +  EVV+LLGD K +A+KRT
Sbjct  78    GSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLLGDLKHKAYKRT  137

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
             KSRP +V+  +  KKES++ K+ F TR      ++ H +++E+  +   + EMWISVDGI
Sbjct  138   KSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKGHELVVESS-NDEKDQEMWISVDGI  196

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               V V NL W+FRGN  V+VD   V V++DVHDW+F   SS   A  G+F          
Sbjct  197   VLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFG--SSESTASSGLFF---------  245

Query  1197  egeeDNSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
                   S P     S      +  EFC   YA K E
Sbjct  246   ---GGGSSPLSRYNSASSGYGQLHEFCLFLYAGKLE  278



>ref|XP_010256015.1| PREDICTED: uncharacterized protein LOC104596517 [Nelumbo nucifera]
Length=298

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 162/286 (57%), Gaps = 15/286 (5%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             +  S T Q+ VTC++ +++      IT+TWSK+L+G  LS+ +++ +  N   CK+D+K 
Sbjct  20    SNASKTAQNLVTCVYRSRLRGRSCLITVTWSKNLMGQGLSVGIDDST--NQCLCKVDIKP  77

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W F  +KG KS   D  +VD+YWD  +AKF SSPEP   FY+A+    E+V+LLGD   E
Sbjct  78    WLFSKRKGFKSLEADSSKVDIYWDLSSAKFGSSPEPLEGFYLAVVFDREMVLLLGDLSKE  137

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWI  1001
             A+K+T + P    A  + K+E ++ KR + T+       + H++ IE D  G  +P + I
Sbjct  138   AYKKTSAAPVPSSAIFIAKREHIFGKRVYGTKAQFCDNGQIHDVTIECDTVGLNDPCLLI  197

Query  1002  SVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
              +D    ++V  L W+FRGN+T++VD + VEVFWDVH+W+F       A G  VF+F+  
Sbjct  198   RIDTKTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLFGP-----ALGSAVFMFQTC  252

Query  1182  nggkge----geeDNSLPQKSCD----DSQSRPPEFCHVFYAWKTE  1295
                +         D ++   SC     DSQ +   F  + YAWK E
Sbjct  253   LSAEKLWGSHTSSDPTIIPWSCSQIFRDSQLQGLGFSLILYAWKNE  298



>ref|XP_008455804.1| PREDICTED: uncharacterized protein LOC103495897 [Cucumis melo]
Length=299

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 162/295 (55%), Gaps = 25/295 (8%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +    T Q+ VTC++  ++      I++TWSK+L+G  LS+ +++ S  N   CK+
Sbjct  17    DFSSSNNGKTAQNLVTCVYQCRLRGRSCLISVTWSKNLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRRGSKSLEAYACKIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK++ S P    A  + KKE ++ K+ FC++       + H+IIIE D +G TEP
Sbjct  135   LRKEAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVTEP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++V+ +AVEVFWDVH W+F     S + G  VF+
Sbjct  195   CLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLF-----STSPGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
             FK     +          Q  CD             DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWGS-----QPVCDPNVLSWSFSQRFSDSKSQGLGFSLMLYAWKNE  299



>ref|XP_008802684.1| PREDICTED: uncharacterized protein LOC103716457 [Phoenix dactylifera]
Length=289

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 158/276 (57%), Gaps = 16/276 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T Q+ VTC++  ++      IT+TWSK+L+G  LSI +++ +  N   CK+++K W F  
Sbjct  27    TAQNLVTCVYQTQLCGRSCLITVTWSKNLMGQGLSIGIDDSA--NQSLCKVEIKPWLFSK  84

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             +KG KS   +  +VD++WD  AAKF S PEP   FYVA+    E+V+LLGD   EA+++T
Sbjct  85    RKGSKSLEAENSKVDIFWDLSAAKFGSGPEPLEGFYVAVVFDLEMVLLLGDLSKEAYRKT  144

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
              + PP   A  + K+E +Y K+ +CT+       + H+I IE ++ G  +P + I +D  
Sbjct  145   GASPPPSSAVFIAKREHIYGKKIYCTKAQFCDNGQVHDIAIECEMVGLKDPTLEIRIDKK  204

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               ++V  L W+FRGN+T++VD + VEVFWDVH+W+F         G  VF+F+       
Sbjct  205   RVMQVKRLVWKFRGNQTILVDGLPVEVFWDVHNWLFG-----APTGNAVFMFQ------T  253

Query  1197  egeeDNSLPQKSCD---DSQSRPPEFCHVFYAWKTE  1295
                 +  LP  S     +SQ +   F  + YAWK E
Sbjct  254   CVSAEKLLPWSSSQIFRESQLQGLGFSLILYAWKNE  289



>ref|XP_004139223.1| PREDICTED: uncharacterized protein LOC101220430 [Cucumis sativus]
 ref|XP_004156452.1| PREDICTED: uncharacterized LOC101220430 [Cucumis sativus]
Length=299

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 162/295 (55%), Gaps = 25/295 (8%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +    T Q+ VTC++  ++      I++TWSK+L+G  LS+ +++ S  N   CK+
Sbjct  17    DFSSSNNGKTAQNLVTCVYQCRLRGRSCLISVTWSKNLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRRGSKSLEAYACKIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK++ S P    A  + KKE ++ K+ FC++       + H+IIIE D +G TEP
Sbjct  135   LRREAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVTEP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++V+ +AVEVFWDVH W+F     S + G  VF+
Sbjct  195   CLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLF-----STSPGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
             FK     +          Q  CD             DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWGS-----QPVCDPNVLSWSFSQRFSDSKSQGLGFSLMLYAWKNE  299



>ref|XP_007138005.1| hypothetical protein PHAVU_009G173000g [Phaseolus vulgaris]
 gb|ESW09999.1| hypothetical protein PHAVU_009G173000g [Phaseolus vulgaris]
Length=332

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 150/245 (61%), Gaps = 17/245 (7%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  +  Y+CK++LK W FW 
Sbjct  27    SGQSVHMSVYRTKIADHCRLITITWCKNLMLHGLSVAVEGPEGEAQYSCKVELKPWYFWR  86

Query  657   KKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
             K+G K F V   + VDV+WD +AAKF+   EP S++YVA+    EVV+L+GD + EA++R
Sbjct  87    KQGSKRFLVHGNKAVDVFWDLKAAKFNGETEPISEYYVAVVCEQEVVLLVGDLRKEAYRR  146

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE----TDLSGPT------  983
             T  RP ++D  LV KKE ++ KR F TR       R H I IE    +++ G +      
Sbjct  147   TGCRPALIDPILVSKKEHIFGKRKFSTRAKFHEKGRCHEISIECKNKSNIGGESASSGVE  206

Query  984   -EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG  1160
              +PEM I +DG   + V +L W+FRGNE++ ++ + VEV+WDVHDW+F     S      
Sbjct  207   VQPEMEIRLDGHVVIHVKHLQWKFRGNESIHLNKMRVEVYWDVHDWLF-----SPGLKHA  261

Query  1161  VFIFK  1175
             +FIFK
Sbjct  262   LFIFK  266



>ref|XP_006645201.1| PREDICTED: uncharacterized protein LOC102718506 [Oryza brachyantha]
Length=311

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 165/297 (56%), Gaps = 39/297 (13%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH--------------  614
             + QS VT ++ A+I+   R +T+TW ++L+ H LS+ +E  + +                
Sbjct  30    SGQSAVTLVYRAEISGHSRLVTVTWCRNLLTHGLSVSIEGSAGNGKDKIGREYGEAADGA  89

Query  615   -------YTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVAL  773
                      CK++++ W FW K G K F VD   +DV WD R+A+FS  PEP SD+YVA+
Sbjct  90    GAGGKSCSACKVEMQPWHFWRKYGAKQFQVDGNAIDVVWDLRSARFSDEPEPLSDYYVAV  149

Query  774   ATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNI  953
              +G EVV+LLG+ K +AF+RT SRP + DA LV KKE V++K+ F T+       + H+I
Sbjct  150   VSGEEVVLLLGNLKKDAFRRTGSRPSLQDAVLVCKKEHVFSKKRFLTKARFHDKGKPHDI  209

Query  954   IIE---TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMF  1124
              IE   ++L+G  + +M I +DG  SV V +L W+FRGNE + ++ + V+V+WD HDW+F
Sbjct  210   SIECSSSNLTGGMDVDMVIKIDGCVSVLVRHLQWKFRGNECISINKLKVQVYWDAHDWLF  269

Query  1125  NDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
                         +FIFK           +   P+ S + +     +FC   YAWK E
Sbjct  270   G-----TGMRHALFIFKP----------EPPSPETSSEFNADGYSDFCLFLYAWKVE  311



>ref|XP_008351057.1| PREDICTED: probable protein phosphatase 2C 14 [Malus domestica]
Length=702

 Score =   213 bits (543),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 150/240 (63%), Gaps = 10/240 (4%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A E  + QS    ++  KIA   R IT+ W K+L+ H LS+ V+  + D    CKI+LK 
Sbjct  442   AGEIRSGQSMFMSVYSTKIAGQCRLITVNWCKNLLLHGLSVSVQGQNRDEECRCKIELKP  501

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK  
Sbjct  502   WYFWRKQGSKQFTVDGSAVDVVWDLKAAKFNGETEPQSDYYVAIVCEDEVVLLVGDQKKA  561

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-TDLSGPTEPEMW  998
             AF++T  RP +++  LV  +E ++ KR F TR      +  H I+IE ++ S  ++PE+ 
Sbjct  562   AFRKTACRPSLIEPILVSMREHLFGKRKFSTRIKFHEKENFHEILIECSNGSDGSDPELE  621

Query  999   ISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIF  1172
             I +DGI++VRV  L+W+FRGN+ V V+   VEVFWDVHDW+F        +GP  G+FIF
Sbjct  622   IKIDGIQAVRVKRLHWKFRGNDCVDVNRNRVEVFWDVHDWLF-------CSGPRHGLFIF  674



>ref|XP_011046236.1| PREDICTED: uncharacterized protein LOC105140891 [Populus euphratica]
 ref|XP_011046237.1| PREDICTED: uncharacterized protein LOC105140891 [Populus euphratica]
Length=328

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 152/258 (59%), Gaps = 22/258 (9%)
 Frame = +3

Query  453   QKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             +K A++ AT     QS     +  KIAD  R ITITW K+L+ H LS+ VE P  ++ YT
Sbjct  16    EKAADDPATVTRSGQSVFMSAYRTKIADQCRLITITWCKNLLLHGLSVSVEGPEGESQYT  75

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K F V+ + VD++WD +AAKF+   EP+S++YVA+    EVV+L
Sbjct  76    CKVELKPWYFWRKQGSKRFVVEGKAVDIFWDLKAAKFNGETEPNSEYYVAVVCDEEVVLL  135

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGP  980
             LGD K +A+++T  RP ++D  LV +KE ++ K+ F TR       R H I IE      
Sbjct  136   LGDLKKDAYRKTGCRPALIDPILVSRKEHIFGKKKFATRIKFHEKGRFHEISIECKNGSN  195

Query  981   T-------------EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWM  1121
             +             EPEM I +DG   + V +L W+FRGNE + +  + VEV+WD+HDW+
Sbjct  196   SGNIVSNGNSINGDEPEMEIRIDGHLVIHVKHLQWKFRGNEYINLRKLRVEVYWDIHDWL  255

Query  1122  FNDDSSSVAAGPGVFIFK  1175
             F     S      +FIFK
Sbjct  256   F-----SPGLRHALFIFK  268



>gb|KGN60826.1| hypothetical protein Csa_2G011590 [Cucumis sativus]
Length=335

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 162/295 (55%), Gaps = 25/295 (8%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +    T Q+ VTC++  ++      I++TWSK+L+G  LS+ +++ S  N   CK+
Sbjct  53    DFSSSNNGKTAQNLVTCVYQCRLRGRSCLISVTWSKNLMGQGLSVGIDDSS--NQCLCKV  110

