BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13607_g2_i1 len=2637 path=[4790:0-2636]

Length=2637
                                                                      Score     E

ref|XP_009614130.1|  PREDICTED: potassium channel AKT2/3-like          1216   0.0      
dbj|BAD81033.1|  potassium channel NKT2                                1211   0.0      Nicotiana tabacum [American tobacco]
dbj|BAA84085.1|  potassium channel                                     1209   0.0      Nicotiana paniculata
ref|XP_009791067.1|  PREDICTED: potassium channel AKT2/3-like          1209   0.0      
ref|XP_009795716.1|  PREDICTED: potassium channel AKT2/3-like          1206   0.0      
ref|XP_004230485.1|  PREDICTED: potassium channel AKT2/3-like          1203   0.0      
ref|XP_009616703.1|  PREDICTED: potassium channel AKT2/3-like          1201   0.0      
ref|XP_006349369.1|  PREDICTED: potassium channel AKT2/3-like          1201   0.0      
gb|ABF85695.1|  potassium channel                                      1201   0.0      Nicotiana rustica [wild tobacco]
ref|XP_011087731.1|  PREDICTED: potassium channel AKT2/3               1189   0.0      
ref|NP_001275259.1|  potassium channel AKT2/3-like                     1182   0.0      
ref|XP_010327298.1|  PREDICTED: potassium channel AKT2/3-like          1174   0.0      
emb|CDO97567.1|  unnamed protein product                               1167   0.0      
ref|XP_002529533.1|  Potassium channel AKT2/3, putative                1124   0.0      Ricinus communis
gb|KDP38842.1|  hypothetical protein JCGZ_04999                        1116   0.0      
ref|XP_006431832.1|  hypothetical protein CICLE_v10000273mg            1107   0.0      
ref|XP_006471022.1|  PREDICTED: potassium channel AKT2/3-like          1105   0.0      
ref|XP_002268924.1|  PREDICTED: potassium channel AKT2/3               1100   0.0      Vitis vinifera
ref|XP_003593018.1|  Potassium channel                                 1099   0.0      
ref|XP_004485488.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...   1097   0.0      
ref|XP_003532990.1|  PREDICTED: potassium channel AKT2/3 isoform X1    1095   0.0      
gb|KHN11238.1|  Potassium channel AKT2/3                               1094   0.0      
ref|XP_010101161.1|  Potassium channel                                 1094   0.0      
ref|XP_007042250.1|  Potassium transport 2/3 isoform 1                 1091   0.0      
ref|XP_007225285.1|  hypothetical protein PRUPE_ppa001379mg            1087   0.0      
ref|XP_003540163.1|  PREDICTED: potassium channel AKT2/3-like iso...   1085   0.0      
ref|XP_010245053.1|  PREDICTED: potassium channel AKT2/3-like iso...   1082   0.0      
ref|XP_007148520.1|  hypothetical protein PHAVU_006G215700g            1082   0.0      
ref|XP_006385212.1|  potassium channel family protein                  1077   0.0      
ref|XP_010245052.1|  PREDICTED: potassium channel AKT2/3-like iso...   1076   0.0      
gb|EYU26523.1|  hypothetical protein MIMGU_mgv1a001765mg               1073   0.0      
gb|AAD16278.1|  pulvinus inward-rectifying channel for potassium ...   1070   0.0      Samanea saman [cow-tamarind]
ref|XP_008218775.1|  PREDICTED: potassium channel AKT2/3               1068   0.0      
emb|CAA71598.1|  potassium channel                                     1067   0.0      Vicia faba [broad bean]
emb|CBI23771.3|  unnamed protein product                               1065   0.0      
emb|CAC05489.1|  potassium channel 2                                   1060   0.0      Populus tremula x Populus tremuloides
gb|AEY75251.1|  potassium channel                                      1058   0.0      
ref|XP_009355246.1|  PREDICTED: potassium channel AKT2/3 isoform X1    1057   0.0      
ref|NP_001291251.1|  potassium channel AKT2/3                          1053   0.0      
ref|XP_008378877.1|  PREDICTED: potassium channel AKT2/3 isoform X3    1051   0.0      
ref|XP_010065457.1|  PREDICTED: potassium channel AKT2/3               1041   0.0      
ref|XP_006585489.1|  PREDICTED: potassium channel AKT2/3 isoform X2    1037   0.0      
ref|XP_004299918.1|  PREDICTED: potassium channel AKT2/3-like          1035   0.0      
ref|XP_010277671.1|  PREDICTED: potassium channel AKT2/3-like          1028   0.0      
ref|XP_010539347.1|  PREDICTED: potassium channel AKT2/3 isoform X2    1026   0.0      
ref|XP_010539338.1|  PREDICTED: potassium channel AKT2/3 isoform X1    1026   0.0      
ref|XP_008783360.1|  PREDICTED: potassium channel AKT2                 1015   0.0      
ref|XP_010539356.1|  PREDICTED: potassium channel AKT2/3 isoform X3    1015   0.0      
gb|KFK28793.1|  hypothetical protein AALP_AA7G048900                   1014   0.0      
ref|NP_567651.1|  potassium channel AKT2/3                             1011   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAA96153.1|  AKT3                                                   1011   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283121.1|  hypothetical protein CARUB_v10004143mg            1006   0.0      
ref|XP_010448923.1|  PREDICTED: potassium channel AKT2/3-like          1003   0.0      
ref|XP_010439358.1|  PREDICTED: potassium channel AKT2/3                998   0.0      
ref|XP_010434070.1|  PREDICTED: potassium channel AKT2/3-like           992   0.0      
emb|CDX79135.1|  BnaA01g12020D                                          991   0.0      
ref|XP_009135705.1|  PREDICTED: potassium channel AKT2/3                991   0.0      
ref|XP_002867783.1|  hypothetical protein ARALYDRAFT_492645             991   0.0      
emb|CDX82921.1|  BnaC01g13710D                                          991   0.0      
ref|XP_006413681.1|  hypothetical protein EUTSA_v10024449mg             990   0.0      
ref|XP_009355247.1|  PREDICTED: potassium channel AKT2/3 isoform X2     988   0.0      
ref|XP_010529461.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    987   0.0      
ref|XP_010910948.1|  PREDICTED: potassium channel AKT2-like isofo...    981   0.0      
ref|XP_008378875.1|  PREDICTED: potassium channel AKT2/3 isoform X1     975   0.0      
ref|XP_009405920.1|  PREDICTED: potassium channel AKT2                  973   0.0      
gb|AAD39492.1|AF145272_1  pulvinus inward-rectifying channel SPICK2     956   0.0      Samanea saman [cow-tamarind]
ref|XP_002441141.1|  hypothetical protein SORBIDRAFT_09g021160          952   0.0      Sorghum bicolor [broomcorn]
ref|XP_006654434.1|  PREDICTED: potassium channel AKT2-like             949   0.0      
ref|XP_006431831.1|  hypothetical protein CICLE_v10000273mg             949   0.0      
ref|XP_004961990.1|  PREDICTED: potassium channel AKT2-like isofo...    947   0.0      
ref|XP_010681784.1|  PREDICTED: potassium channel AKT2/3 isoform X1     940   0.0      
ref|XP_010930758.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    939   0.0      
ref|XP_004961989.1|  PREDICTED: potassium channel AKT2-like isofo...    939   0.0      
sp|Q75HP9.1|AKT2_ORYSJ  RecName: Full=Potassium channel AKT2            939   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008378876.1|  PREDICTED: potassium channel AKT2/3 isoform X2     939   0.0      
gb|EAY98139.1|  hypothetical protein OsI_20054                          939   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006585490.1|  PREDICTED: potassium channel AKT2/3 isoform X3     933   0.0      
ref|XP_008655420.1|  PREDICTED: potassium channel protein ZMK2 is...    931   0.0      
ref|XP_006859218.1|  hypothetical protein AMTR_s00070p00197870          928   0.0      
ref|NP_001105120.1|  potassium channel protein ZMK2                     926   0.0      Zea mays [maize]
ref|XP_006592673.1|  PREDICTED: potassium channel AKT2/3-like iso...    924   0.0      
ref|XP_010245054.1|  PREDICTED: potassium channel AKT2/3-like iso...    923   0.0      
ref|XP_009403703.1|  PREDICTED: potassium channel AKT2-like isofo...    922   0.0      
gb|KHG14137.1|  Potassium channel AKT2/3 -like protein                  912   0.0      
ref|XP_009403698.1|  PREDICTED: potassium channel AKT2-like isofo...    907   0.0      
gb|ABE99811.1|  inwardly rectifying potassium channel AKT2              905   0.0      Hordeum vulgare [barley]
dbj|BAJ86681.1|  predicted protein                                      902   0.0      
dbj|BAJ96949.1|  predicted protein                                      902   0.0      
ref|XP_009403704.1|  PREDICTED: potassium channel AKT2-like isofo...    899   0.0      
ref|XP_003568398.1|  PREDICTED: potassium channel AKT2                  894   0.0      
ref|NP_001147796.1|  potassium channel AKT2/3                           890   0.0      Zea mays [maize]
ref|XP_002441145.1|  hypothetical protein SORBIDRAFT_09g021210          885   0.0      Sorghum bicolor [broomcorn]
ref|XP_010681788.1|  PREDICTED: potassium channel AKT2/3 isoform X5     878   0.0      
ref|XP_002441143.1|  hypothetical protein SORBIDRAFT_09g021190          875   0.0      Sorghum bicolor [broomcorn]
ref|XP_010910952.1|  PREDICTED: potassium channel AKT2-like isofo...    853   0.0      
ref|XP_010681785.1|  PREDICTED: potassium channel AKT2/3 isoform X2     809   0.0      
gb|AEO14874.1|  rsmv3 protein                                           798   0.0      
gb|AFW81865.1|  potassium channel2                                      801   0.0      
ref|XP_008655421.1|  PREDICTED: potassium channel protein ZMK2 is...    789   0.0      
ref|XP_009403705.1|  PREDICTED: potassium channel AKT2-like isofo...    787   0.0      
gb|KDO50099.1|  hypothetical protein CISIN_1g038432mg                   783   0.0      
ref|XP_008781668.1|  PREDICTED: potassium channel AKT2-like             754   0.0      
ref|XP_007042251.1|  Potassium transport 2/3 isoform 2                  742   0.0      
ref|XP_008647796.1|  PREDICTED: potassium channel AKT2/3 isoform X1     746   0.0      
ref|XP_008456068.1|  PREDICTED: potassium channel AKT2/3                691   0.0      
ref|XP_004146262.1|  PREDICTED: potassium channel AKT2/3-like           691   0.0      
gb|EMS50502.1|  Potassium channel AKT2/3                                689   0.0      
ref|XP_004159885.1|  PREDICTED: potassium channel AKT2/3-like           659   0.0      
emb|CAA70947.1|  putative inward rectifying potassium channel           649   0.0      Solanum tuberosum [potatoes]
ref|XP_010047779.1|  PREDICTED: potassium channel AKT1-like isofo...    634   0.0      
gb|EMT08371.1|  hypothetical protein F775_52637                         634   0.0      
ref|XP_010249975.1|  PREDICTED: potassium channel AKT1-like             633   0.0      
ref|XP_010047932.1|  PREDICTED: potassium channel AKT1-like isofo...    631   0.0      
ref|XP_007013335.1|  K+ transporter 1                                   631   0.0      
ref|XP_009396647.1|  PREDICTED: potassium channel AKT1-like             626   0.0      
ref|NP_180233.1|  potassium channel AKT1                                624   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002529373.1|  Potassium channel AKT1, putative                   625   0.0      Ricinus communis
ref|XP_008464998.1|  PREDICTED: potassium channel AKT1 isoform X1       621   0.0      
ref|XP_004149890.1|  PREDICTED: potassium channel AKT1-like             620   0.0      
ref|XP_004969311.1|  PREDICTED: potassium channel AKT1-like             617   0.0      
gb|AIB06354.1|  potassium channel                                       616   0.0      
ref|XP_006293431.1|  hypothetical protein CARUB_v10025578mg             614   0.0      
emb|CBI20997.3|  unnamed protein product                                615   0.0      
gb|AFW83425.1|  potassium channel                                       614   0.0      
emb|CDP04802.1|  unnamed protein product                                614   0.0      
ref|XP_006646148.1|  PREDICTED: potassium channel AKT1-like             613   0.0      
gb|KFK41169.1|  hypothetical protein AALP_AA2G094700                    612   0.0      
ref|XP_010417806.1|  PREDICTED: potassium channel AKT1                  611   0.0      
ref|XP_010925257.1|  PREDICTED: potassium channel AKT1-like isofo...    611   0.0      
emb|CAN78157.1|  hypothetical protein VITISV_032798                     610   0.0      Vitis vinifera
emb|CAI77627.1|  potassium uptake channel                               609   0.0      Zea mays [maize]
gb|AHZ30618.1|  potassium channel AKT1                                  609   0.0      
gb|ABO15470.1|  AKT1-like K+ channel LilKT1                             608   0.0      Lilium longiflorum [Easter lily]
gb|AIY55349.1|  potassium channel AKT1-like protein                     608   0.0      
ref|XP_008675279.1|  PREDICTED: potassium channel AKT1-like             609   0.0      
ref|XP_006841929.1|  hypothetical protein AMTR_s00042p00201380          608   0.0      
emb|CDY35373.1|  BnaA04g14740D                                          608   0.0      
gb|AAF81249.1|AF267753_1  putative potassium channel protein Mkt1p      608   0.0      Mesembryanthemum crystallinum
gb|EEE55080.1|  hypothetical protein OsJ_02815                          608   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393618.1|  PREDICTED: potassium channel AKT1-like             608   0.0      
ref|XP_009619489.1|  PREDICTED: potassium channel AKT1-like             608   0.0      
ref|XP_002458234.1|  hypothetical protein SORBIDRAFT_03g029520          607   0.0      Sorghum bicolor [broomcorn]
ref|XP_009772048.1|  PREDICTED: potassium channel AKT1                  608   0.0      
ref|XP_003549784.1|  PREDICTED: potassium channel AKT1-like             607   0.0      
ref|XP_010510883.1|  PREDICTED: potassium channel AKT1-like             605   0.0      
ref|XP_002281787.1|  PREDICTED: potassium channel AKT1-like isofo...    606   0.0      Vitis vinifera
ref|NP_001268010.1|  inward rectifying shaker-like K+ channel           607   0.0      
ref|XP_009140622.1|  PREDICTED: potassium channel AKT1                  605   0.0      
ref|NP_001055614.1|  Os05g0428700                                       593   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CBI28150.3|  unnamed protein product                                603   0.0      
ref|XP_010670702.1|  PREDICTED: potassium channel AKT1-like             604   0.0      
ref|XP_008242715.1|  PREDICTED: potassium channel AKT1                  604   0.0      
ref|XP_010049960.1|  PREDICTED: potassium channel AKT1                  603   0.0      
ref|XP_006408729.1|  hypothetical protein EUTSA_v10001904mg             603   0.0      
ref|NP_001105480.1|  potassium channel5                                 603   0.0      Zea mays [maize]
ref|XP_009348193.1|  PREDICTED: potassium channel AKT1                  603   0.0      
emb|CDY55714.1|  BnaC04g37620D                                          602   0.0      
emb|CAZ64538.1|  inward rectifying shaker-like K+ channel               602   0.0      Vitis vinifera
ref|XP_008787403.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    600   0.0      
ref|XP_003609240.1|  Potassium channel                                  599   0.0      
gb|AAL25649.1|AF197333_1  inward-rectifying K+ channel                  598   0.0      Eucalyptus camaldulensis