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++V+LLGD
Sbjct  111   DIKPWLFSKRRGSKSLEAYACKIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGD  170

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK++ S P    A  + KKE ++ K+ FC++       + H+IIIE D +G TEP
Sbjct  171   LRREAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVTEP  230

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++V+ +AVEVFWDVH W+F     S + G  VF+
Sbjct  231   CLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLF-----STSPGNAVFM  285

Query  1170  FKQgnggkgegeeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
             FK     +          Q  CD             DS+S+   F  + YAWK E
Sbjct  286   FKTCLSAEKLWGS-----QPVCDPNVLSWSFSQRFSDSKSQGLGFSLMLYAWKNE  335



>ref|XP_008390094.1| PREDICTED: uncharacterized protein LOC103452380 [Malus domestica]
Length=738

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 150/240 (63%), Gaps = 10/240 (4%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A E  + QS    ++  KIA   R IT+ W K+L+ H LS+ V+  + D    CKI+LK 
Sbjct  442   AGEIRSGQSMFMSVYSTKIAGQCRLITVNWCKNLLLHGLSVSVQGQNRDEECRCKIELKP  501

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK  
Sbjct  502   WYFWRKQGSKQFTVDGSAVDVVWDLKAAKFNGETEPQSDYYVAIVCEDEVVLLVGDQKKA  561

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-TDLSGPTEPEMW  998
             AF++T  RP +++  LV  +E ++ KR F TR      +  H I+IE ++ S  ++PE+ 
Sbjct  562   AFRKTACRPSLIEPILVSMREHLFGKRKFSTRIKFHEKENFHEILIECSNGSDGSDPELE  621

Query  999   ISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIF  1172
             I +DGI++VRV  L+W+FRGN+ V V+   VEVFWDVHDW+F        +GP  G+FIF
Sbjct  622   IKIDGIQAVRVKRLHWKFRGNDCVDVNRNRVEVFWDVHDWLF-------CSGPRHGLFIF  674



>ref|XP_010251033.1| PREDICTED: uncharacterized protein LOC104593063 [Nelumbo nucifera]
Length=329

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 151/274 (55%), Gaps = 18/274 (7%)
 Frame = +3

Query  393   MRNSQISMAQLRPMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGH  572
             M    I +        +  D   +  +   QS     +  K+A   R ITITW K+L+ H
Sbjct  1     MMQDAIGIPACFSSGEKPTDDPASAVTRAGQSVFLSAYRTKVASECRLITITWCKNLLLH  60

Query  573   ALSIVVENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPD  752
              L I VE P  DN Y CK++LK W FW K+G K F V+ + VDV+WD +AA+F+   EP 
Sbjct  61    GLCISVEGPEGDNQYNCKVELKPWYFWRKQGSKRFIVEGKAVDVFWDLKAARFNGETEPQ  120

Query  753   SDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGR  932
             SD+YVA+    EVV+LLGD K +A+++T  RP +++ +LV +KE ++ KR F TR     
Sbjct  121   SDYYVAVVCEDEVVLLLGDLKKDAYRKTGCRPSLIEPSLVSRKEHIFGKRKFSTRVKFHE  180

Query  933   GKREHNIIIE-------------TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVM  1073
                 H I IE              D  G  + E+ I +DG +++ V +L W+FRGNE++ 
Sbjct  181   KGEFHEISIECNNSNGGSSSTNKNDYIGGFDLELVIRIDGRQAIHVRHLQWKFRGNESIF  240

Query  1074  VDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             VD   VEV+WDVHDW+F     S      +FIFK
Sbjct  241   VDKDRVEVYWDVHDWLF-----SPGLRHALFIFK  269



>gb|KHN30960.1| hypothetical protein glysoja_017497 [Glycine soja]
Length=326

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 145/242 (60%), Gaps = 12/242 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + + QS    ++  KIAD  R ITITW K++I H LS+ VE P     Y CK++LK W F
Sbjct  25    TRSGQSVHMSVYRTKIADQCRLITITWCKNMILHGLSVSVEGPEGKAQYCCKVELKPWYF  84

Query  651   WGKKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             W K+G K F V   + VDV+WD + AKF+   EP S++YVA+    EVV+L+GD K EA+
Sbjct  85    WRKQGSKRFIVHGNKPVDVFWDLKGAKFNGETEPTSEYYVAVVCDQEVVLLIGDLKKEAY  144

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE---TDLSG---PTEP  989
             +RT  RP ++D  LV KKE ++ KR F TR       R H I IE    ++ G     +P
Sbjct  145   RRTGCRPALIDPILVSKKEHIFGKRKFSTRAKFHEKGRCHEISIECKSNNIGGDGDKIQP  204

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EM I +DG   + V  L W+FRGNE++ ++ + VEV+WDVHDW+F     S      +FI
Sbjct  205   EMEIRLDGHVVIHVKRLQWKFRGNESIHLNKMRVEVYWDVHDWLF-----SPGLKHALFI  259

Query  1170  FK  1175
             FK
Sbjct  260   FK  261



>ref|XP_003522405.1| PREDICTED: uncharacterized protein LOC100813254 [Glycine max]
Length=326

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 145/242 (60%), Gaps = 12/242 (5%)
 Frame = +3

Query  471   SATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQF  650
             + + QS    ++  KIAD  R ITITW K++I H LS+ VE P     Y CK++LK W F
Sbjct  25    TRSGQSVHMSVYRTKIADQCRLITITWCKNMILHGLSVSVEGPEGKAQYCCKVELKPWYF  84

Query  651   WGKKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAF  827
             W K+G K F V   + VDV+WD + AKF+   EP S++YVA+    EVV+L+GD K EA+
Sbjct  85    WRKQGSKRFIVHGNKPVDVFWDLKGAKFNGETEPTSEYYVAVVCDQEVVLLIGDLKKEAY  144

Query  828   KRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE---TDLSG---PTEP  989
             +RT  RP ++D  LV KKE ++ KR F TR       R H I IE    ++ G     +P
Sbjct  145   RRTGCRPALIDPILVSKKEHIFGKRKFSTRAKFHEKGRCHEISIECKSNNIGGDGDKIQP  204

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
             EM I +DG   + V  L W+FRGNE++ ++ + VEV+WDVHDW+F     S      +FI
Sbjct  205   EMEIRLDGHVVIHVKRLQWKFRGNESIHLNKMRVEVYWDVHDWLF-----SPGLKHALFI  259

Query  1170  FK  1175
             FK
Sbjct  260   FK  261



>ref|XP_004501866.1| PREDICTED: uncharacterized protein LOC101507614 isoform X1 [Cicer 
arietinum]
Length=334

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/261 (41%), Positives = 150/261 (57%), Gaps = 23/261 (9%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPS-EDNHYTC  623
             +D      + + +S    ++  K+AD  R ITI W K+L+ H LS+ VE P  E   Y+C
Sbjct  17    DDHHHGAVTRSGRSVYMSVYRTKLADHCRLITIAWCKNLLLHGLSVSVETPERETTQYSC  76

Query  624   KIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILL  803
             K++LK W FW K+G K F VD + VDV+WD +AAKF+   EP S++YVA+    EVV+LL
Sbjct  77    KVELKPWYFWRKQGSKRFAVDGKPVDVFWDLKAAKFNGETEPTSEYYVAVVCDQEVVLLL  136

Query  804   GDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-------  962
             GD K EA+KRT  RP ++D  LV KKE ++ KR F T+       R H I I+       
Sbjct  137   GDLKKEAYKRTGCRPSLIDPILVSKKEHIFGKRKFSTKAKFHEKGRCHEISIKCKNKVNN  196

Query  963   ----------TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVH  1112
                       + +    +PEM I  DG  ++ V +L W+FRGNE++ ++ + VEV+WDVH
Sbjct  197   NNVGDGDSVTSGVQVQVQPEMEIRFDGHLAIHVKHLQWKFRGNESIHLNKMRVEVYWDVH  256

Query  1113  DWMFNDDSSSVAAGPGVFIFK  1175
             DW+F     S      +FIFK
Sbjct  257   DWLF-----SPGLKHALFIFK  272



>ref|XP_011032437.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032438.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032439.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032440.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032441.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032442.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032443.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032444.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032446.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032447.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032448.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032449.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032450.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032452.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032453.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032454.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032455.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032456.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032457.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032458.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032459.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032460.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032461.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
Length=299

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 160/290 (55%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITITWSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITITWSKNLMGQGLSVGIDDSA--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG K       ++D+YWD  +AKF S PEP   FYVA+    ++V++LGD
Sbjct  75    DIKPWLFSKRKGSKCLEAYSCKIDIYWDLSSAKFGSGPEPFEGFYVAVVVDRQMVLILGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ K+ FCT+         H+++IE D  G ++P
Sbjct  135   MRKEAFKKTGATPVPSNAVFVAKREHVFGKKVFCTKARFCDNGHIHDLVIECDTVGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +A+EVFWDVH W+F       + G  VF+
Sbjct  195   CLLVRVDCKTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHSWLFG-----ASVGNAVFM  249

Query  1170  FKQgnggkgegeeD-----NSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK     +           N  P    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCTSAEKLWSSQPLSDPNVFPWSFSQRFLDSKSQNLGFSLILYAWKHE  299



>ref|XP_006581901.1| PREDICTED: uncharacterized protein LOC100816323 [Glycine max]
 gb|KHN07982.1| hypothetical protein glysoja_039856 [Glycine soja]
Length=326

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 15/241 (6%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             QS    ++  KIAD  R ITITW K+++ H LS+ VE P  +  Y CK++LK W FW K+
Sbjct  29    QSVHMSLYRTKIADQCRLITITWCKNVMLHGLSVSVEGPEGEAQYCCKVELKPWYFWRKQ  88

Query  663   GLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTK  839
             G K F V  ++ VDV+WD +AAKF    EP S++YVA+    EVV+L+GD K EA++RT 
Sbjct  89    GSKHFIVHGDKAVDVFWDLKAAKFHGETEPTSEYYVAVVCDKEVVLLIGDLKKEAYRRTG  148

Query  840   SRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE------TDLSG---PTEPE  992
              RP ++D  LV KKE ++ KR F TR       R H I IE       ++ G     +PE
Sbjct  149   CRPALIDPILVSKKEHIFGKRKFSTRARFHEKGRCHEISIECKNKSNNNIGGDGDKIQPE  208

Query  993   MWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIF  1172
             M I +DG   + V  L W+FRGNE++ ++ + VEV+WDVHDW+F     S      +FIF
Sbjct  209   MEIKLDGHVVIHVKRLQWKFRGNESIHLNKMRVEVYWDVHDWLF-----SPGLKHALFIF  263

Query  1173  K  1175
             K
Sbjct  264   K  264



>ref|XP_002512236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49688.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 160/290 (55%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITITWSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNTSKNAQNLVTCVYQCRIRGRSCLITITWSKNLMGQGLSVGMDDSA--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  +AKF S PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSSAKFGSGPEPLEAFYVGVVVDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P    A  V K+E V+ KR F T+       + H+++IE D  G ++P
Sbjct  135   MRKEAFKKTSAAPISSTAVFVSKREHVFGKRVFSTKAQFSDNGQVHDLVIECDTIGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVEV WDVH+W+F       + G  VF+
Sbjct  195   CLVVRVDCKTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFGS-----SVGNAVFM  249

Query  1170  FKQgnggkgegeeD-----NSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK     +           N LP    +   DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWSSQPLSDPNVLPWSFSQRFLDSKSQNLGFSLILYAWKNE  299



>ref|XP_002318087.2| hypothetical protein POPTR_0012s09090g [Populus trichocarpa]
 gb|EEE96307.2| hypothetical protein POPTR_0012s09090g [Populus trichocarpa]
Length=329

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 149/251 (59%), Gaps = 18/251 (7%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITI W K+L+ H LS+ VE P  ++HYTCK +LK 
Sbjct  23    ATVTRSGQSVFVSVYRTKIADQCRLITIRWCKNLLLHGLSVSVEGPEGESHYTCKAELKP  82

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F V+ + VD++WD + A+F+   EP+S++YVA+    EVV+LLGD K +
Sbjct  83    WYFWRKQGSKRFVVEGKAVDIFWDLKTARFNGETEPNSEYYVAVVCDEEVVLLLGDLKKD  142

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE----TDLSGPT--  983
             A+K+T  RP ++D  LV +KE ++ K+ F TR       R H I IE     + SG    
Sbjct  143   AYKKTGCRPGLIDPILVSRKEHIFCKKKFATRIKFHEKGRFHEISIECRNICNYSGNASN  202

Query  984   -------EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSS  1142
                    EPEM I +DG   + V +L W+FRGNE + +  + VEV+WDVHDW+F     S
Sbjct  203   GNSINRDEPEMDIRIDGDLVIHVKHLQWKFRGNEYINLHKLRVEVYWDVHDWLF-----S  257

Query  1143  VAAGPGVFIFK  1175
                   +FIFK
Sbjct  258   PGLRHALFIFK  268



>emb|CDP12711.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 152/251 (61%), Gaps = 18/251 (7%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  KIAD  R ITITW K+L+ H LS+ VE P  ++ YTCK++LK 
Sbjct  23    AGVTRSGQSVFMSVYRTKIADQCRLITITWCKNLLLHGLSVSVEGPEGESQYTCKVELKP  82

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F V+ + VD++WD +AAKF+   EP S++YVA+    EVV+L+GD K +
Sbjct  83    WYFWRKQGSKRFLVEGKPVDIFWDLKAAKFNGETEPSSEYYVAVVYDEEVVLLIGDLKKD  142

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-----------TD  968
              +++T  RP ++D  LV +KE ++ K+ F TR       R H I IE           ++
Sbjct  143   GYRKTGCRPALIDPLLVSRKEHIFGKKKFLTRVKFHEKGRIHEIAIECKSRSNNSGNLSN  202

Query  969   LSGP--TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSS  1142
              + P   +PEM I +DG   + V +L W+FRGN+++ ++ V +EV+WDVHDW+F     S
Sbjct  203   ANSPNGVDPEMEIRIDGNLVIHVKHLQWKFRGNDSIKMNKVRLEVYWDVHDWLF-----S  257

Query  1143  VAAGPGVFIFK  1175
                   +FIFK
Sbjct  258   PGLRHALFIFK  268



>ref|XP_006439940.1| hypothetical protein CICLE_v10023489mg [Citrus clementina]
 gb|ESR53180.1| hypothetical protein CICLE_v10023489mg [Citrus clementina]
 gb|KDO69466.1| hypothetical protein CISIN_1g037094mg [Citrus sinensis]
Length=332

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 150/254 (59%), Gaps = 21/254 (8%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSE-DNHYTCKIDLK  638
             A  + + QS    ++ +KIAD  R ITITW K+L+ H LS+ VE   + D  YTCK++LK
Sbjct  22    AAVTRSGQSVFMSVYRSKIADQSRLITITWCKNLLLHGLSVSVEEGEDGDGQYTCKVELK  81

Query  639   TWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKS  818
              W FW K+G K F +D + VD+YW+ +AAKF+   EP+SD+YVA+    EV +L+GD K 
Sbjct  82    PWYFWRKQGSKRFLLDGKAVDIYWNLKAAKFNGETEPNSDYYVAVVCDEEVALLVGDLKK  141

Query  819   EAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETD----------  968
             +A+++T  RP ++D  LV +KE ++ KR F TR       R H I IE            
Sbjct  142   DAYRKTGCRPALIDPVLVSRKEHIFGKRKFITRVKFHEKGRFHEISIECKNRCDGRRSNG  201

Query  969   -----LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDD  1133
                   SG  EPEM I +DG   + V +L W+FRGNE++ ++   VEV+WDVHDW+F   
Sbjct  202   SGSGSFSGGVEPEMEIRIDGYLVIHVKHLQWKFRGNESININKARVEVYWDVHDWLF---  258

Query  1134  SSSVAAGPGVFIFK  1175
               S      +FIFK
Sbjct  259   --SPGLRHALFIFK  270



>ref|XP_006838233.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
 gb|ERN00802.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
Length=301

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 162/289 (56%), Gaps = 18/289 (6%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             +  S T Q+ VTC++ +++      IT+TWSK+L+G  LS+ +++ +  N   CK+DLK 
Sbjct  20    SSHSRTAQNLVTCVYRSQLCGRSCVITVTWSKNLMGQGLSVGIDDST--NQGLCKVDLKP  77

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W F  +KG K+ + +  ++D++WD  +AKF S PEP   FY+A+    ++V+LLGD   +
Sbjct  78    WLFSKRKGSKTLDAETNKIDIFWDLSSAKFGSGPEPIEGFYLAVVFDLQMVLLLGDLSKD  137

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWI  1001
             A+++T +RPP  +   V K+E ++ KR + T+       + H++ IE D  G  EP + I
Sbjct  138   AYRKTNARPPSFNPVFVAKREHIFGKRVYFTKAQFCNNGQSHDVSIECDTVGVKEPSLSI  197

Query  1002  SVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
              +D    ++V  L W+FRGN T++VD + VEV+WDVH+W+F     S   G  VF+FK  
Sbjct  198   RIDKKMVLQVKQLVWKFRGNHTILVDGLPVEVYWDVHNWLF-----SQTMGSAVFMFKSC  252

Query  1182  nggkgegeeDN-------SLPQKSCD----DSQSRPPEFCHVFYAWKTE  1295
                +      +       S+P  SC     DS      F  + YAWK E
Sbjct  253   LSAEKLWSGQHSNDTSSVSMPWSSCSQSFRDSYLEGLGFSLILYAWKNE  301



>ref|XP_008811744.1| PREDICTED: uncharacterized protein LOC103722827 [Phoenix dactylifera]
Length=315

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 166/308 (54%), Gaps = 24/308 (8%)
 Frame = +3

Query  429   PMNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVV----EN  596
             P  P  +D      + + +S V  ++   IA   R IT+TW + +  H LSI V    +N
Sbjct  13    PGEPTADDPTSIAATRSGRSIVASVYRTMIAGHCRLITVTWCRDVRVHGLSISVVEDSDN  72

Query  597   PSEDN-----HYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDF  761
               E N      ++CK++L+ W FW K G K F+V+ + VDV+WD ++AKFS  PEP SD+
Sbjct  73    VDETNMISSKRHSCKVELRPWCFWRKHGWKRFHVEGKPVDVFWDLKSAKFSGEPEPRSDY  132

Query  762   YVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKR  941
             YVA+ +  EVV+LLGD   EA++RT SRP  +DATLV +KE V+ K+ F  R++L    +
Sbjct  133   YVAVVSDDEVVLLLGDLNKEAYRRTGSRPAAIDATLVSRKEHVFGKKRFVARSILSEKGK  192

Query  942   EHNIIIE--------TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEV  1097
              H I+IE        +      +PEM I VD   ++ V +L W+FRGN+++ V+   VEV
Sbjct  193   LHEILIECSNRSSSSSIGRSNMDPEMVIKVDAHVAIHVRHLQWKFRGNQSITVNKARVEV  252

Query  1098  FWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgegeeDNSLPQK--SCDDSQSRPPEFCH  1271
             +WDVHDW+F     S      +FIFK  +          SL       D        FC 
Sbjct  253   YWDVHDWLF-----SPGLTHALFIFKPRSLLHSSTSSSPSLMSSFDGKDSDADGSSGFCL  307

Query  1272  VFYAWKTE  1295
               YAWK E
Sbjct  308   FLYAWKLE  315



>ref|XP_010910592.1| PREDICTED: uncharacterized protein LOC105036529 [Elaeis guineensis]
Length=290

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 156/276 (57%), Gaps = 16/276 (6%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T Q+ VTC++  ++      IT+TWSK+L+G  LSI +++ +  N   CK+D+K W F  
Sbjct  28    TAQNLVTCVYQTQLGGRACLITVTWSKNLMGQGLSIGIDDSA--NQSLCKVDIKPWLFSK  85

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             +KG KS   +  +VD++WD  AAKF S PEP   FYVA+    E+V+LLGD   EA+++T
Sbjct  86    RKGSKSLEAENSKVDIFWDLSAAKFGSGPEPLEGFYVAVIFDLEMVLLLGDLTKEAYRKT  145

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
              + P    A  + K+E +Y K+ +CT+       + H+I IE +  G  +P + I +D  
Sbjct  146   SASPLPSSAVFIAKREHIYGKKIYCTKAQFCDNGQVHDIAIECETVGLKDPTLEIRIDKK  205

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkg  1196
               ++V  L W+FRGN+T++VD + VEVFWDVH+W+F         G  VF+F+       
Sbjct  206   RVMQVKRLMWKFRGNQTILVDGLPVEVFWDVHNWLFG-----APTGNAVFMFQ------T  254

Query  1197  egeeDNSLPQKSCD---DSQSRPPEFCHVFYAWKTE  1295
                 +  LP  S     +SQ +   F  + YAWK E
Sbjct  255   CVSAEKLLPWSSSQIFRESQLQGLGFSLILYAWKNE  290



>emb|CAN64151.1| hypothetical protein VITISV_041021 [Vitis vinifera]
Length=305

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 164/296 (55%), Gaps = 21/296 (7%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + T Q+ VTC++  ++      IT+ WSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNATKTAQNLVTCVYQCRLRGRSCLITVVWSKNLMGQGLSVGIDDSA--NQSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS   +  ++D+YWDF +AKF S PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEANSSKIDIYWDFSSAKFGSGPEPLEGFYVGVVFDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  + K+E+++ K+ F T+       + H+++IE D  G T+P
Sbjct  135   LRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNGQIHDLMIECDTIGVTDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I VD    ++V  L W+FRGN T+ VD +AVEVFWDVH+W+F     S   G  VF+
Sbjct  195   YLAIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLF-----STTLGNAVFL  249

Query  1170  FKQgnggkge----------geeDNSLPQKSCD----DSQSRPPEFCHVFYAWKTE  1295
             FK     +               D ++   SC     DSQS+   F  + +A K E
Sbjct  250   FKTCLSAEKLWASQPLSDPNVFRDPNVVTLSCSQRFRDSQSQALSFSLILHALKNE  305



>ref|XP_002277386.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659902.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659903.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659904.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659905.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659906.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659907.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659908.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659909.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659910.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659911.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659912.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659913.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
Length=305

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 165/296 (56%), Gaps = 21/296 (7%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + T Q+ VTC++  ++      IT+ WSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNATKTAQNLVTCVYQCRLRGRSCLITVVWSKNLMGQGLSVGIDDSA--NQSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS   +  ++D+YWDF +AKF S PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEANSSKIDIYWDFSSAKFGSGPEPLEGFYVGVVFDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  + K+E+++ K+ F T+       + H+++IE D  G T+P
Sbjct  135   LRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNGQIHDLMIECDTIGVTDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I VD    ++V  L W+FRGN T+ VD +AVEVFWDVH+W+F     S   G  VF+
Sbjct  195   YLVIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLF-----STTLGNAVFL  249