ref|XP_004508539.1|  PREDICTED: potassium channel AKT1-like isofo...    598   0.0      
ref|XP_006371939.1|  k transporter family protein                       598   0.0      
gb|ABE99810.1|  inwardly rectifying potassium channel AKT1              598   0.0      Hordeum vulgare [barley]
ref|XP_007204288.1|  hypothetical protein PRUPE_ppa001241mg             597   0.0      
gb|AAL25648.1|AF197332_1  inward-rectifying K+ channel                  597   0.0      Eucalyptus camaldulensis
ref|NP_001275347.1|  potassium channel AKT1-like                        597   0.0      
emb|CAN80462.1|  hypothetical protein VITISV_015412                     595   0.0      Vitis vinifera
gb|KHN15126.1|  Potassium channel AKT1                                  597   0.0      
gb|AAV59417.1|  putative potassium channel protein                      585   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008352270.1|  PREDICTED: potassium channel AKT1-like             595   0.0      
gb|AAF36832.1|AF207745_1  AKT1-like potassium channel                   596   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|NP_001291230.1|  potassium channel AKT1-like                        595   0.0      
ref|XP_003524528.2|  PREDICTED: potassium channel AKT1-like             595   0.0      
ref|XP_006451007.1|  hypothetical protein CICLE_v10007412mg             594   0.0      
ref|XP_006579054.1|  PREDICTED: potassium channel AKT1-like             593   0.0      
ref|XP_010051190.1|  PREDICTED: potassium channel AKT1-like             595   0.0      
ref|NP_001234258.1|  potassium channel                                  593   0.0      
gb|KCW81436.1|  hypothetical protein EUGRSUZ_C02815                     593   0.0      
ref|XP_010670706.1|  PREDICTED: potassium channel AKT1 isoform X2       593   0.0      
ref|XP_004508540.1|  PREDICTED: potassium channel AKT1-like isofo...    593   0.0      
gb|KHG29670.1|  Potassium channel AKT1 -like protein                    592   0.0      
sp|P0C550.1|AKT1_ORYSI  RecName: Full=Potassium channel AKT1; Sho...    594   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001043713.1|  Os01g0648000                                       594   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400651.1|  PREDICTED: potassium channel AKT1-like             592   0.0      
ref|XP_010546590.1|  PREDICTED: potassium channel AKT6                  592   0.0      
ref|XP_010925144.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    592   0.0      
ref|XP_010670705.1|  PREDICTED: potassium channel AKT1 isoform X1       592   0.0      
gb|AAL40894.1|  AKT1-like potassium channel                             591   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_011014911.1|  PREDICTED: potassium channel AKT1-like             592   0.0      
gb|ADA79674.1|  shaker-like potassium channel 1                         591   0.0      Populus euphratica
emb|CAG27094.1|  inwardly rectifying potassium channel subunit          590   0.0      Daucus carota [Queen Anne's lace]
ref|XP_006475780.1|  PREDICTED: potassium channel AKT1-like             589   0.0      
emb|CAM88967.1|  AKT2 inward rectifier channel                          592   0.0      Physcomitrella patens
ref|XP_007154951.1|  hypothetical protein PHAVU_003G160800g             588   0.0      
ref|XP_003526425.1|  PREDICTED: potassium channel AKT1-like             588   0.0      
ref|XP_003569453.1|  PREDICTED: potassium channel AKT1 isoform X1       588   0.0      
ref|XP_010533190.1|  PREDICTED: potassium channel AKT1                  588   0.0      
ref|XP_004287371.1|  PREDICTED: potassium channel AKT1-like             587   0.0      
ref|XP_010656397.1|  PREDICTED: potassium channel AKT1-like isofo...    585   0.0      
gb|KDP33617.1|  hypothetical protein JCGZ_07188                         586   0.0      
ref|XP_011085715.1|  PREDICTED: potassium channel AKT1-like isofo...    586   0.0      
gb|KHN27401.1|  Potassium channel AKT1                                  583   0.0      
gb|EYU28414.1|  hypothetical protein MIMGU_mgv1a001164mg                583   0.0      
ref|XP_011019759.1|  PREDICTED: potassium channel AKT1 isoform X2       581   0.0      
ref|XP_010474523.1|  PREDICTED: potassium channel AKT1-like             592   0.0      
ref|XP_011026492.1|  PREDICTED: potassium channel AKT1-like             581   0.0      
ref|XP_008809499.1|  PREDICTED: potassium channel AKT1-like isofo...    580   0.0      
ref|XP_011019758.1|  PREDICTED: potassium channel AKT1 isoform X1       580   0.0      
ref|XP_011077973.1|  PREDICTED: potassium channel AKT1-like             580   0.0      
ref|XP_009386140.1|  PREDICTED: potassium channel AKT1                  580   0.0      
gb|KFK32558.1|  hypothetical protein AALP_AA6G258700                    579   0.0      
ref|NP_194976.1|  putative potassium channel AKT5                       578   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFW83426.1|  hypothetical protein ZEAMMB73_660957                    579   0.0      
ref|XP_006364280.1|  PREDICTED: potassium channel AKT1-like             576   0.0      
emb|CAB64728.1|  putative potassium channel                             577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093723.1|  PREDICTED: potassium channel AKT1-like             577   0.0      
ref|XP_010423759.1|  PREDICTED: potassium channel AKT6                  576   0.0      
ref|XP_008809491.1|  PREDICTED: potassium channel AKT1-like isofo...    576   0.0      
gb|KCW82789.1|  hypothetical protein EUGRSUZ_C04163                     575   0.0      
dbj|BAE99592.1|  K+ transporter                                         571   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450501.1|  hypothetical protein CICLE_v10007406mg             573   0.0      
ref|XP_010472568.1|  PREDICTED: potassium channel AKT6-like             573   0.0      
ref|XP_010325113.1|  PREDICTED: potassium channel AKT1-like             572   0.0      
gb|ADK93728.1|  inward-rectifying potassium channel                     573   0.0      
ref|XP_008394035.1|  PREDICTED: potassium channel AKT1-like isofo...    573   0.0      
gb|EYU27297.1|  hypothetical protein MIMGU_mgv1a022010mg                573   0.0      
ref|XP_010429557.1|  PREDICTED: potassium channel AKT6                  573   0.0      
ref|XP_006483310.1|  PREDICTED: potassium channel AKT6-like             573   0.0      
gb|KHN07100.1|  Potassium channel AKT1                                  572   0.0      
ref|XP_003545498.1|  PREDICTED: potassium channel AKT1-like             571   0.0      
gb|EEC71181.1|  hypothetical protein OsI_03064                          570   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006296292.1|  hypothetical protein CARUB_v10025462mg             570   0.0      
ref|XP_006392345.1|  hypothetical protein EUTSA_v10023251mg             569   0.0      
gb|KCW79762.1|  hypothetical protein EUGRSUZ_C011051                    558   0.0      
emb|CDX75249.1|  BnaA01g04530D                                          568   0.0      
ref|XP_009125933.1|  PREDICTED: probable potassium channel AKT5         568   0.0      
gb|ACX37089.1|  potassium channel                                       567   0.0      Zygophyllum xanthoxylon
ref|XP_008392136.1|  PREDICTED: potassium channel AKT1                  568   0.0      
gb|ABR17684.1|  unknown                                                 560   0.0      Picea sitchensis
ref|NP_180131.3|  potassium channel AKT6                                567   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285898.1|  hypothetical protein CARUB_v10007410mg             566   0.0      
ref|XP_006412470.1|  hypothetical protein EUTSA_v10024374mg             566   0.0      
ref|XP_010432708.1|  PREDICTED: probable potassium channel AKT5         566   0.0      
ref|XP_004293012.1|  PREDICTED: potassium channel AKT6-like             566   0.0      
ref|XP_009117222.1|  PREDICTED: potassium channel AKT6                  565   0.0      
ref|XP_009601872.1|  PREDICTED: potassium channel AKT1-like isofo...    567   0.0      
ref|XP_008394036.1|  PREDICTED: potassium channel AKT1-like isofo...    565   0.0      
gb|KHN06658.1|  Potassium channel AKT1                                  564   0.0      
ref|XP_002514366.1|  Potassium channel AKT6, putative                   565   0.0      Ricinus communis
emb|CDY11516.1|  BnaA09g40820D                                          563   0.0      
ref|XP_004136471.1|  PREDICTED: potassium channel AKT1-like             563   0.0      
ref|XP_004162061.1|  PREDICTED: potassium channel AKT1-like             562   0.0      
emb|CDX68851.1|  BnaC01g06020D                                          560   0.0      
ref|XP_009601874.1|  PREDICTED: potassium channel AKT1-like isofo...    562   0.0      
emb|CDX76746.1|  BnaC08g33320D                                          560   0.0      
ref|XP_007225029.1|  hypothetical protein PRUPE_ppa019987mg             558   0.0      
gb|KHN32491.1|  Potassium channel AKT1                                  556   0.0      
ref|NP_001268073.1|  inward rectifying shaker-like K+ channel           553   0.0      
ref|XP_008812840.1|  PREDICTED: potassium channel KAT3-like             553   1e-180   
ref|XP_008466383.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    556   1e-180   
gb|AAL24466.1|AF359522_1  inward rectifying potassium channel           551   5e-180   Vitis vinifera
ref|XP_010447376.1|  PREDICTED: probable potassium channel AKT5         554   6e-180   
ref|XP_002308313.1|  k transporter family protein                       553   7e-180   Populus trichocarpa [western balsam poplar]
ref|XP_010670704.1|  PREDICTED: potassium channel AKT1-like             553   1e-179   
ref|XP_010919840.1|  PREDICTED: potassium channel KAT3-like             550   2e-179   
gb|AAP21250.1|  At2g26650                                               548   2e-179   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06180.1|  Potassium channel AKT1                                  553   2e-179   
ref|XP_006392335.1|  hypothetical protein EUTSA_v10023250mg             553   2e-179   
ref|XP_008362916.1|  PREDICTED: potassium channel AKT1-like             542   4e-179   
ref|XP_010538533.1|  PREDICTED: potassium channel KAT1                  548   1e-178   
ref|XP_007161234.1|  hypothetical protein PHAVU_001G053200g             550   1e-178   
ref|XP_008783946.1|  PREDICTED: potassium channel KAT3 isoform X4       546   2e-178   
gb|KDP37966.1|  hypothetical protein JCGZ_04609                         546   4e-178   
ref|XP_010915561.1|  PREDICTED: potassium channel KAT3-like             545   1e-177   
sp|Q8H569.1|AKT3_ORYSJ  RecName: Full=Potassium channel AKT3            547   9e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007213639.1|  hypothetical protein PRUPE_ppa001715mg             540   1e-175   
ref|XP_010559246.1|  PREDICTED: potassium channel KAT1                  539   2e-175   
ref|XP_009621376.1|  PREDICTED: potassium channel AKT1-like             542   3e-175   
ref|XP_008219894.1|  PREDICTED: potassium channel AKT1-like             540   7e-175   
dbj|BAD81034.1|  potassium channel NKT1                                 541   8e-175   
ref|XP_009799565.1|  PREDICTED: potassium channel AKT1-like isofo...    540   1e-174   
ref|XP_009799566.1|  PREDICTED: potassium channel AKT1-like isofo...    540   2e-174   
ref|XP_010110981.1|  Potassium channel KAT2                             536   3e-174   
ref|XP_006845349.1|  hypothetical protein AMTR_s00141p00107890          535   4e-174   
emb|CAK50799.1|  inwardly rectifying potassium channel subunit          535   4e-174   
ref|XP_011085793.1|  PREDICTED: potassium channel AKT1-like isofo...    536   5e-174   
ref|XP_011081924.1|  PREDICTED: potassium channel AKT1-like             538   7e-174   
ref|XP_004958974.1|  PREDICTED: potassium channel AKT3-like             539   8e-174   
ref|NP_001175074.1|  Os07g0175400                                       538   1e-173   
ref|XP_008225478.1|  PREDICTED: potassium channel KAT1-like             534   2e-173   
gb|EPS59603.1|  potassium channel                                       528   2e-173   
ref|XP_010279668.1|  PREDICTED: potassium channel KAT3                  533   2e-173   
ref|XP_007137051.1|  hypothetical protein PHAVU_009G095700g             536   3e-173   
ref|XP_008783944.1|  PREDICTED: potassium channel KAT3 isoform X2       534   3e-173   
ref|NP_001046422.2|  Os02g0245800                                       524   5e-173   
ref|XP_008783945.1|  PREDICTED: potassium channel KAT3 isoform X3       533   5e-173   
ref|XP_010254477.1|  PREDICTED: potassium channel AKT1-like             526   1e-172   
gb|EMT02357.1|  Potassium channel AKT1                                  536   1e-172   
ref|XP_004501299.1|  PREDICTED: potassium channel AKT1-like             535   2e-172   
ref|XP_010445001.1|  PREDICTED: probable potassium channel AKT5         533   3e-172   
gb|EEC72823.1|  hypothetical protein OsI_06546                          528   4e-172   
gb|KEH39823.1|  inwardly rectifying potassium channel subunit           532   6e-172   
sp|Q6K3T2.1|KAT1_ORYSJ  RecName: Full=Potassium channel KAT1            527   1e-171   
ref|XP_006658326.1|  PREDICTED: potassium channel AKT3-like             523   1e-171   
ref|NP_001291250.1|  uncharacterized protein LOC105118640               528   2e-171   
gb|KHG04443.1|  Potassium channel KAT1 -like protein                    527   6e-171   
emb|CBI30869.3|  unnamed protein product                                523   7e-171   
gb|KDO80355.1|  hypothetical protein CISIN_1g002763mg                   522   1e-170   
ref|XP_006647116.1|  PREDICTED: potassium channel KAT1-like             525   2e-170   
ref|XP_002519693.1|  Potassium channel KAT2, putative                   528   2e-170   
ref|XP_003530386.1|  PREDICTED: potassium channel KAT1-like             523   6e-170   
ref|XP_002453600.1|  hypothetical protein SORBIDRAFT_04g008780          523   1e-169   
gb|ACF78497.1|  unknown                                                 515   2e-169   
gb|KDO78166.1|  hypothetical protein CISIN_1g003951mg                   523   5e-169   
ref|XP_008653638.1|  PREDICTED: potassium channel AKT3-like             526   7e-169   
ref|XP_006467473.1|  PREDICTED: potassium channel KAT2-like             522   7e-169   
ref|XP_004951327.1|  PREDICTED: potassium channel KAT1-like             521   7e-169   
gb|EYU33359.1|  hypothetical protein MIMGU_mgv1a002393mg                519   8e-169   
ref|XP_008381130.1|  PREDICTED: potassium channel KAT1-like             521   9e-169   
ref|XP_004293533.1|  PREDICTED: potassium channel KAT1-like             519   2e-168   
ref|XP_006449685.1|  hypothetical protein CICLE_v10014336mg             521   3e-168   
ref|XP_010056887.1|  PREDICTED: potassium channel KAT3                  519   3e-168   
ref|XP_010230035.1|  PREDICTED: potassium channel AKT3-like             525   5e-168   
ref|XP_008645574.1|  PREDICTED: potassium channel KAT1-like             518   8e-168   
ref|NP_001284388.1|  potassium channel KAT3-like                        517   9e-168   
ref|XP_011096553.1|  PREDICTED: potassium channel KAT3-like             518   9e-168   