Query  1170  FKQgnggkge----------geeDNSLPQKSCD----DSQSRPPEFCHVFYAWKTE  1295
             FK     +              +D ++   SC     DSQS+   F  + +A K E
Sbjct  250   FKTCLSAEKLWASQPLSDPNVFQDPNVVTLSCSQRFRDSQSQALSFSLILHALKNE  305



>ref|XP_004302026.1| PREDICTED: uncharacterized protein LOC101296394 [Fragaria vesca 
subsp. vesca]
Length=303

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/281 (37%), Positives = 163/281 (58%), Gaps = 15/281 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T Q+ VTCI+  ++ +    IT+TWS++L+G  LSI +++ S  N   CK+D+K W F  
Sbjct  30    TAQNLVTCIYQCRLRNRSCLITVTWSRNLMGQGLSIGIDDSS--NQCLCKVDIKPWLFSK  87

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             ++G KS      ++D+YWDF +AKF S PEP   +YV +    ++++LLGD K EAFK+T
Sbjct  88    RRGSKSLEAYSSKIDIYWDFSSAKFGSGPEPVDGYYVGIVVDRQMILLLGDMKKEAFKKT  147

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
              + P   +A  + ++E ++ K+ F T+       + H+++IE D  G  +P + + VD  
Sbjct  148   SASPASSNAGCIARREHIFGKKVFTTKARFCNDGQVHDLVIECDTVGVNDPCLIVRVDSK  207

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg--  1190
               ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+FK       
Sbjct  208   TVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGS-----SPGSAVFMFKTCLSAEK  262

Query  1191  --kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
                G+ + D S  Q    +   DS+S+   +  + YAWK E
Sbjct  263   LWSGQPQSDPSALQWSFSQRFSDSKSQGLGYSLMLYAWKNE  303



>ref|XP_010546610.1| PREDICTED: uncharacterized protein LOC104818644 [Tarenaya hassleriana]
Length=286

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 158/282 (56%), Gaps = 12/282 (4%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +      Q+ VTCI+  +I      IT+TW+K+LIG  L++ +++    N   CK+
Sbjct  17    DSSSSNAGKNAQNLVTCIYQCRIRGRTCLITVTWTKNLIGQGLTVGIDDSC--NQSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             ++K W F  +KG KS      +VDV+WD  +AKF S PEP + FYV +    E+++LLGD
Sbjct  75    EIKPWLFTKRKGSKSLEAYSCKVDVFWDLSSAKFGSGPEPLAGFYVGVVVDKEMILLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
                EAFK+T + P    A  V KKE V+ KR F  +       + H+++IE D S  ++P
Sbjct  135   MNKEAFKKTNATPSSSSALFVAKKEHVFGKRVFAAKAQFSGNGKTHDLVIECDTS-VSDP  193

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + V+G   ++V  L W+FRGN+T++VD +AVEV WDVH W+F   S+    G  VF+
Sbjct  194   CLIVRVNGKPMMQVKRLKWKFRGNDTIIVDRMAVEVLWDVHSWLFGIPST----GNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             F+     +      +SL      D++S+   F  + YAWK E
Sbjct  250   FRTCQSAEKAWSFSHSLT-----DAKSQSFGFSLILYAWKNE  286



>ref|XP_008807465.1| PREDICTED: uncharacterized protein LOC103719825 [Phoenix dactylifera]
Length=325

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 167/316 (53%), Gaps = 42/316 (13%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY---  617
             +D   A  + + Q     I+  +IA   R IT+TW K+L+ H LS++VE   +D+ +   
Sbjct  19    DDPTSAVATRSGQGAALLIYRTRIAGHCRLITVTWCKNLLAHGLSVLVEGSDKDDEHKGN  78

Query  618   ---------------------TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFS  734
                                  +CK++++ W FW K G K F V+ + VDV+WD R+AKFS
Sbjct  79    GSSVDVDNNNSSSSSSSKHQNSCKVEMRPWNFWRKHGSKRFLVEGKPVDVFWDLRSAKFS  138

Query  735   SSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCT  914
               PEP SD+YVA+ + GEVV+LLGD K EAF+RT SRP +++A LV KKE V+ K+ F  
Sbjct  139   DEPEPQSDYYVAVVSDGEVVLLLGDLKEEAFRRTGSRPSLIEAILVSKKEHVFGKKRFSA  198

Query  915   RTMLGRGKREHNIIIETD-----LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVD  1079
             R       + H+I IE +      +G  + EM + VD   ++ V +L W+FRGNE++ ++
Sbjct  199   RAKFHEKGKFHDISIECNGSSSSTTGSMDSEMVMKVDRHVAIHVRHLQWKFRGNESISIN  258

Query  1080  NVAVEVFWDVHDWMFNDDSSSVAAGPG----VFIFKQgnggkgegeeDNSLPQKSCDDSQ  1247
                V+V+WDVHDW+F          PG    +FIFK  +         +       + + 
Sbjct  259   KQRVQVYWDVHDWLFT---------PGLRHALFIFKPESLPSSSTSSSSYNSFAGTNANG  309

Query  1248  SRPPEFCHVFYAWKTE  1295
                  FC   YAWK E
Sbjct  310   GESSGFCLFLYAWKLE  325



>emb|CDY00013.1| BnaC09g02880D [Brassica napus]
Length=295

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/285 (39%), Positives = 163/285 (57%), Gaps = 9/285 (3%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +      Q+ VTCI+  +I      IT+TW+K+L+G ++++ V++    N   CK+
Sbjct  17    DSSSSNSGKNAQNLVTCIYQCRIRGRTCLITVTWAKTLMGQSVTVGVDDSC--NQSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             ++K W F  +KG KS  V    +DV WD  +AKF S PE    FYV +    E+V+LLGD
Sbjct  75    EIKPWLFTKRKGSKSLEVYSCSIDVVWDLASAKFGSGPEALGGFYVGVVVDKEMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTML-GRGKREHNIIIETDLSGPTE  986
              K EAFK+T + P    A  V KKE V+ KR F T+  L   G R H+++IE D S  T+
Sbjct  135   MKKEAFKKTNASPSSRGAVFVAKKEHVFGKREFATKAQLCSDGVRIHDLVIECDTS-VTD  193

Query  987   PEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             P + + VDG   ++V  L W+FRGN+T++V+ +AVEV WDVH W+F   SS   AG  VF
Sbjct  194   PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSS---AGNAVF  250

Query  1167  IFK--QgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             +F+  Q +  K      + +   +  +S+S+   F  + YAWK E
Sbjct  251   MFRTCQSSSDKSLSFSQDIIATTTTTNSKSQSSVFSLILYAWKNE  295



>ref|XP_002451729.1| hypothetical protein SORBIDRAFT_04g006760 [Sorghum bicolor]
 gb|EES04705.1| hypothetical protein SORBIDRAFT_04g006760 [Sorghum bicolor]
Length=321

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/297 (41%), Positives = 167/297 (56%), Gaps = 46/297 (15%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH----------YTCKID  632
             Q     + LAKI  + R +T  WSKSLI  + +I ++ P                T K++
Sbjct  45    QCSTVSVFLAKINGVARLVTAVWSKSLINQSFTISIDRPGPGGGGGGGGDGDGPVTHKVE  104

Query  633   LKTWQFWGKKGLKSFNVDQ-ERVDVYWDFRAAKFSS---SPEPDSDFYVALATGGEVVIL  800
             LK W FW KKG K+ +V   +RVD++WD R+AKF++   SPEP   +YVAL +  EVV+L
Sbjct  105   LKPWPFWSKKGGKAMDVGGGDRVDMFWDLRSAKFAAGGTSPEPAGGYYVALVSNDEVVLL  164

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCF-CTRTMLGRGKREHNIIIETDLSG  977
             LGD K +A+KRTK+RP + DA LV ++ESV+ +R F     +  R  +EH I+IE  L+ 
Sbjct  165   LGDCKKDAYKRTKARPSLEDAVLVCRRESVFGRRSFAARARLDARRSKEHEIVIEYALAA  224

Query  978   P---TEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVA  1148
                  +PEMWI+VDG   + V +L W+FRGNET++VD   V+V WDVHDW+F        
Sbjct  225   AGSSKDPEMWITVDGFVLLHVKSLQWKFRGNETLLVDQAPVQVIWDVHDWLF--------  276

Query  1149  AGPG---VFIFKQgnggkgegeeDNSLPQKSCDDS-----QSRPPEFCHVFYAWKTE  1295
             AGPG   VF+FK               P +  +DS     Q    +FC    AW+TE
Sbjct  277   AGPGTQAVFVFKP------------GAPPEIQEDSGGNGIQGEGTDFCFFLQAWRTE  321



>ref|XP_010674843.1| PREDICTED: uncharacterized protein LOC104890923 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 158/295 (54%), Gaps = 25/295 (8%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + T Q+ VTC++  +       IT+TWSKSL+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSNGNKTAQNLVTCVYQCRFRGRSCLITVTWSKSLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS +V+   +D+YWD  +AKF S PEP   FY+A+    ++++LLGD
Sbjct  75    DIKPWLFSKRKGSKSLDVESSNIDLYWDLSSAKFGSGPEPLEGFYLAIVCDKQMILLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  + K+E VY K+ F ++         H+++IE D     +P
Sbjct  135   MRKEAFKKTNATPVSSNAVFIAKREHVYGKKVFYSKAKFSDNGPVHDLMIECDTISTNDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T+++D + VEVFWDVH W+F       + G  VF+
Sbjct  195   CLIVRVDTKNLMQVKRLRWKFRGNHTILIDGLPVEVFWDVHSWLFGS-----SPGSAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
             F+     +          Q  CD             DSQS    F  + YAWK E
Sbjct  250   FRTSLTAEKLWAS-----QPLCDPNVLHWSTSQRIRDSQSHQLGFSLILYAWKQE  299



>ref|XP_009588422.1| PREDICTED: uncharacterized protein LOC104085995 [Nicotiana tomentosiformis]
Length=297

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 156/284 (55%), Gaps = 25/284 (9%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  K+      + +TWSK+L+G  L++ +++ +  N   CK+D+K W F  KK
Sbjct  26    QNLVTCVYQCKLRGKSCLLNVTWSKNLMGQGLTVGIDDNT--NQCLCKVDIKPWLFSKKK  83

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+      ++DVYWD  +AKF S PEP   FYV + +  ++++LLGD + EA K+T +
Sbjct  84    GSKTLEAYSRKIDVYWDLTSAKFGSGPEPLEGFYVCVVSERQMILLLGDMRKEATKKTGA  143

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P    A  + KKE ++ K+ F T+       R H+++IE D SG ++P + I VD    
Sbjct  144   TPSASGAVFIAKKEHIFGKKVFGTKAQFCDNGRVHDLVIECDTSGTSDPCLVIRVDSKPM  203

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             ++V  L W+FRGN T++VD + VEVFWDVH+W+F       +AG GVF+FK     +   
Sbjct  204   MQVKRLRWKFRGNHTILVDGLGVEVFWDVHNWLFG-----TSAGDGVFMFKTSLSAEKLW  258

Query  1203  eeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
                    Q  CD             ++QS    F    YAWK E
Sbjct  259   A-----AQPVCDPQTLHWSWSQRFREAQSHSLGFSLFLYAWKNE  297



>ref|XP_004951552.1| PREDICTED: uncharacterized protein LOC101772581 [Setaria italica]
Length=313

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 166/287 (58%), Gaps = 35/287 (12%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNH---YTCKIDLKTWQFW  653
             Q     ++LAKI+   R +T  WSK+LI  + +I ++ P +D      T K++LK W FW
Sbjct  46    QCSTVSVYLAKISGAPRLVTAVWSKNLINQSFTISIDRPGDDGGDGPVTHKVELKPWPFW  105