ref|XP_010693510.1|  PREDICTED: potassium channel KAT3-like             516   1e-167   
ref|XP_008783943.1|  PREDICTED: potassium channel KAT2 isoform X1       520   1e-167   
gb|EYU29239.1|  hypothetical protein MIMGU_mgv1a001125mg                522   1e-167   
ref|XP_007013809.1|  Shaker pollen inward K+ channel isoform 1          523   2e-167   
ref|XP_010688091.1|  PREDICTED: potassium channel AKT1-like             523   2e-167   
ref|XP_004498651.1|  PREDICTED: potassium channel AKT1-like isofo...    522   2e-167   
ref|XP_004498652.1|  PREDICTED: potassium channel AKT1-like isofo...    522   2e-167   
ref|NP_001275475.1|  uncharacterized protein LOC102583546               515   3e-167   
ref|XP_003603438.1|  Potassium channel                                  521   3e-167   
ref|XP_010047933.1|  PREDICTED: potassium channel AKT1-like isofo...    508   4e-167   
ref|XP_010047780.1|  PREDICTED: potassium channel AKT1-like isofo...    508   4e-167   
ref|XP_004233118.1|  PREDICTED: potassium channel KAT1-like             514   4e-167   
ref|XP_009602723.1|  PREDICTED: potassium channel KAT3-like isofo...    514   5e-167   
ref|XP_009602722.1|  PREDICTED: potassium channel KAT3-like isofo...    514   5e-167   
ref|NP_001289500.1|  potassium channel KAT3-like                        513   1e-166   
ref|XP_007025090.1|  Potassium channel in 2                             518   1e-166   
ref|NP_001105240.1|  potassium channel3                                 514   2e-166   
ref|XP_010274957.1|  PREDICTED: potassium channel KAT3-like isofo...    516   2e-166   
ref|XP_009804747.1|  PREDICTED: potassium channel KAT3-like isofo...    511   5e-166   
ref|XP_009804745.1|  PREDICTED: potassium channel KAT3-like isofo...    511   6e-166   
ref|XP_009381861.1|  PREDICTED: potassium channel KAT3-like             513   9e-166   
ref|XP_009360884.1|  PREDICTED: potassium channel KAT1-like             514   1e-165   
ref|XP_002459406.1|  hypothetical protein SORBIDRAFT_02g004160          518   1e-165   
ref|XP_011013837.1|  PREDICTED: potassium channel AKT1-like isofo...    507   2e-165   
ref|XP_011013838.1|  PREDICTED: potassium channel AKT1-like isofo...    507   2e-165   
emb|CAD18901.1|  inwardly rectifying potassium channel                  511   4e-165   
ref|XP_002305337.2|  K+ channel family protein                          508   6e-165   
gb|AFW65933.1|  potassium channel3                                      511   6e-165   
ref|XP_009114367.1|  PREDICTED: potassium channel KAT1                  508   7e-165   
ref|XP_009408890.1|  PREDICTED: potassium channel KAT3-like isofo...    511   7e-165   
gb|EYU21946.1|  hypothetical protein MIMGU_mgv1a001079mg                514   2e-164   
emb|CDY35154.1|  BnaA09g17910D                                          506   2e-164   
emb|CDY03233.1|  BnaC09g19230D                                          505   5e-164   
ref|XP_006281669.1|  hypothetical protein CARUB_v10027805mg             504   1e-163   
ref|XP_006414124.1|  hypothetical protein EUTSA_v10024618mg             504   1e-163   
emb|CAA12645.1|  inward potassium channel alpha subunit                 508   2e-163   
ref|XP_008677784.1|  PREDICTED: potassium channel3 isoform X1           508   2e-163   
ref|XP_010665823.1|  PREDICTED: potassium channel KAT3-like isofo...    506   2e-163   
ref|XP_003593936.1|  Potassium channel                                  508   2e-163   
ref|XP_009396648.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    499   2e-163   
emb|CAC87141.1|  K+ channel protein                                     507   3e-163   
gb|AES64187.2|  inwardly rectifying potassium channel subunit           508   3e-163   
ref|XP_009601876.1|  PREDICTED: potassium channel AKT1-like isofo...    510   5e-163   
ref|XP_004486026.1|  PREDICTED: potassium channel KAT1-like isofo...    507   7e-163   
ref|XP_009416516.1|  PREDICTED: potassium channel KAT1-like             496   9e-163   
gb|KFK31483.1|  hypothetical protein AALP_AA6G118100                    502   9e-163   
ref|XP_004486027.1|  PREDICTED: potassium channel KAT1-like isofo...    506   1e-162   
ref|XP_009101530.1|  PREDICTED: potassium channel KAT1-like             503   1e-162   
gb|AAX19659.1|  inward rectifying potassium channel                     503   1e-162   
emb|CDX78839.1|  BnaA01g09060D                                          503   2e-162   
ref|XP_009131562.1|  PREDICTED: potassium channel KAT2-like             502   2e-162   
emb|CDX99479.1|  BnaC01g10730D                                          502   2e-162   
dbj|BAJ84904.1|  predicted protein                                      503   3e-162   
ref|XP_002863415.1|  hypothetical protein ARALYDRAFT_494350             501   3e-162   
ref|XP_010481478.1|  PREDICTED: potassium channel KAT1-like             501   5e-162   
ref|XP_008349191.1|  PREDICTED: potassium channel KAT1-like             497   6e-162   
ref|XP_009406249.1|  PREDICTED: potassium channel KAT3-like isofo...    504   6e-162   
ref|XP_009406247.1|  PREDICTED: potassium channel KAT3-like isofo...    504   7e-162   
ref|XP_010681787.1|  PREDICTED: potassium channel AKT2/3 isoform X4     501   1e-161   
ref|XP_010496011.1|  PREDICTED: potassium channel KAT1                  500   1e-161   
ref|XP_010232087.1|  PREDICTED: potassium channel AKT1 isoform X2       499   1e-161   
ref|XP_004511133.1|  PREDICTED: potassium channel KAT1-like             500   2e-161   
ref|XP_003541662.1|  PREDICTED: potassium channel KAT2-like             503   3e-161   
gb|KHN47317.1|  Potassium channel KAT2                                  502   3e-161   
ref|XP_010441608.1|  PREDICTED: potassium channel KAT1-like             498   8e-161   
ref|XP_006398319.1|  hypothetical protein EUTSA_v10000798mg             499   1e-160   
gb|EMS47074.1|  Potassium channel KAT1                                  503   1e-160   
ref|XP_009403508.1|  PREDICTED: potassium channel KAT3                  499   3e-160   
ref|NP_199436.1|  potassium channel KAT1                                496   4e-160   
emb|CAA63601.1|  K+ channel                                             496   6e-160   
gb|KHN33141.1|  Potassium channel KAT1                                  499   8e-160   
ref|XP_006597528.1|  PREDICTED: potassium channel KAT1-like             498   9e-160   
ref|XP_010234093.1|  PREDICTED: potassium channel KAT1-like             487   1e-159   
ref|XP_007147900.1|  hypothetical protein PHAVU_006G164300g             497   2e-159   
tpg|DAA59730.1|  TPA: hypothetical protein ZEAMMB73_881022              501   4e-159   
ref|XP_004244802.1|  PREDICTED: potassium channel KAT3                  493   5e-159   
ref|XP_008464999.1|  PREDICTED: potassium channel AKT1 isoform X2       494   5e-159   
emb|CAM88966.1|  AKT1 inward rectifier channel                          501   1e-158   
ref|XP_006356880.1|  PREDICTED: potassium channel KAT1-like             491   5e-158   
gb|EEE66660.1|  hypothetical protein OsJ_23288                          496   8e-158   
ref|XP_009389833.1|  PREDICTED: potassium channel KAT3-like             486   1e-157   
ref|XP_011085251.1|  PREDICTED: potassium channel KAT1-like             491   3e-157   
ref|XP_004486028.1|  PREDICTED: potassium channel KAT1-like isofo...    490   3e-157   
gb|EAZ02946.1|  hypothetical protein OsI_25085                          495   4e-157   
ref|XP_010517557.1|  PREDICTED: potassium channel KAT2-like             488   5e-157   
ref|XP_009406245.1|  PREDICTED: potassium channel KAT3-like isofo...    492   5e-157   
ref|XP_011019760.1|  PREDICTED: potassium channel AKT6 isoform X3       492   6e-157   
ref|XP_009760491.1|  PREDICTED: potassium channel KAT3-like isofo...    489   8e-157   
ref|XP_009760492.1|  PREDICTED: potassium channel KAT3-like isofo...    488   1e-156   
ref|XP_009616640.1|  PREDICTED: potassium channel KAT3 isoform X1       488   1e-156   
ref|XP_002870057.1|  hypothetical protein ARALYDRAFT_329707             487   3e-156   
ref|XP_010439874.1|  PREDICTED: potassium channel KAT2-like             486   5e-156   
ref|XP_006283236.1|  hypothetical protein CARUB_v10004269mg             485   1e-155   
emb|CAC28122.1|  inward rectifying K+ channel                           485   2e-155   
ref|NP_193563.3|  potassium channel KAT2                                484   2e-155   
gb|EMT23215.1|  Potassium channel KAT1                                  486   4e-155   
ref|XP_009601877.1|  PREDICTED: potassium channel AKT1-like isofo...    486   6e-155   
gb|EEC71508.1|  hypothetical protein OsI_03790                          475   1e-154   
ref|NP_001044290.1|  Os01g0756700                                       475   2e-154   
ref|XP_010540570.1|  PREDICTED: potassium channel KAT2-like isofo...    475   5e-154   
ref|XP_010540571.1|  PREDICTED: potassium channel KAT2-like isofo...    474   6e-154   
ref|XP_004147434.1|  PREDICTED: potassium channel KAT1-like             471   1e-153   
ref|XP_008348556.1|  PREDICTED: potassium channel KAT1-like isofo...    472   1e-153   
ref|XP_010665824.1|  PREDICTED: potassium channel KAT3-like isofo...    479   1e-153   
ref|XP_002456376.1|  hypothetical protein SORBIDRAFT_03g034980          473   2e-153   
gb|KEH19291.1|  inwardly rectifying potassium channel subunit           479   2e-153   
ref|XP_004968605.1|  PREDICTED: potassium channel KAT2-like             472   2e-153   
tpg|DAA52881.1|  TPA: potassium channel4                                479   3e-153   
ref|XP_004970003.1|  PREDICTED: potassium channel KAT3-like isofo...    472   3e-153   
ref|XP_010540568.1|  PREDICTED: potassium channel KAT3-like isofo...    477   3e-153   
ref|XP_010540569.1|  PREDICTED: potassium channel KAT3-like isofo...    477   3e-153   
ref|XP_010434553.1|  PREDICTED: potassium channel KAT2                  478   5e-153   
emb|CDM82256.1|  unnamed protein product                                474   9e-153   
emb|CDM84232.1|  unnamed protein product                                470   1e-152   
ref|XP_010230608.1|  PREDICTED: potassium channel KAT2-like isofo...    476   5e-152   
ref|NP_001105161.1|  potassium channel4                                 476   7e-152   
ref|XP_008348557.1|  PREDICTED: potassium channel KAT1-like isofo...    465   1e-151   
gb|AAX15943.1|  KZM2                                                    475   1e-151   
gb|EYU43265.1|  hypothetical protein MIMGU_mgv1a002597mg                473   2e-151   
ref|XP_009616641.1|  PREDICTED: potassium channel KAT3 isoform X2       474   2e-151   
ref|XP_006644729.1|  PREDICTED: potassium channel KAT3-like             466   3e-151   
gb|KHG28816.1|  Potassium channel AKT1 -like protein                    475   7e-151   
ref|XP_003569842.1|  PREDICTED: potassium channel KAT3-like             465   1e-150   
emb|CDY33464.1|  BnaA06g36090D                                          470   4e-150   
emb|CDY62359.1|  BnaCnng40090D                                          469   5e-150   
ref|XP_004970004.1|  PREDICTED: potassium channel KAT3-like isofo...    462   1e-149   
ref|XP_008809507.1|  PREDICTED: potassium channel AKT1-like isofo...    471   1e-149   
emb|CDP03402.1|  unnamed protein product                                459   6e-149   
gb|AHM23834.1|  putative KAT2                                           464   7e-149   
sp|Q5QNI1.2|KAT2_ORYSJ  RecName: Full=Potassium channel KAT2            464   8e-149   
gb|EEC70154.1|  hypothetical protein OsI_00861                          463   1e-148   
gb|KHG16749.1|  Potassium channel AKT1 -like protein                    470   3e-148   
ref|XP_008657217.1|  PREDICTED: potassium channel KAT3-like             459   5e-148   
ref|XP_003638588.1|  Inward rectifying potassium channel                462   3e-147   
emb|CDX76529.1|  BnaA08g08710D                                          461   3e-146   
ref|XP_010925255.1|  PREDICTED: potassium channel AKT1-like isofo...    462   3e-146   
gb|EMT29322.1|  Potassium channel KAT1                                  451   7e-146   
ref|XP_002324845.2|  hypothetical protein POPTR_0018s01360g             458   6e-145   
gb|AFW85053.1|  putative protein kinase superfamily protein             458   1e-144   
ref|XP_009108358.1|  PREDICTED: potassium channel KAT2-like             457   2e-144   
ref|XP_002309603.2|  hypothetical protein POPTR_0006s26600g             453   2e-143   
ref|XP_006363595.1|  PREDICTED: potassium channel AKT1-like             447   3e-142   
dbj|BAD81035.1|  potassium channel NtKC1                                445   6e-141   
ref|XP_010681786.1|  PREDICTED: potassium channel AKT2/3 isoform X3     446   5e-140   
ref|XP_010419342.1|  PREDICTED: potassium channel AKT6-like             448   7e-140   
ref|XP_009348440.1|  PREDICTED: potassium channel KAT3-like             440   2e-139   
ref|XP_009406246.1|  PREDICTED: potassium channel KAT2-like isofo...    444   9e-139   
ref|XP_004136462.1|  PREDICTED: potassium channel KAT3-like             438   1e-138   
ref|XP_004162067.1|  PREDICTED: potassium channel KAT3-like             439   2e-138   
ref|XP_008466351.1|  PREDICTED: potassium channel KAT3                  438   2e-138   
ref|XP_004291407.1|  PREDICTED: potassium channel KAT3-like             438   2e-138   
ref|XP_011081850.1|  PREDICTED: potassium channel KAT3                  437   4e-138   
gb|ACJ05642.2|  potassium channel protein NKT5                          437   6e-138   
ref|XP_008393996.1|  PREDICTED: potassium channel KAT3                  436   9e-138   
ref|XP_010249790.1|  PREDICTED: potassium channel KAT3                  436   2e-137   
ref|XP_009801141.1|  PREDICTED: potassium channel KAT3-like isofo...    435   3e-137   
ref|XP_009377371.1|  PREDICTED: potassium channel KAT3-like             434   3e-137   
ref|XP_009801142.1|  PREDICTED: potassium channel KAT3-like isofo...    434   4e-137   
ref|XP_009801140.1|  PREDICTED: potassium channel KAT3-like isofo...    435   4e-137   
gb|EAZ13588.1|  hypothetical protein OsJ_03504                          428   6e-137   
emb|CDP18439.1|  unnamed protein product                                434   7e-137   
ref|XP_006356660.1|  PREDICTED: potassium channel KAT3-like             433   1e-136   
ref|XP_009801143.1|  PREDICTED: potassium channel KAT3-like isofo...    430   1e-136   
ref|XP_002516596.1|  Potassium channel KAT3, putative                   433   2e-136   
ref|XP_010254155.1|  PREDICTED: potassium channel KAT3-like isofo...    432   3e-136   
ref|XP_010095492.1|  Potassium channel KAT3                             431   1e-135   
ref|XP_009609170.1|  PREDICTED: potassium channel KAT3-like isofo...    429   9e-135   
ref|XP_009609168.1|  PREDICTED: potassium channel KAT3-like isofo...    429   1e-134   
ref|XP_010325274.1|  PREDICTED: potassium channel KAT3                  428   1e-134   
gb|KGN65561.1|  hypothetical protein Csa_1G448920                       427   1e-134   
ref|XP_009601875.1|  PREDICTED: potassium channel AKT1-like isofo...    434   4e-134   
gb|KDO79683.1|  hypothetical protein CISIN_1g006769mg                   423   1e-133   
emb|CDP19258.1|  unnamed protein product                                429   1e-133   