Query  654   GKKGLKSFNVDQ-ERVDVYWDFRAAKFSS--SPEPDSDFYVALATGGEVVILLGDQKSEA  824
              KKG K+ +V   +R D++WD R AKF++  SPEP   +YVA+ +  EVV+LLGD K +A
Sbjct  106   SKKGNKALDVGGGDRADIFWDLRGAKFAAGGSPEPAGGYYVAVVSNDEVVLLLGDGKKDA  165

Query  825   FKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRG-KREHNIIIETDLSGPT--EPEM  995
             +KRTKSRP + DA LV ++ESV+ +R F  R  L     +EH I++E   +     +PE+
Sbjct  166   YKRTKSRPSLEDAVLVCRRESVFGRRSFAARARLDARRSKEHEIVVECSPAAGAIRDPEL  225

Query  996   WISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPG---VF  1166
             W++VDG   + V NL W+FRGNETV+VD   V+V WDVHDW+F        AGPG    F
Sbjct  226   WVTVDGFVLLHVKNLQWKFRGNETVLVDQAPVQVIWDVHDWLF--------AGPGSQAAF  277

Query  1167  IFKQgnggkgegeeDNSLPQKSCDDS----QSRPPEFCHVFYAWKTE  1295
             +FK             + P+   D      QS   +FC    AW+TE
Sbjct  278   VFKP-----------GAAPEIQEDSGGNGIQSEGTDFCFFLQAWRTE  313



>ref|XP_008221896.1| PREDICTED: uncharacterized protein LOC103321834 [Prunus mume]
Length=727

 Score =   209 bits (533),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 164/284 (58%), Gaps = 20/284 (7%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             QS    ++  KIA   R ITITW K+L+ H LS+ V+    D  Y CK++LK W FW K+
Sbjct  451   QSVFMSVYSTKIAGQCRLITITWCKNLLLHGLSVSVQGQYGDEDYRCKVELKPWYFWRKQ  510

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K F VD   VDV WD +AAKF+   EP SD+YVA+    EVV+L+GDQK +A++RT  
Sbjct  511   GSKQFLVDGSTVDVVWDLKAAKFNGETEPRSDYYVAIVCEEEVVLLVGDQKKDAYRRTGC  570

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT--EPEMWISVDGI  1016
             RP +++  LV +KE ++ K+ + TR      +  H I+IE +    T  +PE+ I +DG 
Sbjct  571   RPSLIEPILVSRKEHLFGKKRYSTRIKFHEKESFHEILIECNNISATGADPELEIKIDGS  630

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVFIFK---Qg  1181
              ++ V +L+W+FRGNE V ++   VEV+WDVHDW+F       ++GP  G+FIFK     
Sbjct  631   IALHVKHLHWKFRGNECVDINKTKVEVYWDVHDWLF-------SSGPRHGMFIFKPISSS  683

Query  1182  nggkgegeeDNSLPQKSC------DDSQSRPPEFCHVFYAWKTE  1295
             +    +  ++  L +KS       D+       F    YAWK E
Sbjct  684   SPETAQSTQEQELTEKSSCAAEEEDEKAGGSSVFSLFVYAWKVE  727



>ref|XP_003521743.1| PREDICTED: uncharacterized protein LOC100791607 [Glycine max]
 gb|KHN31447.1| hypothetical protein glysoja_035554 [Glycine soja]
Length=297

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 159/289 (55%), Gaps = 15/289 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + + Q+ VTC++  ++    R IT+TWSK+L+G  L + +++ S  +   CK+
Sbjct  17    DSSSSSTNKSAQNVVTCVYQCRVGGSSRLITVTWSKNLMGQGLGVGIDDSSSQS--LCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS  V   +VDVYWD  +AKF S PEP   FYV     G++V+LLGD
Sbjct  75    DIKPWGFSKRRGCKSLEVHSCKVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A LV KKE V+ K+ + T+ +     + H+++IE   +   +P
Sbjct  135   LRKEAFKKTNANPLPHNAALVAKKEHVFGKKLYGTKAVFCDNGQIHDLVIECGTASVGDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+
Sbjct  195   SLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSLGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPE-------FCHVFYAWKTE  1295
             F+       +       P         R PE       F  V YAWK +
Sbjct  250   FRTCLSAADKLWASQP-PSDLAWSFSERFPETKLQGLSFSLVLYAWKNQ  297



>gb|KDP23639.1| hypothetical protein JCGZ_23472 [Jatropha curcas]
Length=299

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 160/291 (55%), Gaps = 17/291 (6%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S   Q+ VTC++  +I      ITITWSK+L+G  LS+ +++ +  N   CK+
Sbjct  17    DSSSSNTSKNAQNLVTCMYQCRIRGRYCFITITWSKNLMGQGLSVGMDDSA--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS      ++D+YWD  AAKF S PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAYSCKIDIYWDLSAAKFGSGPEPLEGFYVGIVVDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A  V K+E V+ K+ F TR       + H+++IE D    ++P
Sbjct  135   LRKEAFKKTSATPIPSNAVFVAKREHVFGKKVFSTRAQFCDNGQIHDLVIECDTISTSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VD    ++V  L W+FRGN T++VD +AVEV WDVH+W+F       + G  VF+
Sbjct  195   CLVVRVDCKTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFG-----TSVGNAVFM  249

Query  1170  FKQgnggkgegeeDN---------SLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             FK     +      +         S  Q+   DS+S+   F  + YAWK E
Sbjct  250   FKTCLSAEKLWSSQSLADATVLPWSFSQRFL-DSKSQNLGFSLILYAWKNE  299



>ref|XP_010649892.1| PREDICTED: uncharacterized protein LOC100246068 [Vitis vinifera]
Length=300

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 159/282 (56%), Gaps = 15/282 (5%)
 Frame = +3

Query  474   ATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFW  653
             +T Q+ VTC++  K+      I ITWSK+L+G  LS+ +++    N   CK D+K W F 
Sbjct  26    STAQNLVTCVYSCKLGGKSCLIIITWSKNLVGQCLSVEIDDWM--NQCLCKFDIKPWLFA  83

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
              +KG KSF ++  +VD YWD   AKF S PEP   FY+A+   GE+V+LLGD + EAFK+
Sbjct  84    KRKGSKSFEINSIQVDTYWDLSLAKFGSGPEPLEGFYLAVVFNGEMVLLLGDMRKEAFKK  143

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDG  1013
             T + P   +A  V KKE ++ K+ + T+       + HN+ IE D  G  +P + I +D 
Sbjct  144   TNATPGFYNAIFVSKKEHIFGKKLYGTKAQFWDNGQNHNLSIECDTVGTDDPFLAIRIDS  203

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg-  1190
                ++V +L W+FRGN+T+++D + VEVFWDVH+W+F       + G  VF+F+  +   
Sbjct  204   KMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGP-----SVGNAVFMFQTCSSAE  258

Query  1191  ---kgegeeDNSLPQKSCDDS----QSRPPEFCHVFYAWKTE  1295
                  +   D+S     C  +    + +   F  + YAWK E
Sbjct  259   KLWSSQPFFDSSALLSPCSQNFREFKLQGLGFSLILYAWKNE  300



>ref|XP_007144817.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
 gb|AGV54810.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW16811.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
Length=299

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 166/290 (57%), Gaps = 15/290 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  S T Q+ V C++  +I      ITITWSKSL+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSNASKTAQNLVICVYQCRIRGKCCLITITWSKSLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS      ++DVYWD  +A+F   PEP   FYV +    ++V+LLGD
Sbjct  75    DIKPWVFSKRRGSKSLEAYSCKIDVYWDLSSARFGVGPEPLEGFYVGVVVDRQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK++ + P   +A +V KKE V+ K+ F  + +     + H+++IE D SG ++P
Sbjct  135   LRKEAFKKSSAIPLPSNAVIVAKKEHVFGKKMFGNKAVFCDNGQIHDLVIECDTSGVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD +AVEVFWDV++W+F       + G  VF+
Sbjct  195   CLIIRIDSKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFG-----TSLGNAVFM  249

Query  1170  FKQgngg----kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
             F+          G+   D ++ Q    +   +++S+   F H+ YAWK +
Sbjct  250   FRTSISEEKLWAGQPLSDANVVQWSFSQRFSETKSQGLGFSHILYAWKND  299



>ref|XP_003632331.1| PREDICTED: uncharacterized protein LOC100853449 [Vitis vinifera]
Length=300

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 159/291 (55%), Gaps = 16/291 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + T Q+ VTC++  ++      ITITW+K+L+G  LS+ +++ S  N   CK+
Sbjct  17    DSSSSSTARTAQNLVTCVYQCRLRGKWCLITITWTKNLMGQGLSVGIDDSS--NQCLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG K+  VD  ++D+YWD  AAKF S PEP   FY+A+    E+ +LLGD
Sbjct  75    DIKPWLFSKRKGCKNLEVDSSKIDMYWDLSAAKFGSGPEPLEGFYLAVVFNQELALLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              K EA K+  S P    A L+ K+E ++ KR +  +       + H+I+IE D  G TEP
Sbjct  135   LKKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQFCDKGQMHDIMIECDTVGVTEP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD + +EVFWDVH+W+F +     A G  VF+
Sbjct  195   CLLIRIDSKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLFGN-----AIGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSC---------DDSQSRPPEFCHVFYAWKTE  1295
             F+     +      +     S           D+Q +   F  + YAWK E
Sbjct  250   FQSCLSAEKLWACQSISSDPSVLAWSWSEKFRDTQLQGLGFSLILYAWKNE  300



>gb|ACU18448.1| unknown [Glycine max]
Length=297

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 159/289 (55%), Gaps = 15/289 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + + Q+ VTC++  ++    R IT+TWSK+L+G  L + +++ S  +   CK+
Sbjct  17    DSSSSSTNKSAQNVVTCVYQCRVGGSSRPITVTWSKNLMGQGLGVGIDDSSSQS--LCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS  V   +VDVYWD  +AKF S PEP   FYV     G++V+LLGD
Sbjct  75    DIKPWGFSKRRGCKSLEVHSCKVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A LV KKE V+ K+ + T+ +     + H+++IE   +   +P
Sbjct  135   LRKEAFKKTNANPLPHNAALVAKKEHVFGKKLYGTKAVFCDNGQIHDLVIECGTASVGDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+
Sbjct  195   SLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSLGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPE-------FCHVFYAWKTE  1295
             F+       +       P         R PE       F  V YAWK +
Sbjct  250   FRTCLSAADKLWASQP-PSDLAWSFSERFPETKLQGLSFSLVLYAWKNQ  297



>ref|XP_008804337.1| PREDICTED: uncharacterized protein LOC103717650 [Phoenix dactylifera]
Length=288

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 159/285 (56%), Gaps = 16/285 (6%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +    T Q+ V+C++  ++      IT+TWSK+L+   L+I +++ +  N   CK+
Sbjct  17    DSSSSSAGKTAQNLVSCVYRTQLCSRSCVITVTWSKNLMSQGLTIGIDDSA--NRSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS   +  +VDV+WD  AA+F S PEP   FYVA+    E+V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAENSKVDVFWDLSAARFGSGPEPLEGFYVAVVFDLEMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
                EA+++T + PP  +A  + ++E +Y K  +CT+       + H+I IE +  G  +P
Sbjct  135   LTKEAYRKTSATPPPSNALFIARREHIYGKNVYCTKAQFCDNGQVHDIAIECETVGLRDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN+T++VD + VEVFWDVH+W+F   +     G  VF+
Sbjct  195   SLEIRIDKKRVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHNWLFGPTT-----GNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCD---DSQSRPPEFCHVFYAWKTE  1295
             F+           +  LP  S     +SQ +   F  + YAWK E
Sbjct  250   FQ------TCISAEKLLPWSSSQIFRESQLQGLGFSLILYAWKDE  288