>ref|XP_009614130.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=824

 Score =  1216 bits (3146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/793 (75%), Positives = 687/793 (87%), Gaps = 6/793 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             ++ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  29    DELSFRNLSKLILPPLGSNDYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSAWVCPF  88

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY+STWF
Sbjct  89    EIAFMHSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLVRDRRRIATRYISTWF  148

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A +FTGKH +G+ YSVLGMLRFWRLRRV  FFTRLEKD+RFSYFWVR
Sbjct  149   MMDVASTIPFDLLALIFTGKHQIGISYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTLL VHCAGCLYY LADRYPHQG  WLG++N   +E SL IRYI+A+YWS+TT
Sbjct  209   CARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWLGAMNPNYKETSLLIRYIAALYWSITT  268

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  269   MTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  328

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RN LP RLKEQILAYMCLRF+AESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  329   NFVCRNRLPPRLKEQILAYMCLRFRAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  388

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSREILLLLVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMI+ EMENEQVVWT
Sbjct  389   FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIECEMENEQVVWT  448

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGDM GEVGA CCRPQS+TYRTKTLSQLLK++TTSL+EA++ ++EDNI MIKNFLQHH
Sbjct  449   FKSGDMLGEVGAFCCRPQSYTYRTKTLSQLLKIRTTSLIEAMKTRQEDNIIMIKNFLQHH  508

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKL+DLKLGDLF E+G E+GDPNMS+NL TV +TGNATFL ELLKA LDP+IGD++G+TP
Sbjct  509   KKLRDLKLGDLFHEVGAENGDPNMSVNLLTVASTGNATFLEELLKARLDPDIGDAQGRTP  568

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNIHL+D+ GNTALW+AIA K+H  F ILYHWAS+SDPYV
Sbjct  569   LHIAASKGHEECVMVLLRHGCNIHLRDVNGNTALWEAIAEKQHPTFRILYHWASVSDPYV  628

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AG+LLC AAK ND +VM+ELLKHGL VDSKDRHGSTAI  A+EEN  DM+KLL+MNGAEI
Sbjct  629   AGELLCTAAKRNDLTVMKELLKHGLIVDSKDRHGSTAIHVALEENHEDMVKLLLMNGAEI  688

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRV  366
             +D  K  L+ ++L+E+LQKRE+GHR+ + +T + E A KW + + + NS S   Q S RV
Sbjct  689   NDKFKHKLSSMNLSEMLQKREVGHRVIVSDT-MDEVAQKWREQEQKYNSGSTRDQSSFRV  747

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIY+GHP  R+ T C EPG+LI LP ++AEL  IAG+K GFDAT++ +TD+EG+ IDSI+
Sbjct  748   SIYKGHPVIRKRTHCSEPGKLIILPNSLAELKIIAGQKFGFDATNALVTDQEGSEIDSIE  807

Query  185   VIRDNDKLFIVAD  147
             VIRDNDKLFIV D
Sbjct  808   VIRDNDKLFIVED  820



>dbj|BAD81033.1| potassium channel NKT2 [Nicotiana tabacum]
Length=824

 Score =  1211 bits (3133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/793 (75%), Positives = 683/793 (86%), Gaps = 6/793 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             ++     LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  29    DELGFRNLSKLILPPLGSNDYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSAWVCPF  88

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY STWF
Sbjct  89    EIAFMRSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLVRGRRRIATRYTSTWF  148

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVAST+PF+ +A +FTGKH +G+ YSVLGMLRFWRLRRV  FFTRLEKD+RFSYFWVR
Sbjct  149   MMDVASTVPFDLLALIFTGKHQIGISYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTLL VHCAGCLYY LADRYPHQG  WLG++N   +E SL IRYI+A+YWS+TT
Sbjct  209   CARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWLGAMNPNYKETSLLIRYIAALYWSITT  268

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  269   MTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  328

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RN LP RLKEQILAYMCLRF+AESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  329   NFVCRNRLPPRLKEQILAYMCLRFRAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  388

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSREILLLLVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMI+ EMENEQVVWT
Sbjct  389   FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIECEMENEQVVWT  448

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGDM GEVGA CCRPQS+TYRTKTLSQLLK++ TSL+EA++ ++EDNI MIKNFLQHH
Sbjct  449   FKSGDMLGEVGAFCCRPQSYTYRTKTLSQLLKIRATSLIEAMKTRQEDNIIMIKNFLQHH  508

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKL+DLKLGDLF E+G E+GDPNMS+NL TV +TGNATFL ELLKA LDP+IGD++G+TP
Sbjct  509   KKLRDLKLGDLFHEVGAENGDPNMSVNLLTVASTGNATFLEELLKARLDPDIGDAQGRTP  568

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNIHL+D+ GNTALW+AIA K+H  F ILYHWAS+SDPYV
Sbjct  569   LHIAASKGHEECVMVLLRHGCNIHLRDVNGNTALWEAIAEKQHPTFRILYHWASVSDPYV  628

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AG+LLC AAK ND +VM+ELLKHGL VDSKDRHGSTAI  A+EEN  DM+KLL+MNGAEI
Sbjct  629   AGELLCTAAKRNDLTVMKELLKHGLIVDSKDRHGSTAIHVALEENHEDMVKLLLMNGAEI  688

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRV  366
             +D  K  L+ ++L+E+LQKRE+GHR+ + +T + E A KW + + + NS +   Q S RV
Sbjct  689   NDKFKHKLSSMNLSEMLQKREVGHRVIVSDT-MDEVAQKWREQEQKYNSGNTRDQSSFRV  747

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIY+GHP  R+ T C EPG+LI LP ++AEL  IAG+K GFDAT++  TD+EG+ IDSI+
Sbjct  748   SIYKGHPVIRKRTHCSEPGKLIILPNSLAELKIIAGQKFGFDATNALATDQEGSEIDSIE  807

Query  185   VIRDNDKLFIVAD  147
             VIRDNDKLFIV D
Sbjct  808   VIRDNDKLFIVED  820



>dbj|BAA84085.1| potassium channel [Nicotiana paniculata]
Length=824

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/793 (75%), Positives = 685/793 (86%), Gaps = 6/793 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             E+ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYS WVCPF
Sbjct  29    EELSFRNLSKLILPPLGSNGYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSVWVCPF  88

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+ S  +  LY+ DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY+STWF
Sbjct  89    EIAFMHSNPNRALYLADNVVDLFFAVDIILTFFVAYIDTTTQLLVRDRRRIATRYISTWF  148

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FFTRLEKD+RFSYFWVR
Sbjct  149   MMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTLL VHCAGCLYY LADRYPHQG  WLG++N   +E SL IRYI+A+YWS+TT
Sbjct  209   CARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWLGAMNPNYKETSLLIRYIAALYWSITT  268

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  269   MTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  328

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RN LP RLKEQILAYMCLRF+AESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  329   NFVCRNRLPPRLKEQILAYMCLRFRAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  388

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSREILLLLVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMI+ EMENEQV WT
Sbjct  389   FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIECEMENEQVCWT  448

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGDM GEVGA CCRPQS+TYRTKTLSQLLK++TTSL+EA++ ++EDN+ MIKNFLQHH
Sbjct  449   FKSGDMLGEVGAFCCRPQSYTYRTKTLSQLLKIRTTSLIEAMKTRQEDNLIMIKNFLQHH  508

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKL+DLKLGDLF E+  E+GDPNMS+NL TV +TGNA FL ELLKA LDP+IGD++G+TP
Sbjct  509   KKLRDLKLGDLFHEVRAENGDPNMSVNLLTVASTGNAAFLEELLKARLDPDIGDAQGRTP  568

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNIHL+D+ GNTALW+AIAAK+H  F ILYHWAS+SDPYV
Sbjct  569   LHIAASKGHEECVMVLLRHGCNIHLRDVNGNTALWEAIAAKQHPTFQILYHWASVSDPYV  628

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AG+LLC AAK N+ +VM+ELLKHGL VDS DRHGSTAI  A+EEN  DM+KLL+MNGAEI
Sbjct  629   AGELLCTAAKRNELTVMKELLKHGLIVDSIDRHGSTAIHVALEENHEDMVKLLLMNGAEI  688

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRV  366
             +D  K  L+ ++L+E+LQKRE+GHR+ +P+T + E A KW + + + NS S   Q S RV
Sbjct  689   NDKFKHKLSSMNLSEMLQKREVGHRVIVPDT-MDEVAQKWREQEQKYNSGSTRDQSSFRV  747

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIY+GHP  R+ T C EPG+LI LP ++AEL  IAG+K GFDAT++ +TD+EG+ IDSI+
Sbjct  748   SIYKGHPVIRKRTHCSEPGKLIILPNSLAELKIIAGQKFGFDATNALVTDQEGSEIDSIE  807

Query  185   VIRDNDKLFIVAD  147
             VIRDNDKLFIV D
Sbjct  808   VIRDNDKLFIVED  820



>ref|XP_009791067.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=837

 Score =  1209 bits (3127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/795 (75%), Positives = 685/795 (86%), Gaps = 6/795 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             ++ S   LSK ILPPLGS+      T  +G  I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  42    DELSFRNLSKLILPPLGSNGYNQNQTQQKGKTITPMDSRYRCWETLMVIMVAYSAWVCPF  101

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+ S  +  LY+ DN+VDLFFA+DI+LTFFVAYID TTQLL+  RK+IATRY+STWF
Sbjct  102   EIAFMHSNPNRVLYIADNVVDLFFAIDIILTFFVAYIDTTTQLLVGDRKRIATRYISTWF  161

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FFTRLEKD+RFSYFWVR
Sbjct  162   MMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  221

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTLL VHCAGCLYY LADRYPHQG  WLG++N   +E SL IRYI+A+YWS+TT
Sbjct  222   CARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWLGAMNPNYKETSLLIRYIAALYWSITT  281

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  282   MTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  341

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RN LP RLKEQILAYMCLRF+AESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  342   NFVCRNRLPPRLKEQILAYMCLRFRAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  401

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSREILLLLVAD KAEYIPPREDVIMQNESPD+VYIIVSGEVEMI++EMENEQVVWT
Sbjct  402   FKGVSREILLLLVADTKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIESEMENEQVVWT  461

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGDM GEVGA C RPQS+TYRTKTLSQLLK++TTSL+EA++ ++EDNI MIKNFLQHH
Sbjct  462   FKSGDMLGEVGAFCRRPQSYTYRTKTLSQLLKIRTTSLIEAMKTRQEDNIIMIKNFLQHH  521

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKL+DLKLGDLF  +G+E+GDPNMS+NL TV +TGNATFL ELLKA  DP+IGD++G+TP
Sbjct  522   KKLRDLKLGDLFHAVGEENGDPNMSVNLLTVASTGNATFLEELLKARFDPDIGDAQGRTP  581

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNI+L D+ GNTALW+AIAAK+HS F ILYHWAS+SDPYV
Sbjct  582   LHIAASKGHEECVMVLLRHGCNIYLPDVNGNTALWEAIAAKQHSTFRILYHWASVSDPYV  641

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AG+LLC AAK ND +VM+ELLKHGL VDSKDRHGSTAI  A+ EN  DM+KLL+MNGAEI
Sbjct  642   AGELLCTAAKRNDITVMKELLKHGLTVDSKDRHGSTAIDVALGENHEDMVKLLLMNGAEI  701

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRV  366
             +D  K  L+ ++L E+LQKRE+GHR+ +P+T + E A KW + + + NS S   Q S RV
Sbjct  702   NDKFKHKLSSMNLREILQKREVGHRVIVPDT-MDEVAQKWREQEQKYNSGSTRDQSSFRV  760

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIY+GHP  R+ T C EPG+LI LP ++AEL  IAG+K GFDAT + +TD+EG+ IDSI+
Sbjct  761   SIYKGHPVIRKRTHCCEPGKLIMLPNSLAELKIIAGQKFGFDATKALVTDQEGSEIDSIE  820

Query  185   VIRDNDKLFIVADWN  141
             VIRDNDKL+IV D N
Sbjct  821   VIRDNDKLYIVEDPN  835



>ref|XP_009795716.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=864

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/795 (76%), Positives = 682/795 (86%), Gaps = 6/795 (1%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             + S   LSK ILPPLGSS      T  +G  ISPM SRYR WET MVLLVAY AWVCPFE
Sbjct  69    NLSFYNLSKLILPPLGSSGYNQNQTLQKGNTISPMTSRYRWWETVMVLLVAYCAWVCPFE  128

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             I+F++S  +  LY+ DNIV+LFFA DI+LTFFVAYIDPTTQLL+   +KIA RYLSTWFL
Sbjct  129   IAFMKSNTNKILYIADNIVNLFFAADIILTFFVAYIDPTTQLLVRDPRKIAIRYLSTWFL  188

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPFE ++ LFTGKH +GV YSVLGMLRFWRLR+V  FFTRLEKD+RFSYFWVRC
Sbjct  189   MDVASTIPFEALSLLFTGKHQIGVSYSVLGMLRFWRLRKVKQFFTRLEKDMRFSYFWVRC  248

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARLLFVTL  VHCAGCLYY LADR PHQG  WLGS+N   RE SL IRYISAMYWS+TTM
Sbjct  249   ARLLFVTLFSVHCAGCLYYLLADRNPHQGNTWLGSVNPNFRETSLWIRYISAMYWSITTM  308

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ+ASN
Sbjct  309   TTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQSASN  368

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLKEQILAYMCLRFKAESLNQQ LIEQLPKTICKSI HHLFLP VEKVYLF
Sbjct  369   FVCRNRLPPRLKEQILAYMCLRFKAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYLF  428

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSREILL LVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMID+EM+NEQVVWTL
Sbjct  429   KGVSREILLHLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIDSEMKNEQVVWTL  488

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              SGDM GEVGA CCRPQS+TYRT+TLSQLLK++TT L+EA++ ++EDN+TM+KNFLQHHK
Sbjct  489   KSGDMLGEVGAFCCRPQSYTYRTRTLSQLLKIRTTCLIEAMKSRQEDNVTMMKNFLQHHK  548

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             KLKDL+L DLF+E+G+ED DPNMSINL TV +TGNA FL+ELLKA LDP+IGDSKG+TPL
Sbjct  549   KLKDLRLVDLFLEVGEEDSDPNMSINLLTVASTGNAAFLDELLKARLDPDIGDSKGRTPL  608

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKGHEECVMVLL+HGCNIHL+D+ GNTALW+AIAAK H IF ILYHWASI+DPYVA
Sbjct  609   HIAASKGHEECVMVLLRHGCNIHLQDVNGNTALWEAIAAKHHPIFEILYHWASIADPYVA  668

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GDLLC AA+ ND ++M+ELLKHGL VDSKDRHGST I+ A+EEN  +M+KLL++NGAEID
Sbjct  669   GDLLCTAARKNDLTIMKELLKHGLLVDSKDRHGSTPIRVAIEENHVEMVKLLLINGAEID  728

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSS-SMPQQCSIRVS  363
             D +K  L+ ++LTE+LQKRE+GHRI + +    +   KW + + + +S S   QCS RVS
Sbjct  729   DILKYKLSSMNLTEMLQKREVGHRIIVSDAT-DDFDRKWCEQEQKYASESCKDQCSFRVS  787

Query  362   IYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             IYRGHP  RR T C EPG+LI+LP ++ EL + AG+K+G DA D+ +TDE+GA IDSI+V
Sbjct  788   IYRGHPEVRRRTHCSEPGKLIRLPNSLEELKNTAGQKIGCDAKDAVVTDEQGAEIDSIEV  847

Query  182   IRDNDKLFIVADWNS  138
             IRDNDKLFIV D NS
Sbjct  848   IRDNDKLFIVEDINS  862



>ref|XP_004230485.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=837

 Score =  1203 bits (3113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/821 (72%), Positives = 691/821 (84%), Gaps = 14/821 (2%)
 Frame = -2

Query  2588  YVAQAPNSMMNKDTAAssssssSQEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVIS  2415
             +V Q  NS  + ++A           +D S   LSK ILPPLGS  S    T  +G +I+
Sbjct  24    HVVQDDNSHGSSNSAT--------PSDDLSFRNLSKLILPPLGSNDSNTNQTHEKGFIIT  75

Query  2414  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  2235
             PMDSRYRCWE+ MV++VAYSAWVCPFEI+F+ S  +T LY+ DN+VD+FFA DI LTFFV
Sbjct  76    PMDSRYRCWESLMVIMVAYSAWVCPFEIAFMHSNPNTALYITDNVVDIFFAADIFLTFFV  135

Query  2234  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  2055
             AYID TTQLL+  R+KIA RYLSTWF+MDVASTIPF+ +A L TGKH +GV YSVLGMLR
Sbjct  136   AYIDATTQLLVRDRRKIAIRYLSTWFIMDVASTIPFDLLALLLTGKHQVGVSYSVLGMLR  195

Query  2054  FWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWL  1875
             FWRLRRV  FFTRLEKD+RFSYFWVRCARLLFVTLL VHCAGCLYY LADRYPHQG  WL
Sbjct  196   FWRLRRVKQFFTRLEKDMRFSYFWVRCARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWL  255

Query  1874  GSLN--VREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYI  1701
             G++N   +E SL IRYI+A+YWS+TTMTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYI
Sbjct  256   GAMNPNYKETSLVIRYIAALYWSITTMTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYI  315

Query  1700  IGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPL  1521
             IGNMTNLVVEGTRRTMEFRNSI+AASNFV RNHLP RLK+QILAYMCLRF+AESLNQQ L
Sbjct  316   IGNMTNLVVEGTRRTMEFRNSIEAASNFVCRNHLPPRLKDQILAYMCLRFRAESLNQQEL  375

Query  1520  IEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESP  1341
             IEQLPKTICKSI HHLFLP VEKVYLFKGV++EILLLLVADMKAEYIPPREDVIMQNESP
Sbjct  376   IEQLPKTICKSIRHHLFLPTVEKVYLFKGVTKEILLLLVADMKAEYIPPREDVIMQNESP  435

Query  1340  DDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklk  1161
             D++YIIVSGEVEMI++EMENE  VWT  SGDM GEVGALCCRPQS+TYRTKTLSQLLK++
Sbjct  436   DELYIIVSGEVEMIESEMENEPTVWTFKSGDMIGEVGALCCRPQSYTYRTKTLSQLLKIR  495

Query  1160  ttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT  981
             T++L+EA++ ++EDNI MIKNFLQHHKKLK L+LGDL   +G + GDPNM +NL TV +T
Sbjct  496   TSNLIEAMKTRQEDNIIMIKNFLQHHKKLKGLRLGDLLHGVGGDYGDPNMYVNLLTVAST  555

Query  980   GNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTAL  801
             GNATFL ELLKA LDP+IGD++G+TPLHIAASKGHEECVMVLL+HGCNI+L+D+ G+TAL
Sbjct  556   GNATFLEELLKAKLDPDIGDAQGRTPLHIAASKGHEECVMVLLRHGCNINLRDVNGHTAL  615

Query  800   WDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHG  621
             W+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHGL VDSKDR G
Sbjct  616   WEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHGLQVDSKDRDG  675

Query  620   STAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILH  441
             STAI  A+EEN  DM+KLL+MNGAEI+D +K  L+ ++L ++LQKRE+GHRI + +T + 
Sbjct  676   STAIHVALEENLEDMVKLLLMNGAEINDKLKYKLSSMNLNDMLQKREVGHRIMVSDT-MD  734

Query  440   EAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISI  264
             E A KW + + Q NS S   Q S RVSIYRGHP  RR T C EPG+LI LP ++AEL  I
Sbjct  735   EVAQKWRQQEKQHNSESTRDQMSFRVSIYRGHPVIRRRTHCSEPGKLITLPNSLAELKII  794

Query  263   AGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  141
             AG+K GFDAT++S+TD+EG+ IDSI+VIRDNDKLFIV   N
Sbjct  795   AGQKFGFDATNASITDQEGSEIDSIEVIRDNDKLFIVEGPN  835



>ref|XP_009616703.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=847

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/794 (75%), Positives = 673/794 (85%), Gaps = 4/794 (1%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             + S   LSK ILPPLGSS      T  +G  ISPM SRYR WET MVLLVAY AWVCPFE
Sbjct  52    NLSFYNLSKLILPPLGSSGYNQNQTLQKGNTISPMTSRYRWWETLMVLLVAYCAWVCPFE  111

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++F++S  + +LY+ DNIV+LFFA DI+LTFFVAYIDPTTQLL+   +KIATRYLSTWFL
Sbjct  112   VAFMKSNTNKELYIADNIVNLFFAADIILTFFVAYIDPTTQLLVRDPRKIATRYLSTWFL  171

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPFE ++ LF+GKH +GV YSVLGMLRFWRLR+V  FFTRLEKD+RFSYFWVRC
Sbjct  172   MDVASTIPFETLSLLFSGKHQIGVSYSVLGMLRFWRLRKVKQFFTRLEKDMRFSYFWVRC  231

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARLLFVTL  VHCAGCLYY LADR PH+G  WLGS+N   RE SL IRYISAMYWS+TTM
Sbjct  232   ARLLFVTLFSVHCAGCLYYLLADRNPHKGNTWLGSVNPNFRETSLWIRYISAMYWSITTM  291

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ+ASN
Sbjct  292   TTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQSASN  351

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLKEQILAYMCLRFKAESLNQQ LIEQLPKTICKSI HHLFLP VEKVYLF
Sbjct  352   FVCRNRLPPRLKEQILAYMCLRFKAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYLF  411

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSREILL LVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMID+EM+NEQ+VWTL
Sbjct  412   KGVSREILLHLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIDSEMKNEQIVWTL  471

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              SGDM GEVGA CCRPQS+TYRT+ LSQLLK++TT L+EA++ ++EDN+TM+KNFLQHHK
Sbjct  472   KSGDMLGEVGAFCCRPQSYTYRTRILSQLLKIRTTCLIEAMKSRQEDNVTMMKNFLQHHK  531

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             K KDL+L DLF+E+G+ED DPNMSINL TV +TGNA FL+ELLKA LDP+IGDSKG+TPL
Sbjct  532   KFKDLRLVDLFLEVGEEDSDPNMSINLLTVASTGNAAFLDELLKARLDPDIGDSKGRTPL  591

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKGHEE VMVLL+HGCNIHL+D+ GNTALW+AIAAK H IF ILYHWASISDPYVA
Sbjct  592   HIAASKGHEESVMVLLRHGCNIHLQDVNGNTALWEAIAAKHHPIFEILYHWASISDPYVA  651

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GDLLC AA+ ND ++M+ELLKHGL VDSKDRHGST I  A+EEN  +M+KLL++NGAEID
Sbjct  652   GDLLCTAARRNDLTIMKELLKHGLLVDSKDRHGSTPIHVAIEENHVEMVKLLLINGAEID  711

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSI  360
             D +K  L+ ++L+E+LQKRE+GHRI + +           ++      S   QCS RVSI
Sbjct  712   DTLKYKLSSMNLSEILQKREVGHRIIVSDATDEFDHKLCEQEQKYGFESSKDQCSFRVSI  771

Query  359   YRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
             YRGHP  RR T C EPGRLI+LP ++ EL S AG+K G DA D+ +TDE+GA IDSI+VI
Sbjct  772   YRGHPEVRRRTHCSEPGRLIRLPNSLEELKSTAGQKFGCDAKDALVTDEQGAEIDSIEVI  831

Query  179   RDNDKLFIVADWNS  138
             RDNDKLFIV D NS
Sbjct  832   RDNDKLFIVEDINS  845



>ref|XP_006349369.1| PREDICTED: potassium channel AKT2/3-like [Solanum tuberosum]
Length=837

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/821 (72%), Positives = 690/821 (84%), Gaps = 14/821 (2%)
 Frame = -2

Query  2588  YVAQAPNSMMNKDTAAssssssSQEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVIS  2415
             +V Q  NS  + ++A S         +D S   LSK ILPPLGS  S    T  +G +I+
Sbjct  24    HVVQDDNSHESSNSATSI--------DDLSFRNLSKLILPPLGSNGSNTNQTHEKGFIIT  75