>ref|XP_002322201.2| hypothetical protein POPTR_0015s09600g [Populus trichocarpa]
 gb|EEF06328.2| hypothetical protein POPTR_0015s09600g [Populus trichocarpa]
Length=424

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 151/258 (59%), Gaps = 22/258 (9%)
 Frame = +3

Query  453   QKEAEESAT----DQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             +K A++ AT     QS     +  KIAD  R ITITW K+L+ H LS+ VE P  ++ YT
Sbjct  16    EKVADDPATVTRSGQSVFMSAYRTKIADQCRLITITWCKNLLLHGLSVSVEGPEGESQYT  75

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K+G K F V+ + VD++WD +AAKF    EP+S++YVA+    EVV+L
Sbjct  76    CKLELKPWYFWRKQGSKRFVVEGKAVDIFWDLKAAKFKGETEPNSEYYVAVVCDEEVVLL  135

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGP  980
             LGD K +A+++T  RP ++D  LV +KE ++ K+ F TR       R H I IE      
Sbjct  136   LGDLKKDAYRKTGCRPALIDPILVSRKEHIFGKKKFATRIKFHEKGRFHEISIECKNGSN  195

Query  981   T-------------EPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWM  1121
             +             EPEM I +DG   + V +L W+FRGNE + +  + VEV+WDVHDW+
Sbjct  196   SGTIVSNGNSINGDEPEMEIRIDGHLVIHVKHLQWKFRGNEYINLRKLRVEVYWDVHDWL  255

Query  1122  FNDDSSSVAAGPGVFIFK  1175
             F     S      +FIFK
Sbjct  256   F-----SPGLRHALFIFK  268



>ref|XP_009805050.1| PREDICTED: uncharacterized protein LOC104250176 [Nicotiana sylvestris]
Length=297

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 156/284 (55%), Gaps = 25/284 (9%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  K+      + +TWSK+L+G  L++ +++ +  N   CK+D+K W F  KK
Sbjct  26    QNLVTCVYQCKLRGKSCLLNVTWSKNLMGQGLTVGIDDNT--NQCLCKVDIKPWLFSKKK  83

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+      ++DVYWD  +AKF S PEP   FYV + +  ++++LLGD + EA K+T +
Sbjct  84    GSKTLEAYSRKIDVYWDLTSAKFGSGPEPLEGFYVCVVSERQMILLLGDMRKEATKKTSA  143

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P    A  + KKE ++ K+ F T+       R H+++IE D SG ++P + I VD    
Sbjct  144   TPSASGAVFIAKKEHIFGKKVFGTKAQFCDNGRVHDLVIECDTSGTSDPCLVIRVDSKPM  203

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             ++V  L W+FRGN T++VD + VEVFWDVH+W+F       +AG GVF+FK     +   
Sbjct  204   LQVKRLRWKFRGNHTLLVDGLGVEVFWDVHNWLFG-----TSAGDGVFMFKTSISAEKLW  258

Query  1203  eeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
                    Q  CD             ++QS    F    YAWK E
Sbjct  259   AT-----QPICDPQTLHWSWSQRFREAQSHSLGFSLFLYAWKNE  297



>ref|XP_007147151.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
 gb|ESW19145.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
Length=297

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 148/242 (61%), Gaps = 7/242 (3%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + + Q+ VTC++  ++      IT+TWSK+L+G  L + +++ S  +   CK+
Sbjct  17    DSSSSSANKSTQNVVTCVYQCRVGGSSCLITVTWSKNLMGQGLGVAIDDSSSQS--LCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS  V   +VDVYWD  +AKF SSPEP   FYV     G++++LLGD
Sbjct  75    DIKPWGFSKRRGCKSLEVHSCKVDVYWDLSSAKFGSSPEPLGGFYVGAVVDGQMILLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              K EAFK+T + P   +  L+ KKE V+ K+ + T+ +     + H+I+IE D +  ++P
Sbjct  135   LKKEAFKKTNASPLPHNGFLIAKKEHVFGKKLYGTKAVFCDNGQIHDIVIECDTATVSDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+
Sbjct  195   SLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSLGNAVFM  249

Query  1170  FK  1175
             F+
Sbjct  250   FR  251



>ref|XP_010277409.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
 ref|XP_010277418.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
Length=298

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 157/286 (55%), Gaps = 15/286 (5%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             +  S   Q+ VTC++   +      IT+TWSK+L+G  LS+ +++ +  N   CK+D+K 
Sbjct  20    SSASKNAQNLVTCVYQGTLRGRSCMITVTWSKNLMGQGLSVGIDDST--NQCLCKVDIKP  77

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W F  +KG KS   D  +VD+YWD  +AKF S PEP   FY+A+    E+V+LLGD   E
Sbjct  78    WLFSKRKGSKSLEADSSKVDIYWDLSSAKFGSGPEPLEGFYLAVVFDREMVLLLGDLSKE  137

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWI  1001
             A+K+T + P   +A  V K+E ++ KR + T+       + H++ IE D     +P + I
Sbjct  138   AYKKTNAAPVPSNAIFVAKREHIFGKRLYGTKAQFCDNGQIHDVTIECDTVNLNDPCLLI  197

Query  1002  SVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQg  1181
              +D    ++V  L W+FRGN+T++VD + VEVFWDVH+W+F       A G  VF+F+  
Sbjct  198   RIDSKTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLFGP-----ALGSAVFMFQTC  252

Query  1182  ngg----kgegeeDNSLPQKSCD----DSQSRPPEFCHVFYAWKTE  1295
                          D ++   SC     DSQ +   F  + YAWK E
Sbjct  253   LSAEKLWASHTSSDPTILPWSCSQIFRDSQLQGLGFSLILYAWKNE  298



>gb|EYU22191.1| hypothetical protein MIMGU_mgv1a010634mg [Erythranthe guttata]
Length=306

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 163/287 (57%), Gaps = 18/287 (6%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT---CKID  632
             A  + + Q+    ++   IAD  R IT+TW K+L+ H LS+ V+   + +H+T   CK++
Sbjct  29    ASITRSGQNVFMSVYRTTIADRRRFITVTWCKNLLLHGLSVSVDG--DHHHHTSSACKVE  86

Query  633   LKTWQFWGKKGLKSFNVDQER-VDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             LK W FW K+G K F +D ++ VDV+WD + A+F+   EP SD+YVA+  GGEVV LLG+
Sbjct  87    LKPWYFWKKQGSKRFLIDGDKPVDVFWDLKIARFNGETEPTSDYYVAVVCGGEVV-LLGN  145

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE-----TDLS  974
              K EA+++T  RP +VD TL+ ++E ++ K+ F TR         H I IE     T  +
Sbjct  146   LKKEAYRKTGCRPALVDPTLISRREHIFGKKKFITRVKFHDKGSFHEISIECKNKSTGPN  205

Query  975   GPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAG  1154
              P EPEM I +DG  +V V +L W+FRGNE++ ++   ++V+WDVHDW+F     S    
Sbjct  206   SPVEPEMEIRIDGHLAVHVKHLQWKFRGNESIHLNKARIDVYWDVHDWLF-----SPGLR  260

Query  1155  PGVFIFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
               +FIFK             S          +  P+FC   YAW+ E
Sbjct  261   HALFIFKPTLLPALSTSSPPSP-PPGSSGGSAEGPDFCLFLYAWRVE  306



>ref|XP_006395009.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
 gb|ESQ32295.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
Length=288

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 158/282 (56%), Gaps = 10/282 (4%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +      Q+ VTCI+  +I      IT+TW+K+L+G +++I V++    N   CK+
Sbjct  17    DSSSSNSGKNAQNLVTCIYQCRIRGRNCLITVTWTKNLMGQSVTIGVDDSC--NQSLCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             ++K W F  +KG KS       +DV+WD  +AKF S PE    FYV +    E+V+LLGD
Sbjct  75    EIKPWLFTKRKGSKSLEAYSCNIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              K EAFK+T + P  + A  + KKE V+ KR F T+  L    + H+++IE D S  T+P
Sbjct  135   MKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLVIECDTS-VTDP  193

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VDG   ++V  L W+FRGN+T++V+ +AVEV WDVH W+F   S    AG  VF+
Sbjct  194   CLIVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFAMPS----AGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             F+              +   +  +S+S+   F  + YAWK E
Sbjct  250   FRTCQSPDKSLSFSQDM---TTTNSKSQSFGFSLILYAWKNE  288



>ref|XP_010923391.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923392.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923393.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
Length=288

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 159/285 (56%), Gaps = 16/285 (6%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +    T Q+ V+C++  ++      IT+TWSK+L+   LSI +++ +  N   CK+
Sbjct  17    DSSSSSAGKTVQNLVSCVYRTQLCRRSCVITVTWSKNLMSQGLSIGIDDSA--NRSVCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  +KG KS   +  +VD++WD  AAKF S PEP   FYVA+    E+V+LLGD
Sbjct  75    DIKPWLFSKRKGSKSLEAENSKVDIFWDLSAAKFGSGPEPLEGFYVAVVFDLEMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
                EA+++T + PP  +A  + ++E +Y K  +CT+       + H+I IE +  G  +P
Sbjct  135   LTKEAYRKTSASPPPSNAVFIARREHIYGKNVYCTKAQFCDNGQVHDIAIECETVGLKDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN+T++VD + VEVFWDVH+W+F   +     G  VF+
Sbjct  195   SLEIRIDKKRVMQVKRLGWKFRGNQTILVDGLPVEVFWDVHNWLFGTPT-----GNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCD---DSQSRPPEFCHVFYAWKTE  1295
             F+           +  LP  S     +S+ +   F  + YAWK E
Sbjct  250   FQ------TCISAEKLLPWSSSQIFRESELQGLGFSLILYAWKDE  288



>emb|CAN68226.1| hypothetical protein VITISV_040533 [Vitis vinifera]
Length=300

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 159/282 (56%), Gaps = 15/282 (5%)
 Frame = +3

Query  474   ATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFW  653
             +T Q+ VTC++  K+      I ITWSK+L+G  LS+ +++    N   CK D+K W F 
Sbjct  26    STAQNLVTCVYSCKLGGKSCLIIITWSKNLVGQCLSVEIDDWM--NQCLCKFDIKPWLFA  83

Query  654   GKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKR  833
              +KG KSF ++  +VD YWD   AKF S PEP   FY+A+   G++V+LLGD + EAFK+
Sbjct  84    KRKGSKSFEINSIQVDTYWDLSLAKFGSGPEPLEGFYLAVVFNGDMVLLLGDMRKEAFKK  143

Query  834   TKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDG  1013
             T + P   +A  V KKE ++ K+ + T+       + HN+ IE D  G  +P + I +D 
Sbjct  144   TNATPGFYNAIFVSKKEHIFGKKLYGTKAQFWDNGQNHNLSIECDTVGTDDPFLAIRIDS  203

Query  1014  IESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg-  1190
                ++V +L W+FRGN+T+++D + VEVFWDVH+W+F       + G  VF+F+  +   
Sbjct  204   KMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGP-----SVGNAVFMFQTCSSAE  258

Query  1191  ---kgegeeDNSLPQKSCDDS----QSRPPEFCHVFYAWKTE  1295
                  +   D+S     C  +    + +   F  + YAWK E
Sbjct  259   KLWSSQPFFDSSALLSPCSQNFREFKLQGLGFSLILYAWKNE  300



>ref|XP_004301059.1| PREDICTED: uncharacterized protein LOC101305476 [Fragaria vesca 
subsp. vesca]
Length=742

 Score =   207 bits (528),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 168/309 (54%), Gaps = 32/309 (10%)
 Frame = +3

Query  441   RREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYT  620
             R  D   A    + QS V  ++  KIA   R IT+TW K+L+ H LS+ V+    ++ Y 
Sbjct  442   RPADHDPAGVIRSGQSLVMSVYSTKIAGRCRLITVTWCKNLLLHGLSVSVQGQEGEDAYR  501

Query  621   CKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVIL  800
             CK++LK W FW K G K F VD   VDV WD +AAKF+   EP SD+YVA     EVV+L
Sbjct  502   CKVELKPWYFWRKTGAKQFMVDGITVDVVWDLKAAKFNGETEPQSDYYVAFVCEEEVVLL  561

Query  801   LGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTML---GRGKREHNIIIETD-  968
             +GDQK +A++RT  RP +++  LV +KE ++ KR + T       G+GK  H I+IE + 
Sbjct  562   VGDQKKDAYRRTGCRPSLIEPILVSRKEHLFGKRKYSTGIQFHEQGKGKF-HEILIECNN  620

Query  969   ------LSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFND  1130
                        +PE+ I +DG +++ V +L W+FRGNE+V V+   VEV++DVHDW+F  
Sbjct  621   NSNNSVTGSGADPELEIKIDGNQAIHVKHLQWKFRGNESVDVNKTKVEVYYDVHDWLF--  678

Query  1131  DSSSVAAGP--GVFIFKQgnggkgegeeDNSLP-----QKSC-------DDSQSRPPEFC  1268
                   +GP  G+FIFK       E     +       QKS        DDS      F 
Sbjct  679   -----GSGPRYGMFIFKPIPSESAESSLSTTAQVLTHHQKSRGGLEDEDDDSAGGSSGFS  733

Query  1269  HVFYAWKTE  1295
              + YAWK E
Sbjct  734   LLVYAWKVE  742



>ref|XP_009364535.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364536.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364537.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364538.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364540.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
Length=299

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 157/279 (56%), Gaps = 15/279 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  ++      IT+TWS++L+G  LS+ +++ S  N   CK+D+K W F  ++
Sbjct  28    QNLVTCMYQCRLRGRSCLITVTWSRNLMGQGLSVGIDDSS--NQCLCKVDIKPWLFSKRR  85

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G KS      ++D+YWD  +AKF S PEP   +YV +    ++++LLGD + EAFK+T +
Sbjct  86    GSKSLEAYSSQIDIYWDLSSAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAFKKTSA  145

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P    A  V K+E ++ KR F T+       + H+++IE D  G  +P + + VD    
Sbjct  146   NPVPSSAVCVAKREHIFGKRGFTTKAQFCNNGQVHDLVIECDTVGVNDPCLLVRVDSKPV  205

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg----  1190
             ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+FK         
Sbjct  206   MQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSPGNAVFMFKTCLSAEKLW  260

Query  1191  kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
               +   D S  Q    +   DS+S+   F  + YAWK E
Sbjct  261   ASQPASDPSALQWSFSQRFSDSKSQSLGFSLILYAWKNE  299



>dbj|BAJ95878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 158/274 (58%), Gaps = 15/274 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  ++A     +++TWSKSL+G  LS+ V+  S      CK D+K W F  KK
Sbjct  31    QNLVTCLYQTQLAARPCVVSVTWSKSLMGQGLSVAVDGLS--GQSLCKADIKPWLFSKKK  88

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G KS +VD  +VD++WD  AA+F + PEP   FYVAL    E+ +LLGD   +A+++T +
Sbjct  89    GSKSLDVDGGKVDIFWDLSAARFGAGPEPLEGFYVALVFDLELALLLGDMNKDAYRKTGA  148

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
               P ++A  V +KE +Y K+ +  +       + H+++IE D  G  +P + I +D    
Sbjct  149   NRPALNAAFVARKEHIYGKKIYSAKAQFCDNGQFHDLVIECDTVGLKDPCLEIRIDKKPV  208

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             ++V  L W+FRGN+T++VD + VEVFWDVH W+F   ++S A    VF+F+         
Sbjct  209   MQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTTSNA----VFMFQ------TCQ  258

Query  1203  eeDNSLP---QKSCDDSQSRPPEFCHVFYAWKTE  1295
               + S+P    +   +SQ +   F  + YAWK E
Sbjct  259   APEKSMPWSYSQIFRESQLQGLGFSLILYAWKIE  292



>ref|XP_010932250.1| PREDICTED: uncharacterized protein LOC105052962 [Elaeis guineensis]
Length=325

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 170/318 (53%), Gaps = 46/318 (14%)
 Frame = +3

Query  447   EDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHY---  617
             +D   A  + + Q  V  I+   IA   R IT+TW K+L+ H LS++VE    ++ +   
Sbjct  19    DDPTSAVATRSGQGAVMLIYRTWIAGHCRLITVTWCKNLLAHGLSVLVEGSDNNDEHKSN  78

Query  618   -------------------TCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSS  740
                                +CK++++ W FW K+G K F+V+ + VDVYWD + AKFS  
Sbjct  79    GNNSINVDSSSSSSNKHQNSCKVEMRPWNFWRKQGSKRFHVEGKPVDVYWDLKNAKFSDE  138

Query  741   PEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRT  920
             PEP SD+YVA+ +  +VV+LLGD K +AF+RT SRP +++A LV KKE V+ K+ F TR 
Sbjct  139   PEPQSDYYVAVVSNDQVVLLLGDLKEDAFRRTGSRPSLIEAILVSKKEHVFGKKRFSTRA  198

Query  921   MLGRGKREHNIIIETDL-----SGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNV  1085
                   + H+I IE +      +G  + EM + +D   ++ V +L W+FRGNE++ ++  
Sbjct  199   KFHEEAKFHDISIECNSSSSSTNGGMDSEMVMKIDKHVAIHVRHLQWKFRGNESISINKQ  258

Query  1086  AVEVFWDVHDWMFNDDSSSVAAGPG----VFIFKQgnggkgegeeD----NSLPQKSCDD  1241
              V+V+WDVHDW+F          PG    +FIFK  +             N+    + + 
Sbjct  259   RVQVYWDVHDWLF---------APGLRHALFIFKPESLPSSSSSTSSSSYNNFAGSNANG  309

Query  1242  SQSRPPEFCHVFYAWKTE  1295
              +S    FC   YAWK E
Sbjct  310   GES--SGFCLFLYAWKLE  325



>ref|XP_010248684.1| PREDICTED: uncharacterized protein LOC104591523 [Nelumbo nucifera]
Length=782

 Score =   207 bits (527),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 157/266 (59%), Gaps = 19/266 (7%)
 Frame = +3

Query  420   QLRP---MNPRREDQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVV  590
             QL P   ++  ++    A  +   Q+    ++  KIA   R IT+TW K+L+ H L + V
Sbjct  465   QLIPACFLSGEKQSDDPAAVTKAGQNVFLSVYRTKIAGQCRMITVTWCKNLLLHGLCVSV  524

Query  591   ENPSEDNHYTCKIDLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVA  770
             E P+ +N Y+CK++LK W FW K+G K F V+ + VD++WD +AAKF+   EP SD+YVA
Sbjct  525   EGPNGENQYSCKVELKPWYFWRKQGSKRFMVEGKAVDIFWDLKAAKFNGETEPQSDYYVA  584

Query  771   LATGGEVVILLGDQKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHN  950
             +A   EVV+LLGD K +A+++T  RP +++ ++V KKE ++ K+   +R       R H 
Sbjct  585   VACEDEVVLLLGDLKKDAYRKTGCRPALIEPSMVSKKEHIFGKKKLTSRVKFHEKGRLHE  644

Query  951   IIIE-----------TDLSGPTEPEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEV  1097
             I IE               G  +PEM I VDG  ++ V +L+W+FRGN+++ V  V VEV
Sbjct  645   ISIEFNNSSSSSVNTNSCVGGFDPEMEIKVDGKLAIHVKHLHWKFRGNQSISVHKVRVEV  704

Query  1098  FWDVHDWMFNDDSSSVAAGPGVFIFK  1175
             +WDVHDW+F     S      +FIFK
Sbjct  705   YWDVHDWLF-----SPGLRHALFIFK  725



>ref|XP_009362927.1| PREDICTED: uncharacterized protein LOC103952942 [Pyrus x bretschneideri]
Length=302

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 144/241 (60%), Gaps = 21/241 (9%)
 Frame = +3

Query  501   IHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDN--HYTCKIDLKTWQFWGKKGLKS  674
             ++ AK+    R ITITW K+L+ H LS+ VE P  D    +TCK++LK W FW K+G K 
Sbjct  3     VYRAKLGGQSRLITITWCKNLLLHGLSVSVEGPDGDQTQQHTCKVELKPWYFWRKQGSKR  62

Query  675   FNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKSRPPV  854
             F VD++ V+++WD +AAKF+   EP S++YVA+    EVV++LGD K +A+++T  RP +
Sbjct  63    FVVDEKAVEIFWDLKAAKFNGGTEPKSEYYVAVVCDEEVVLVLGDLKKDAYRKTGFRPAL  122

Query  855   VDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE--------------TDLSGPTEPE  992
              D TLV KKE ++ K+ F T+       R H I IE               +     EPE
Sbjct  123   TDPTLVSKKEHIFGKKKFSTKAKFYERGRSHEIAIECKNRGGGGGGSIGSGNTLNAVEPE  182

Query  993   MWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIF  1172
             + I VDG   V V +L W+FRGNE++ ++ + +EV+WDVHDW+F     S      +FIF
Sbjct  183   LEIRVDGHLVVHVKHLQWKFRGNESIHINKLRIEVYWDVHDWLF-----SPGLRHALFIF  237

Query  1173  K  1175
             K
Sbjct  238   K  238



>ref|XP_009151242.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 ref|XP_009151243.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 emb|CDX86191.1| BnaA06g29080D [Brassica napus]
Length=293

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 162/283 (57%), Gaps = 7/283 (2%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +      Q+ V CI+  +I      IT+TW+KSL+G ++++ V++ S +N   CK+
Sbjct  17    DSSSSNSGKNAQNLVACIYQCRIRGRSCLITVTWAKSLMGQSVTVGVDD-SCNNQSLCKV  75

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             ++K W F  +KG KS      ++DV+WD  +AKF S PE    FYV++    E+V+LLGD
Sbjct  76    EIKPWLFTKRKGSKSLEAYSCKIDVFWDLSSAKFGSGPEALGGFYVSVVVDKEMVLLLGD  135

Query  810   QKSEAFKRTKSRP-PVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTE  986
              + EAFK+T + P   + A  V KKE V+ KR F T+  L    + H+++IE D S  T+
Sbjct  136   MRKEAFKKTNASPSSSLGAVFVAKKEHVFGKRAFATKAELCADGKIHDVVIECDTS-VTD  194

Query  987   PEMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVF  1166
             P + + VDG   ++V  L W+FRGN+T++V+ +AVEV WDVH W+F   S    AG  VF
Sbjct  195   PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPS----AGNAVF  250

Query  1167  IFKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             +F+       +    +     +  +S+S+   F  + YAWK E
Sbjct  251   MFRTCQSSSEKSLSFSQDVMATTTNSKSQSFGFSLILYAWKNE  293



>ref|XP_008388659.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388660.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388661.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
Length=299

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 156/279 (56%), Gaps = 15/279 (5%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  ++      IT+TWS++L+G  LS+ +++ S  N   CK+D+K W F  ++
Sbjct  28    QNLVTCMYQCRLRGRSCLITVTWSRNLMGQGLSVGIDDSS--NQCLCKVDIKPWLFSKRR  85

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G KS      ++D+YWD   AKF S PEP   +YV +    ++++LLGD + EAFK+T +
Sbjct  86    GSKSLEAYSSKIDIYWDLSLAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAFKKTSA  145

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P    A  V K+E ++ KR F T+       + H+++IE D  G  +P + + VD    
Sbjct  146   SPVPSSAVCVAKREHIFGKRGFTTKAQFCNNGQVHDLVIECDTVGVNDPCLLVRVDSKPV  205