Query  2414  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  2235
             PMDSRYRCWE+ MV++VAYSAWVCPFEI+F+ S  +T LY+ DN+VD+FFA DI LTFFV
Sbjct  76    PMDSRYRCWESLMVIMVAYSAWVCPFEIAFMRSNPNTTLYITDNVVDIFFAADIFLTFFV  135

Query  2234  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  2055
             AYID TTQLL+  R+KIA RYLSTWF+MDVASTIPF+ +A L TGKH +GV YSVLGMLR
Sbjct  136   AYIDATTQLLVRDRRKIAIRYLSTWFIMDVASTIPFDLLALLLTGKHQVGVSYSVLGMLR  195

Query  2054  FWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWL  1875
             FWRLRRV  FFTRLEKD+RFSYFWVRCARLLFVTLL VHCAGCLYY LADRYPHQG  WL
Sbjct  196   FWRLRRVKQFFTRLEKDMRFSYFWVRCARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWL  255

Query  1874  GSLN--VREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYI  1701
              ++N   +E SL IRYI+A+YWS+TTMTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYI
Sbjct  256   RTMNPNYKETSLVIRYIAALYWSITTMTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYI  315

Query  1700  IGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPL  1521
             IGNMTNLVVEGTRRTMEFRNSI+AASNFV RNHLP RLK+QILAYMCLRF+AESLNQQ L
Sbjct  316   IGNMTNLVVEGTRRTMEFRNSIEAASNFVCRNHLPPRLKDQILAYMCLRFRAESLNQQEL  375

Query  1520  IEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESP  1341
             IEQLPKTICKSI HHLFLP VEKVYLFKGV+REILLLLVADMKAEYIPPREDVIMQNESP
Sbjct  376   IEQLPKTICKSIRHHLFLPTVEKVYLFKGVTREILLLLVADMKAEYIPPREDVIMQNESP  435

Query  1340  DDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklk  1161
             D++YIIVSGEVEM+++EMENEQ VWT  SGDM GEVGA CCRPQS+TYRTKTLSQLLK++
Sbjct  436   DELYIIVSGEVEMLESEMENEQTVWTFKSGDMIGEVGAFCCRPQSYTYRTKTLSQLLKIR  495

Query  1160  ttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT  981
             T++L+EA++ ++EDNI MIKNFLQHHK LK L+LGDL   +G + GDPNM +NL TV +T
Sbjct  496   TSNLIEAMKTRQEDNIIMIKNFLQHHKNLKGLRLGDLLHGVGGDYGDPNMYVNLLTVAST  555

Query  980   GNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTAL  801
             GNATFL ELLKA LDP+IGD++G+TPLHIAASKGHEECVMVLL+HGCNI+L+D+ G+TAL
Sbjct  556   GNATFLEELLKAKLDPDIGDAQGRTPLHIAASKGHEECVMVLLRHGCNINLRDVNGHTAL  615

Query  800   WDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHG  621
             W+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHGL VDSKDR G
Sbjct  616   WEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHGLQVDSKDRDG  675

Query  620   STAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILH  441
             STAI  A+EEN  DM+KLL+MNGAEI+D +K  L+ ++L+++LQKRE+GHR+ + +T + 
Sbjct  676   STAIHVALEENLEDMVKLLLMNGAEINDKLKYKLSSMNLSDMLQKREVGHRVMVSDT-MD  734

Query  440   EAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISI  264
             E A KW +   Q N+ S   Q S RVSIYR HP  RR T C EPG+LIKLP ++AEL  I
Sbjct  735   EVAQKWREQVKQHNTESTRDQSSFRVSIYRSHPVIRRRTHCSEPGKLIKLPNSLAELKII  794

Query  263   AGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  141
             AG+K GFDAT++++TD+EG+ IDSI+VIRDNDKLFIV   N
Sbjct  795   AGQKFGFDATNAAVTDQEGSEIDSIEVIRDNDKLFIVEGPN  835



>gb|ABF85695.1| potassium channel [Nicotiana rustica]
Length=826

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/795 (74%), Positives = 686/795 (86%), Gaps = 8/795 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             ++ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYS WVCPF
Sbjct  29    DELSFRNLSKLILPPLGSNGYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSVWVCPF  88

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY+STWF
Sbjct  89    EIAFMHSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLVRDRRRIATRYISTWF  148

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FFTRLEKD+RFSYFWVR
Sbjct  149   MMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTLL VHCAGCLYY LADRYPHQG  WLG++N   +E SL IRYI+A+YWS+TT
Sbjct  209   CARLLFVTLLTVHCAGCLYYLLADRYPHQGDTWLGAMNPNYKETSLLIRYIAALYWSITT  268

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNTLEM+FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  269   MTTVGYGDLHAVNTLEMVFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  328

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RN LP RLKEQILAYMCLRF+AESLNQQ LIEQ PKTICKSI HHLFLP VEKVYL
Sbjct  329   NFVCRNRLPPRLKEQILAYMCLRFRAESLNQQQLIEQPPKTICKSIRHHLFLPTVEKVYL  388

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSREILLLLVAD KAEYIPPREDVIMQNESPD+VYIIVSGEVEMI+ EMENE+VVWT
Sbjct  389   FKGVSREILLLLVADTKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIECEMENEKVVWT  448

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGDM GEVGA CCRPQS+TYRTKTLSQLLK++TTSL+EA++ ++EDN+ MIKNFLQ+H
Sbjct  449   FKSGDMLGEVGAFCCRPQSYTYRTKTLSQLLKIRTTSLIEAMKTRQEDNLIMIKNFLQYH  508

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKL+DLKLGDLF E+G E+GDPNMS+NL TV +TGNATFL ELLKA LDP+IGD++G+TP
Sbjct  509   KKLRDLKLGDLFHEVGAENGDPNMSVNLITVASTGNATFLEELLKARLDPDIGDAQGRTP  568

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             +HIAASKGHEECVMVLL+HGCNIHL+D+ GNTALW+AIAAK+HS F ILYHWAS+SDPYV
Sbjct  569   VHIAASKGHEECVMVLLRHGCNIHLRDVNGNTALWEAIAAKQHSTFRILYHWASVSDPYV  628

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AG+LLC AAK ND +VM+ELL+HGL VDSKDRHGSTAI  A+EEN  DM+ LL+MNGAEI
Sbjct  629   AGELLCTAAKRNDLTVMKELLEHGLIVDSKDRHGSTAIHVALEENHEDMVNLLLMNGAEI  688

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ--NSSSMPQQCSIR  369
             +D  K  L+ ++L+E+LQKRE+GHR+ +P+T + E A KW + + +  + S+   Q   R
Sbjct  689   NDKFKHKLSSMNLSEMLQKREVGHRVIVPDT-MDEVAQKWREQEQKYNSGSTRRDQSCFR  747

Query  368   VSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL-TDEEGAIIDS  192
             VSIY+GHP  R+ T C EPG+LI LP ++AEL  IAG+K GFDAT+++L TDEEG+ IDS
Sbjct  748   VSIYKGHPVIRKRTHCSEPGKLIILPNSLAELKIIAGQKFGFDATNAALVTDEEGSEIDS  807

Query  191   IDVIRDNDKLFIVAD  147
             I+VIRDNDKLFIV D
Sbjct  808   IEVIRDNDKLFIVED  822



>ref|XP_011087731.1| PREDICTED: potassium channel AKT2/3 [Sesamum indicum]
Length=847

 Score =  1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/798 (74%), Positives = 675/798 (85%), Gaps = 7/798 (1%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSS---QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  2346
             + ED S   LSK I+PPLG+S    P H  S+G +ISPMDS YRCWET MV+LVAYSAWV
Sbjct  50    DHEDLSFRNLSKLIVPPLGASAYTTPNH--SKGRIISPMDSTYRCWETVMVVLVAYSAWV  107

Query  2345  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
             CP+EI+FL S   T LY  D IVD+FFAVDIVLTFFVAYID TTQLL+H   KIA RYLS
Sbjct  108   CPYEIAFLGSNPTTPLYTADIIVDVFFAVDIVLTFFVAYIDSTTQLLVHDPSKIAKRYLS  167

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWFLMDVASTIPFE +AFL +GKH  GV YSVLGMLRFWRLRRV  FFTR+EKDIRFSYF
Sbjct  168   TWFLMDVASTIPFELIAFLISGKHQAGVSYSVLGMLRFWRLRRVKTFFTRIEKDIRFSYF  227

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWS  1812
             WVRCARLLFVTLL VHCA CL Y LA +YP++G  W+GS   N +E SL IRYISA+YWS
Sbjct  228   WVRCARLLFVTLLQVHCAACLAYLLAVQYPNEGNTWIGSAIPNFKETSLLIRYISALYWS  287

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTMTTVGYGD+HAVN LEM FII YMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+
Sbjct  288   ITTMTTVGYGDIHAVNALEMGFIILYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIE  347

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AAS+FVSRN LP RLKEQILAYMCLRFKAESLNQQ LIEQLPKTICKSI  HLFLP VEK
Sbjct  348   AASSFVSRNRLPPRLKEQILAYMCLRFKAESLNQQQLIEQLPKTICKSIQQHLFLPTVEK  407

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKGVSREIL+LLVADMKAEYIPPREDVI+QNE+PDD+YIIVSGEVEMID EME E +
Sbjct  408   VYLFKGVSREILMLLVADMKAEYIPPREDVIIQNEAPDDIYIIVSGEVEMIDCEMEKENI  467

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             VW LN+GDMFGEVGA CC PQSFTYRTKTLSQLL+LKT+SL+EA++ ++EDN+TM+KNFL
Sbjct  468   VWALNTGDMFGEVGAFCCMPQSFTYRTKTLSQLLRLKTSSLIEAMKTRQEDNVTMLKNFL  527

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             QHHKKLKDL+LGDLF+E G+EDGDPNMSINL +V  TGNA FLNELLKAGLDP++GDSKG
Sbjct  528   QHHKKLKDLRLGDLFLEGGEEDGDPNMSINLLSVAGTGNAAFLNELLKAGLDPDVGDSKG  587

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAAS GHE+CV+VLLKH C++HL+D  GNTALWDAIAAK HSIF ILYHWASISD
Sbjct  588   RTPLHIAASNGHEDCVVVLLKHACSLHLRDFNGNTALWDAIAAKHHSIFKILYHWASISD  647

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             PYVAGDLLC AA+ NDS+VM+ELLKHGL+VDSKDRHG TAIQ A EEN  DM+K L+MNG
Sbjct  648   PYVAGDLLCMAARRNDSTVMKELLKHGLYVDSKDRHGLTAIQVATEENHMDMVKFLLMNG  707

Query  551   AEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI  372
             +E+++ VK  ++ ++L E+LQKRE+GHRI +P+ +          D  +N  S       
Sbjct  708   SEVNEIVKNKISSVNLNEMLQKREVGHRIVVPDMLNENVLGVNGNDQQRNGESTKGLVLS  767

Query  371   RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
             RVSIY+GHP  RRE++C EPGRLI+LP ++AEL  IAG+K GFDAT++ LT+EEGA IDS
Sbjct  768   RVSIYKGHPTNRRESRCSEPGRLIRLPGSLAELKGIAGQKFGFDATNALLTNEEGAEIDS  827

Query  191   IDVIRDNDKLFIVADWNS  138
             I+VIRDNDKLFIV + +S
Sbjct  828   IEVIRDNDKLFIVENPDS  845



>ref|NP_001275259.1| potassium channel AKT2/3-like [Solanum tuberosum]
 emb|CAA70870.1| putative inward rectifying potassium channel [Solanum tuberosum]
Length=845

 Score =  1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/795 (73%), Positives = 679/795 (85%), Gaps = 5/795 (1%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSS---QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             + S   LSK ILPPLGSS      +   +G  ISP+ S YRCWET MVLLVAY AWVCPF
Sbjct  49    NMSFHNLSKLILPPLGSSGYNQNQTDLHKGNTISPITSTYRCWETLMVLLVAYCAWVCPF  108

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+F+    + KLY+ DNIV+L FA DI+LTF VAYID T+QLL+  R+KIATRY+STWF
Sbjct  109   EIAFMNLNPNKKLYIADNIVNLVFAADIILTFSVAYIDSTSQLLVRDRRKIATRYVSTWF  168

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             LMDVASTIPF+ +A LFTGKH +G+ YSVLG+LRFWRLR+V  FFTRLEKD+RFSYFW+R
Sbjct  169   LMDVASTIPFDLLAMLFTGKHQVGISYSVLGILRFWRLRKVKQFFTRLEKDMRFSYFWIR  228

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTL  VHCAGCLYY LADRYPHQG  WLGS+N   RE SL IRYISA+YWS+TT
Sbjct  229   CARLLFVTLFSVHCAGCLYYLLADRYPHQGNTWLGSVNPKFRETSLWIRYISAIYWSITT  288

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGT RTMEFRNSIQ+AS
Sbjct  289   MTTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTSRTMEFRNSIQSAS  348

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFVSRNHLP RLKEQILAYMCLRFKAESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  349   NFVSRNHLPPRLKEQILAYMCLRFKAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  408

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKG+SREILL LVADMKAEYIPPREDVIMQNESPD+VYIIVSGEVEMID+EMENEQ+VWT
Sbjct  409   FKGISREILLHLVADMKAEYIPPREDVIMQNESPDEVYIIVSGEVEMIDSEMENEQIVWT  468

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L  GDMFGEVGA CCRPQS+TYRT+TLSQLLK++T+SL+EA++ ++EDN+TM+KNFLQHH
Sbjct  469   LRCGDMFGEVGAFCCRPQSYTYRTRTLSQLLKIRTSSLIEAMKSRQEDNVTMMKNFLQHH  528

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKLKDL+L DLF+++GDED DPNMSINL TV +TGNA FL+ELLKA LDPNI DSKGKTP
Sbjct  529   KKLKDLRLTDLFLDVGDEDSDPNMSINLLTVASTGNAAFLDELLKARLDPNICDSKGKTP  588

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNIHL+D+ G+TALW+AIAAK+H IF ILYHWA ISDPYV
Sbjct  589   LHIAASKGHEECVMVLLRHGCNIHLQDVNGDTALWEAIAAKQHPIFEILYHWACISDPYV  648

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             +GDLLCKAA+ N+ ++M+ELLKHGL V+S DRH STAI  A+EEN  +M+KLL++NG EI
Sbjct  649   SGDLLCKAARRNELTIMKELLKHGLLVNSNDRHRSTAIHVAIEENHLEMVKLLLLNGDEI  708

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVS  363
             DD +K  L+ ++L+E+LQK+++GHRI + +T+      +  ++   +  S   QC+ RVS
Sbjct  709   DDTLKDKLSSMNLSEMLQKQDVGHRIIISDTMDEVDHKEHEQEQKYDFESHTDQCAFRVS  768

Query  362   IYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             IYRGHP  RR TQC E GRLIKLP+++A+L  IAG+K GF+A D+ +T+EEGA IDS++V
Sbjct  769   IYRGHPEFRRRTQCNELGRLIKLPDSLAKLKGIAGQKFGFEAKDALVTNEEGAEIDSVEV  828

Query  182   IRDNDKLFIVADWNS  138
             IRDNDKL+IV   NS
Sbjct  829   IRDNDKLYIVEYTNS  843



>ref|XP_010327298.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=841

 Score =  1174 bits (3037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/792 (73%), Positives = 677/792 (85%), Gaps = 7/792 (1%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSS---QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             + S   LSK I+PPLGSS      +   +G  ISP++S YRCWET MV+LVAY AWVCPF
Sbjct  51    NMSFHNLSKLIVPPLGSSGYNQNQTDLHKGNTISPINSTYRCWETLMVVLVAYCAWVCPF  110

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+    + KLY+ DNIV+LFFA DI+LTF VAYID T+QLL+  RKKIATRY+STWF
Sbjct  111   EMAFMNLNPNKKLYIADNIVNLFFAADIILTFSVAYIDSTSQLLVRDRKKIATRYVSTWF  170

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             LMDV STIPF+ VA  FTGKH +G+ YSVLG+LRFWRLR+V  FFTRLEKD+RFSYFW+R
Sbjct  171   LMDVGSTIPFDLVAMFFTGKHQVGISYSVLGVLRFWRLRKVKQFFTRLEKDMRFSYFWIR  230

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTT  1803
             CARLLFVTL  VHCAGCLYY LADRYPHQG  WLGS+N   RE SL IRYISA+YWS+TT
Sbjct  231   CARLLFVTLFSVHCAGCLYYLLADRYPHQGNTWLGSVNPKFRETSLSIRYISAIYWSITT  290

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGT RTMEFRNSIQ+AS
Sbjct  291   MTTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTSRTMEFRNSIQSAS  350

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RNHLP RLKEQILAYMCLRFKAESLNQQ LIEQLPKTICKSI HHLFLP VEKVYL
Sbjct  351   NFVCRNHLPPRLKEQILAYMCLRFKAESLNQQQLIEQLPKTICKSIRHHLFLPTVEKVYL  410

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKG+SREI L LVADMKA+YIPPREDVIMQNESPD+VYIIVSGEVEMID+EMENEQ+VWT
Sbjct  411   FKGISREIRLHLVADMKADYIPPREDVIMQNESPDEVYIIVSGEVEMIDSEMENEQIVWT  470

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L  GDMFGEVGA CCRPQS+TYRT+TLSQLLK++T+SL+EA++ ++EDN+TM+KNFLQHH
Sbjct  471   LRCGDMFGEVGAFCCRPQSYTYRTRTLSQLLKIRTSSLIEAMKSRQEDNMTMMKNFLQHH  530

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             KKLKDL+L DLF+++GD+D DPNMSINL TV +TGNATFL+ELLKA LDPNI DSKG+TP
Sbjct  531   KKLKDLRLTDLFVDVGDKDSDPNMSINLLTVSSTGNATFLDELLKARLDPNICDSKGRTP  590

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKGHEECVMVLL+HGCNIHL+D+ G+TALW+AI AK+H IF ILYHWA ISDPYV
Sbjct  591   LHIAASKGHEECVMVLLRHGCNIHLQDVNGDTALWEAITAKQHPIFEILYHWACISDPYV  650

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             +GDLLCKAA+ N+ ++M+ELLKHGL V+SKDRH STA+  A+EEN  +M+KLL++NG EI
Sbjct  651   SGDLLCKAARRNELTIMKELLKHGLLVNSKDRHRSTAMHIAIEENHLEMVKLLLLNGDEI  710

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRV  366
             DD +K  L+ ++L+E+LQK ++GHRI + +T + E   KW + + + +  S   QC+ RV
Sbjct  711   DDTLKDKLSSMNLSEILQKPDVGHRIIISDT-MDEVDHKWHEQEQKYDFESHTDQCAFRV  769

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIYRGHP  RR +QC EPGRLIKLP+++ +L  IAG K GFDA D+ +T+EEGA IDS++
Sbjct  770   SIYRGHPEFRRRSQCNEPGRLIKLPDSLEKLKGIAGHKFGFDAKDALVTNEEGAEIDSVE  829

Query  185   VIRDNDKLFIVA  150
             VIRDNDKL+I +
Sbjct  830   VIRDNDKLYIYS  841



>emb|CDO97567.1| unnamed protein product [Coffea canephora]
Length=848

 Score =  1167 bits (3020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/800 (72%), Positives = 674/800 (84%), Gaps = 10/800 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQ--PTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             +D SL  LSK ILPPLG+S      T  +G +I PMDSRYRCWE+ MVLLVAYSAWVCPF
Sbjct  46    KDLSLRNLSKLILPPLGASSYDQNQTRFKGRIIFPMDSRYRCWESLMVLLVAYSAWVCPF  105

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             EI+FL S     LYV DNIVD FFAVDIVLTFFVAYIDP TQLL+   KKIA RYLSTWF
Sbjct  106   EIAFLSSHPKKLLYVADNIVDFFFAVDIVLTFFVAYIDPRTQLLVLDSKKIAKRYLSTWF  165

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             LMDVASTIPFE + FLFTGKH  G+ YSVLGMLRFWR+RRV  FF RLEKDIRF+YFWVR
Sbjct  166   LMDVASTIPFEMIGFLFTGKHQSGLSYSVLGMLRFWRIRRVKKFFKRLEKDIRFNYFWVR  225

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
             CA LL VTL LVHCAGCLYY LADRYPH+GK WLG    N RE SL  RY+SAMYWS+TT
Sbjct  226   CAWLLSVTLFLVHCAGCLYYLLADRYPHEGKTWLGVAIPNFRETSLGFRYVSAMYWSITT  285

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGD+HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  286   MTTVGYGDMHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  345

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV+RNHLP RLKEQI+AYMCLRFKAE LN Q L+EQLP++ICKSI  HLFLP VEKVYL
Sbjct  346   NFVNRNHLPTRLKEQIIAYMCLRFKAERLNHQELMEQLPRSICKSIRQHLFLPTVEKVYL  405

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             FKGVSRE +LLLVAD+ AEY+PPREDVI+ NE+PDDVYIIVSGEVE+I ++ME E+VVWT
Sbjct  406   FKGVSRENILLLVADVTAEYLPPREDVILHNEAPDDVYIIVSGEVEIIASDMEKERVVWT  465

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L  GDMFGEVGA CCRPQ FTYRTK LSQLL+LKT++L+EA+++ REDNI MI+NFL+HH
Sbjct  466   LKPGDMFGEVGAFCCRPQCFTYRTKMLSQLLRLKTSALIEAMKIDREDNIAMIRNFLKHH  525

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
             K LKDL LGDLF+E  +E+GDPN+SINL TV +TGNA FL+ELLKAGLDP++GDSKG+TP
Sbjct  526   KNLKDLCLGDLFLEGVEEEGDPNLSINLLTVASTGNAAFLDELLKAGLDPDVGDSKGRTP  585

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAA+KGHEECV+VLLKHGCNI+L+D++GNTA+W+A+AAK   +F ILYHWASISDPY+
Sbjct  586   LHIAATKGHEECVVVLLKHGCNIYLQDIDGNTAIWEAVAAKHQPVFRILYHWASISDPYL  645

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AGDLLC AA+ ND++VM+ELLK GLH+DSKD HG TAIQ A+ ENQ DMIKLL+MNGAE+
Sbjct  646   AGDLLCTAARKNDAAVMKELLKQGLHIDSKDPHGMTAIQVAVTENQTDMIKLLLMNGAEV  705

Query  542   DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-----NSSSMPQQC  378
             DD +K  L+ +++ E+LQKRE+GHRI +P+T L + A KW +  H+     +  +   + 
Sbjct  706   DDIIKHKLSSINVNEMLQKREVGHRITVPDT-LGQDAFKWNEIKHECDKECSEGTCSTRV  764

Query  377   SIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
             SIRVSIYRGHP  R++ +C EPGRLI LP+++ EL +IAG+K GFDAT++++  E GA I
Sbjct  765   SIRVSIYRGHPVIRKDIRCSEPGRLISLPKSLTELKNIAGKKFGFDATNAAVVSEGGAEI  824

Query  197   DSIDVIRDNDKLFIVADWNS  138
             DSI+VIRDNDK+F + D +S
Sbjct  825   DSIEVIRDNDKIFFIEDHSS  844



>ref|XP_002529533.1| Potassium channel AKT2/3, putative [Ricinus communis]
 gb|EEF32836.1| Potassium channel AKT2/3, putative [Ricinus communis]
Length=845

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/812 (70%), Positives = 674/812 (83%), Gaps = 10/812 (1%)
 Frame = -2

Query  2552  DTAAssssssSQEDED--FSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWE  2385
             +T ++++++  +ED+D   SL  LSK ILPPLG S   +    ++G +ISPMDSRYR W 
Sbjct  29    ETESNTTATHQEEDDDTSLSLSSLSKIILPPLGVSSYNNNPIETRGWIISPMDSRYRWWG  88

Query  2384  TWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLL  2205
             ++MVLLVAYSAWV PFE++FL S  + +LY+ DNIVDLFFA+DIVLTFFVAYID  TQL+
Sbjct  89    SFMVLLVAYSAWVYPFEVAFLNSSPNKRLYIADNIVDLFFAIDIVLTFFVAYIDSRTQLM  148

Query  2204  IHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNF  2025
             +  RKKIATRYLSTWFLMDVASTIPFE +A+LFTG   L + YS+LG+LRFWRLRRV   
Sbjct  149   VRDRKKIATRYLSTWFLMDVASTIPFEALAYLFTGTQKLALSYSLLGILRFWRLRRVKQL  208

Query  2024  FTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREE  1851
             FTRLEKDIRFSYF +RCARLL VTL LVHCAGCLYY LADRYPHQG+ W+G++  N RE 
Sbjct  209   FTRLEKDIRFSYFRIRCARLLCVTLFLVHCAGCLYYLLADRYPHQGRTWIGAVIPNFRET  268

Query  1850  SLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVE  1671
             SL IRYISAMYWS+TTMTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVE
Sbjct  269   SLWIRYISAMYWSITTMTTVGYGDLHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVE  328

Query  1670  GTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICK  1491
             GTRRTMEFRNSI+AASNFV RN LP RLK+QILAYMCLRFKAESLNQ  LIEQLPK+ICK
Sbjct  329   GTRRTMEFRNSIEAASNFVCRNRLPRRLKDQILAYMCLRFKAESLNQNHLIEQLPKSICK  388

Query  1490  SICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGE  1311
             SIC HLFLP VEKVYLFKGVSREIL+LLVA+MKAEYIPPREDVIMQNE+PDDVYI+VSGE
Sbjct  389   SICQHLFLPTVEKVYLFKGVSREILMLLVAEMKAEYIPPREDVIMQNEAPDDVYIVVSGE  448

Query  1310  VEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQM  1131
             VE+ID+++E E+VV TL  GDMFG+VGALCCRPQSFT+RTKTLSQLL+LKT+SL+EA+Q 
Sbjct  449   VEIIDSDLEKERVVGTLQCGDMFGDVGALCCRPQSFTFRTKTLSQLLRLKTSSLIEAMQT  508

Query  1130  KREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELL  951
             ++ D I ++KNFLQHHK LKDLK+G+   E G+EDGDPNM+ NL TV +TGNA FL ELL
Sbjct  509   RQHDYIAIMKNFLQHHKTLKDLKVGEFPFESGEEDGDPNMASNLLTVASTGNAAFLEELL  568

Query  950   KAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHS  771
             KA LDP+IGDSKG+TPLHIAASKGHEECVMVLL+HGCNIHL+D+ GNTALWDA+++K  +
Sbjct  569   KAKLDPDIGDSKGRTPLHIAASKGHEECVMVLLRHGCNIHLRDINGNTALWDALSSKHQT  628

Query  770   IFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEE  591
             IF IL+H+ASISDP  AGDLLC AAK ND ++M+ELLKHGL+VD+KDR G TAIQ AM E
Sbjct  629   IFRILHHFASISDPQTAGDLLCTAAKRNDLTMMKELLKHGLNVDAKDRQGKTAIQIAMAE  688

Query  590   NQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDD  411
                DM+ LLVMNGA++  +     +   L E+L+KRE+GHRI +P+T+  +       + 
Sbjct  689   KYVDMVDLLVMNGADVTASNTYEFSSTTLNEMLKKREIGHRITVPDTVTSDEVILKRDEG  748

Query  410   HQNSSSMPQ----QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGF  243
              Q  +S  +    +C IRVSIY+GHP  R++  C EPGRLI+LP+++ EL  IAG+K GF
Sbjct  749   EQECNSCGKSDELKCIIRVSIYKGHPLVRKQACCKEPGRLIRLPDSLEELKRIAGDKFGF  808

Query  242   DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
             DA ++ +TD EG++IDSI+VIRDNDKLFI  D
Sbjct  809   DARNAMVTDVEGSVIDSIEVIRDNDKLFIAED  840



>gb|KDP38842.1| hypothetical protein JCGZ_04999 [Jatropha curcas]
Length=830

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/786 (71%), Positives = 656/786 (83%), Gaps = 9/786 (1%)
 Frame = -2

Query  2483  KFILPPLGSSQPTH--TSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             K ILPPLG S      T S+G +ISPMDSRYR WE++MV+LVAYSAWV PFE++FL +  
Sbjct  48    KIILPPLGVSSYNQNPTESKGWIISPMDSRYRSWESFMVVLVAYSAWVFPFEVAFLNASS  107

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
              T LY+ DNIVDLFFAVDIVLTF VAYID  TQLL+  R+KIA RYLSTWFLMDVAST+P
Sbjct  108   ITGLYIADNIVDLFFAVDIVLTFLVAYIDSRTQLLVRDRRKIAVRYLSTWFLMDVASTVP  167