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg----  1190
             ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+FK         
Sbjct  206   MQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSPGNAVFMFKTCLSAEKLW  260

Query  1191  kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
               +   D S  Q    +   DS+S+   F  + YAWK E
Sbjct  261   ASQPASDPSALQWSFSQRFSDSKSQGLGFSLILYAWKNE  299



>ref|XP_004159590.1| PREDICTED: uncharacterized protein LOC101232142 [Cucumis sativus]
 gb|KGN62327.1| hypothetical protein Csa_2G349610 [Cucumis sativus]
Length=325

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 149/243 (61%), Gaps = 17/243 (7%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             + QS    ++  KI    R IT+TW K+L+ H LSI V+ P  +  Y CK+++K W FW 
Sbjct  27    SGQSVFMSVYQTKIVGQCRLITVTWCKNLLLHGLSICVQGPEGNEQYQCKVEMKPWYFWR  86

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             K+G K F V+   VDV WD ++AKF+   EP SD+YVA+    EVV+L+GD K +AF++T
Sbjct  87    KQGSKHFEVEGRAVDVVWDLKSAKFNGETEPQSDYYVAVVCEEEVVLLIGDLKKDAFRKT  146

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIE--------TDLSGPTEPE  992
               RP +++ TLV KKE V+ K+ F TR       + H I IE          LS   +PE
Sbjct  147   GCRPALIEPTLVSKKEHVFGKKMFSTRIQFHEKGKLHTISIEFINVNNTNPSLSDSFDPE  206

Query  993   MWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGP--GVF  1166
             + + +DG  ++++ +L+W+FRGNE++++    +EV+WDVHDW+F        +GP  G+F
Sbjct  207   LEMRIDGQPAIKIKHLHWKFRGNESILISRTRLEVYWDVHDWLF-------GSGPRYGLF  259

Query  1167  IFK  1175
             IF+
Sbjct  260   IFR  262



>ref|XP_008345708.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
 ref|XP_008345709.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
Length=299

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/281 (36%), Positives = 157/281 (56%), Gaps = 15/281 (5%)
 Frame = +3

Query  477   TDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWG  656
             T Q+ VTC++  ++      IT+TWS++L+G  LS+ +++ S  +   CK+D+K W F  
Sbjct  26    TAQNLVTCVYQCRLRGQSCLITVTWSRNLMGQGLSVGIDDSS--SQCLCKVDIKPWLFSK  83

Query  657   KKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRT  836
             ++G KS      ++D+YWD  +AKF S PEP   +YV +    ++++LLGD + EAFK+T
Sbjct  84    RRGSKSLEAYSSKIDIYWDLSSAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAFKKT  143

Query  837   KSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGI  1016
                P    A  V K+E ++ KR F T+       + H+++IE D  G  +P + + VD  
Sbjct  144   SVTPVPSSAVCVAKREHIFGKRGFATKAQFCNNGQVHDLVIECDTVGVNDPCLLVRVDSK  203

Query  1017  ESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgngg--  1190
               ++V  L W+FRGN T++VD +AVEVFWDVH+W+F       + G  VF+FK       
Sbjct  204   PVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFG-----TSPGNAVFMFKTCLSAEK  258

Query  1191  --kgegeeDNSLPQ----KSCDDSQSRPPEFCHVFYAWKTE  1295
                 +   D S  Q    +   DS+S+   F  + YAWK E
Sbjct  259   LWASQPASDPSTLQWSFSQRFSDSKSQGLGFSLILYAWKNE  299



>ref|XP_003554710.1| PREDICTED: uncharacterized protein LOC100806479 [Glycine max]
Length=297

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 157/289 (54%), Gaps = 15/289 (5%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +  + + Q+ VTC++  +I  +   IT+TWSK+L+G  L + +++ S  +   CK+
Sbjct  17    DSSSSSANKSAQNVVTCVYQCRIGGISCLITVTWSKNLMGQGLGVGIDDSSSQS--LCKV  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             D+K W F  ++G KS  V   +VDVYWD  +AKF S PEP   FYV     G++V+LLGD
Sbjct  75    DIKPWGFSKRRGCKSLEVHSCKVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              + EAFK+T + P   +A LV KKE V+ K+   T+ +       H+++IE D +   +P
Sbjct  135   LRKEAFKKTNANPLPHNAVLVAKKEHVFGKKLHGTKAVFCDNGPIHDLVIECDTASVGDP  194

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + I +D    ++V  L W+FRGN T++VD +AVEVFWDVH+W F       + G  VF+
Sbjct  195   SLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWFFG-----TSLGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPE-------FCHVFYAWKTE  1295
             F+       +       P         R PE       F  + YAWK +
Sbjct  250   FRTCLSAADKLWASQP-PSDLAWSFSERFPETKLQGLSFSLILYAWKNQ  297



>ref|XP_011042397.1| PREDICTED: uncharacterized protein LOC105138093 isoform X2 [Populus 
euphratica]
Length=308

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 151/250 (60%), Gaps = 19/250 (8%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  K+A L R I ITW K+L+ H LSI V+  +   H+ CK++LK 
Sbjct  23    ATVTRSGQSVFMSVYRTKLAGLCRLIIITWCKNLLMHGLSISVQATNGSEHHQCKVELKP  82

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD   VDV WD +AA+F+   EP SD+YVA+    EVV+L+GD K +
Sbjct  83    WNFWRKQGSKQFIVDGRAVDVVWDLKAAQFNGETEPQSDYYVAIVCEEEVVLLVGDLKKD  142

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT------  983
             A+++T  RP +++  LV +KE V+ K+ F TR       + H I IE    G +      
Sbjct  143   AYRKTGCRPALIEPMLVSRKEHVFGKKRFKTRVKFIEKGKFHGISIECINGGSSGSNIIG  202

Query  984   ---EPEMWISVDGIESVRVMNLNWRFRGNETVMVD-NVAVEVFWDVHDWMFNDDSSSVAA  1151
                +P++ I VDG +++ V +L W+FRGNE++ V+ +  V+V+WDVHDW+F        +
Sbjct  203   DRFDPQLEIKVDGEQAILVKHLQWKFRGNESIHVNKSTRVDVYWDVHDWLF-------GS  255

Query  1152  GP--GVFIFK  1175
             GP  G+FIFK
Sbjct  256   GPRQGLFIFK  265



>ref|XP_006347793.1| PREDICTED: uncharacterized protein LOC102597851 [Solanum tuberosum]
Length=299

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 154/284 (54%), Gaps = 25/284 (9%)
 Frame = +3

Query  483   QSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKTWQFWGKK  662
             Q+ VTC++  K+      + +TWSK+L+G  L+I +++ +  N   CK+D+K W F  KK
Sbjct  28    QNLVTCVYQCKLRGKSCLLNVTWSKNLMGQGLTIGIDDNT--NQCLCKVDIKPWLFSKKK  85

Query  663   GLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSEAFKRTKS  842
             G K+      ++DV WD  +AKF S PEP   FYV + +  ++++LLGD K EA K+T +
Sbjct  86    GSKTLEAYSRKIDVCWDLSSAKFGSGPEPLEGFYVCVVSERQMILLLGDMKKEAIKKTSA  145

Query  843   RPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEPEMWISVDGIES  1022
              P    A  + KKE ++ K+ F T+       R H+++IE D SG ++P + I VD    
Sbjct  146   TPAACGAVFIAKKEHMFGKKVFSTKAQFCDNGRVHDLVIECDTSGTSDPCLVIRVDSKPM  205

Query  1023  VRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFIFKQgnggkgeg  1202
             ++V  L W+FRGN T++VD + VEVFWDVH+W+F     S + G  VF+FK     +   
Sbjct  206   MQVKRLKWKFRGNHTMLVDGLGVEVFWDVHNWLF-----STSVGSAVFMFKTNISAEKLW  260

Query  1203  eeDNSLPQKSCD-------------DSQSRPPEFCHVFYAWKTE  1295
                    Q  CD             ++QS    F    YAWK E
Sbjct  261   AT-----QPICDPQTLHWSWSQRFREAQSHDLGFSLFLYAWKNE  299



>ref|XP_011042396.1| PREDICTED: uncharacterized protein LOC105138093 isoform X1 [Populus 
euphratica]
Length=311

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 151/250 (60%), Gaps = 19/250 (8%)
 Frame = +3

Query  462   AEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKIDLKT  641
             A  + + QS    ++  K+A L R I ITW K+L+ H LSI V+  +   H+ CK++LK 
Sbjct  23    ATVTRSGQSVFMSVYRTKLAGLCRLIIITWCKNLLMHGLSISVQATNGSEHHQCKVELKP  82

Query  642   WQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGDQKSE  821
             W FW K+G K F VD   VDV WD +AA+F+   EP SD+YVA+    EVV+L+GD K +
Sbjct  83    WNFWRKQGSKQFIVDGRAVDVVWDLKAAQFNGETEPQSDYYVAIVCEEEVVLLVGDLKKD  142

Query  822   AFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPT------  983
             A+++T  RP +++  LV +KE V+ K+ F TR       + H I IE    G +      
Sbjct  143   AYRKTGCRPALIEPMLVSRKEHVFGKKRFKTRVKFIEKGKFHGISIECINGGSSGSNIIG  202

Query  984   ---EPEMWISVDGIESVRVMNLNWRFRGNETVMVD-NVAVEVFWDVHDWMFNDDSSSVAA  1151
                +P++ I VDG +++ V +L W+FRGNE++ V+ +  V+V+WDVHDW+F        +
Sbjct  203   DRFDPQLEIKVDGEQAILVKHLQWKFRGNESIHVNKSTRVDVYWDVHDWLF-------GS  255

Query  1152  GP--GVFIFK  1175
             GP  G+FIFK
Sbjct  256   GPRQGLFIFK  265



>ref|XP_002872306.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48565.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 157/282 (56%), Gaps = 10/282 (4%)
 Frame = +3

Query  450   DQKEAEESATDQSYVTCIHLAKIADLLRTITITWSKSLIGHALSIVVENPSEDNHYTCKI  629
             D   +      Q+ VTCI+  +I      IT+TW+K+L+G ++++ V++    N   CK 
Sbjct  17    DSSSSNSGKNAQNLVTCIYQCRIRGRNCLITVTWTKNLMGQSVTVGVDDSC--NQSLCKF  74

Query  630   DLKTWQFWGKKGLKSFNVDQERVDVYWDFRAAKFSSSPEPDSDFYVALATGGEVVILLGD  809
             ++K W F  +KG KS       +DV+WD  +AKF S PE    FYV +    E+V+LLGD
Sbjct  75    EIKPWLFTKRKGSKSLEAYSCNIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGD  134

Query  810   QKSEAFKRTKSRPPVVDATLVHKKESVYAKRCFCTRTMLGRGKREHNIIIETDLSGPTEP  989
              K EAFK+T + P  + A  + KKE V+ KR F T+  L    + H+++IE D S  T+P
Sbjct  135   MKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLLIECDTS-VTDP  193

Query  990   EMWISVDGIESVRVMNLNWRFRGNETVMVDNVAVEVFWDVHDWMFNDDSSSVAAGPGVFI  1169
              + + VDG   ++V  L W+FRGN+T++V+ +AVEV WDVH W+F        AG  VF+
Sbjct  194   CLVVRVDGKTLLQVKRLKWKFRGNDTIIVNRMAVEVLWDVHSWLFGLP----PAGNAVFM  249

Query  1170  FKQgnggkgegeeDNSLPQKSCDDSQSRPPEFCHVFYAWKTE  1295
             F+     +        +   +  +S+S+   F  + YAWK E
Sbjct  250   FRTCQSTEKSLSFSEDM---TTTNSKSQSFGFSLILYAWKNE  288



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4065968517228