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             FE + +LFTGK  LG+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFW+RC RLLFVTL
Sbjct  168   FELLGYLFTGKEKLGLSYSLLGILRFWRLRRVKQLFTRLEKDIRFSYFWIRCIRLLFVTL  227

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              LVHCAGCLYY LADRYPHQGK W+G++  N RE SL IRYISA+YWS+TTMTTVGYGDL
Sbjct  228   FLVHCAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLWIRYISALYWSITTMTTVGYGDL  287

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV RNHLP
Sbjct  288   HAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVCRNHLP  347

Query  1595  ARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
              RLK+QILAYMCLRFKAESLNQ  LIEQLPKTICKSICHHLFLP VEKVYLF GVSREIL
Sbjct  348   PRLKDQILAYMCLRFKAESLNQNHLIEQLPKTICKSICHHLFLPTVEKVYLFNGVSREIL  407

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
             LLLVA+MKAEYIPPREDV+MQNE+P+DVYIIVSGEVE+ID+++E E+VV TL+S DMFGE
Sbjct  408   LLLVAEMKAEYIPPREDVVMQNEAPEDVYIIVSGEVEIIDSDLEKERVVGTLHSMDMFGE  467

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             VGALCCRPQSFT+RTKTLSQLL+LKT  L+E++Q K+ED + +IKNFLQHHKKLKDLK+ 
Sbjct  468   VGALCCRPQSFTFRTKTLSQLLRLKTRVLIESMQTKQEDYVAIIKNFLQHHKKLKDLKIA  527

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
             +   E G+E+ DPNM+INL TV +TGNA FL ELLKA LDP+ GDSKG+TPLHIAASKGH
Sbjct  528   EFLAEGGEEE-DPNMAINLLTVASTGNAAFLEELLKAKLDPDNGDSKGRTPLHIAASKGH  586

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             EECV+VLL+HGCNIHLKD+ GNTALW+A++    SIF IL+H+ASISDP+ AGDLLC AA
Sbjct  587   EECVLVLLRHGCNIHLKDVNGNTALWEALSTNHQSIFRILFHFASISDPHTAGDLLCTAA  646

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA  516
             + ND ++M++LLK GL+VDSKDR G TAIQ A+ EN  DM+ LLVMNGA++  A   +  
Sbjct  647   RRNDLTMMKKLLKQGLNVDSKDRQGKTAIQIAVAENNIDMVDLLVMNGADVTAANTQDFN  706

Query  515   PLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATR  336
                L E+LQKRE+GH I +P+ + +E      K++ ++  S    C+ RVSIYRGHP  R
Sbjct  707   STTLNEMLQKREIGHHITVPDDLSNERLLLKKKEEEEHGKS---SCT-RVSIYRGHPLIR  762

Query  335   RETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  156
             ++    E GRLI+LP ++ EL +IAG+K GFDA ++ +TDEEG+ IDSI+VIRDNDKLFI
Sbjct  763   KQNCSRESGRLIRLPSSMEELKNIAGKKFGFDARNAMITDEEGSEIDSIEVIRDNDKLFI  822

Query  155   VADWNS  138
             V D NS
Sbjct  823   VEDQNS  828



>ref|XP_006431832.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
 gb|ESR45072.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
Length=833

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/795 (70%), Positives = 649/795 (82%), Gaps = 9/795 (1%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +D   SL  LSK ILPPLG SS   + +    +ISPMDSRYRCWET+MVLLVAYSAWVCP
Sbjct  33    DDASLSLRNLSKLILPPLGVSSYNQNQTKSKWIISPMDSRYRCWETFMVLLVAYSAWVCP  92

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE +FL S  D KLY+ D+IVDLFFA+DI LTFFVAYI   +QLL+   KKIA RY+ TW
Sbjct  93    FEFAFLHSSPDKKLYIGDSIVDLFFAIDIFLTFFVAYIHRRSQLLVREPKKIALRYIKTW  152

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FLMDVASTIPFE + +L TG     + YS+LG+LRFWRLRRV   FTRLEKDIRF+YFW+
Sbjct  153   FLMDVASTIPFEAIGYLITGNKKAALSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWI  212

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMT  1806
             RC +LLFVTL LVHCAGCLYY LADRYPH+G+ WLGS+N    E SL IRYISAMYWS+T
Sbjct  213   RCIKLLFVTLFLVHCAGCLYYLLADRYPHKGETWLGSVNPNFTETSLWIRYISAMYWSIT  272

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             TMTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA
Sbjct  273   TMTTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAA  332

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             SNFV RN LP RLK+QILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLFL  VEKVY
Sbjct  333   SNFVGRNRLPPRLKKQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFLHTVEKVY  392

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LFK VS+EI++LLVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVEMID EME E  V 
Sbjct  393   LFKDVSKEIIVLLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEMIDYEMEKEIAVG  452

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
             TL +GDMFGEVGALCCRPQ +TYRTKTLSQLL+LKT++L+EA+Q K+EDN++++KNFLQ 
Sbjct  453   TLQTGDMFGEVGALCCRPQIYTYRTKTLSQLLRLKTSALIEAMQSKQEDNVSILKNFLQQ  512

Query  1085  HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             HKKLKDL +GDL  E G+EDGDPNMS+NL TV +TGNA FL+ELLKA LDP+IGDSKG+T
Sbjct  513   HKKLKDLNIGDLIAESGEEDGDPNMSVNLLTVASTGNAAFLDELLKARLDPDIGDSKGRT  572

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
             PLHIAASKGHEECV+VLLKH  N+HL+DM GNTALW+AI++K HSIF ILYH  +ISDPY
Sbjct  573   PLHIAASKGHEECVLVLLKHASNVHLRDMNGNTALWEAISSKHHSIFRILYHCTAISDPY  632

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
              AGDLLC AAK ND SVM+EL+K+GL+VDSKDRHG TAI+ AM EN  +M+  LVMNG++
Sbjct  633   TAGDLLCTAAKRNDMSVMEELVKYGLNVDSKDRHGRTAIEIAMAENNVEMVNFLVMNGSD  692

Query  545   IDDAVKLNLAPLDLTEVLQKRELGHRIAM--PNTILHEAASKWAKD---DHQNSSSMPQQ  381
             +  A K   +  +L ++LQKRE+GHRI +   N+  +E   K  +    + +   S    
Sbjct  693   VVGANKCEFSSTNLNDMLQKREIGHRITVHDDNSTQNEVLLKKLEIIDFEAKEGKSKGGN  752

Query  380   CSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
             C  RVSIYRGHP  R++  C E GRLIKLP ++ EL  IAGEK GFDA ++ +TDE GA 
Sbjct  753   CQ-RVSIYRGHPLVRKQACCMEAGRLIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAE  811

Query  200   IDSIDVIRDNDKLFI  156
             IDSI+VIRDNDK+FI
Sbjct  812   IDSIEVIRDNDKIFI  826



>ref|XP_006471022.1| PREDICTED: potassium channel AKT2/3-like [Citrus sinensis]
Length=833

 Score =  1105 bits (2859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/795 (71%), Positives = 649/795 (82%), Gaps = 9/795 (1%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +D   SL  LSK ILPPLG SS   + +    +ISPMDSRYRCWET+MVLLVAYSAWV P
Sbjct  33    DDASLSLRNLSKLILPPLGVSSYNQNQTKSKWIISPMDSRYRCWETFMVLLVAYSAWVYP  92

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE +FL S  D KLY+ D+IVDLFFA+DI LTFFVAYI   +QLL+   KKIA RY+ TW
Sbjct  93    FEFAFLHSSPDKKLYIADSIVDLFFAIDIFLTFFVAYIHRRSQLLVREPKKIALRYIKTW  152

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FLMDVASTIPFE + +L TG     + YS+LG+LRFWRLRRV   FTRLEKDIRF+YFW+
Sbjct  153   FLMDVASTIPFEAIGYLITGNKKTALSYSLLGILRFWRLRRVKKLFTRLEKDIRFNYFWI  212

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMT  1806
             RC RLLFVTLLLVHCAGCLYY LADRYPH+G+ WLGS+N    E SL IRYISAMYWS+T
Sbjct  213   RCIRLLFVTLLLVHCAGCLYYLLADRYPHKGETWLGSVNPNFTETSLWIRYISAMYWSIT  272

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             TMTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA
Sbjct  273   TMTTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAA  332

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             SNFV RN LP RLK+QILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLFL  VEKVY
Sbjct  333   SNFVRRNRLPPRLKKQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFLHTVEKVY  392

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LFK VS+EI++LLVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID EME E  V 
Sbjct  393   LFKDVSKEIIVLLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDYEMEKEIAVG  452

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
             TL +GDMFGEVGALCCRPQ FTYRTKTLSQLL+LKT++L+EA+Q K+EDN++++KNFLQH
Sbjct  453   TLQTGDMFGEVGALCCRPQIFTYRTKTLSQLLRLKTSALIEAMQSKQEDNVSILKNFLQH  512

Query  1085  HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             HKKLKDL +GDL  E G+EDGDPNMS+NL TV +TGNA FL+ELLKA LDP+IGDSKG+T
Sbjct  513   HKKLKDLNIGDLIAESGEEDGDPNMSVNLLTVASTGNAAFLDELLKARLDPDIGDSKGRT  572

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
             PLHIAASKGHEECV+VLLKH  N+HL+DM GNTALW+AI++K HSIF ILYH  +ISDPY
Sbjct  573   PLHIAASKGHEECVLVLLKHASNVHLRDMNGNTALWEAISSKHHSIFRILYHCTAISDPY  632

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
              AGDLLC AAK ND SVM+EL+K+GL+VDSKDRHG TAI+ AM EN  +M+ +LVMNG++
Sbjct  633   TAGDLLCTAAKRNDMSVMEELVKYGLNVDSKDRHGRTAIEIAMAENNVEMVNILVMNGSD  692

Query  545   IDDAVKLNLAPLDLTEVLQKRELGHRIAM--PNTILHEAASKWAKD---DHQNSSSMPQQ  381
             +  A     +  +L ++LQKRE+GHRI +   N+  +E   K  +      +   S    
Sbjct  693   VVGANTCEFSSTNLNDMLQKREIGHRITVHDDNSTQNEVLLKKLEIIDFGAKEGKSKGGN  752

Query  380   CSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
             C  RVSIYRGHP  R++  C E GRLIKLP ++ EL  IAGEK GFDA ++ +TDE GA 
Sbjct  753   CQ-RVSIYRGHPLVRKQACCMEAGRLIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAE  811

Query  200   IDSIDVIRDNDKLFI  156
             IDSI+VIRDNDK+FI
Sbjct  812   IDSIEVIRDNDKIFI  826



>ref|XP_002268924.1| PREDICTED: potassium channel AKT2/3 [Vitis vinifera]
Length=841

 Score =  1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/840 (68%), Positives = 677/840 (81%), Gaps = 14/840 (2%)
 Frame = -2

Query  2621  EIRLNRPVYYTYVAQAPNSMMNKDTAAssssssSQEDED----FSLGKLSKFILPPLGSS  2454
             E+++   +Y  Y   A N +  +D +  S     ++  D    F+   LSK ILPPLG S
Sbjct  2     EMKVPHQLYSLY--SASNMIKREDHSRKSLKKPEEKQHDDSKPFNSRNLSKVILPPLGVS  59

Query  2453  QPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNI  2280
                    + +G +ISPMDSRYRCWET+MV+LVAYS W+ PF+++FL++  + +LY+ DN+
Sbjct  60    SYNQNPLAPKGWIISPMDSRYRCWETFMVVLVAYSLWIYPFQVAFLKASPNRQLYITDNV  119

Query  2279  VDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTG  2100
             VDLFFAVDIVLTFFVAYID  TQLL+   +KIA RYLSTWFLMD+AST+PFE +  L TG
Sbjct  120   VDLFFAVDIVLTFFVAYIDRRTQLLVCDWRKIAVRYLSTWFLMDMASTMPFEALGSLITG  179

Query  2099  KHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLY  1920
             K  +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFWVRCARLL VTL LVHCAGCLY
Sbjct  180   KQKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWVRCARLLSVTLFLVHCAGCLY  239

Query  1919  YFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIF  1746
             Y LADRYPHQGK W+G++  N RE SL IRYISA+YWS+TTMTTVGYGD+HAVNT+EMIF
Sbjct  240   YLLADRYPHQGKTWIGAVIPNFRETSLWIRYISALYWSITTMTTVGYGDMHAVNTMEMIF  299

Query  1745  IIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAY  1566
             IIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV RN LP RLKEQILAY
Sbjct  300   IIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVCRNRLPPRLKEQILAY  359

Query  1565  MCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAE  1386
             MCLRFKAESLNQ  LIEQLPK+ICKSIC HLFLP VEKVYLFKG+SREILLLLVA MKAE
Sbjct  360   MCLRFKAESLNQHQLIEQLPKSICKSICQHLFLPTVEKVYLFKGISREILLLLVAKMKAE  419

Query  1385  YIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQS  1206
             YIPPREDVIMQNE+PDDVYIIVSGEVE+ID E E E VV TL S DMFGEVGALCCRPQ+
Sbjct  420   YIPPREDVIMQNEAPDDVYIIVSGEVEIIDYEGEKEHVVGTLQSADMFGEVGALCCRPQT  479

Query  1205  FTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDED  1026
             +T+RTKTLSQLL+LKT++L+EA+Q K+EDN+ ++KNFLQHHK+LKDL +GDL +E G+ED
Sbjct  480   YTFRTKTLSQLLRLKTSALIEAMQTKKEDNVIILKNFLQHHKRLKDLNIGDLLVENGEED  539

Query  1025  GDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKH  846
              +PNM+ NL TV +TGNA FL+ELLKA LDP+IGDSKG+TPLHIAASKGHE+CVMVLLKH
Sbjct  540   VNPNMAFNLLTVASTGNAAFLDELLKAKLDPDIGDSKGRTPLHIAASKGHEDCVMVLLKH  599

Query  845   GCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQE  666
              CN+H++D+ GNTALWDA++AK +SIF ILYH AS+SDPY +GDLLC AAK ND + M+E
Sbjct  600   ACNVHVRDINGNTALWDAVSAKHNSIFWILYHCASLSDPYTSGDLLCTAAKRNDLTAMKE  659

Query  665   LLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQK  486
             LLK GL++DSK+R G TAIQ AM E+  DM+KLLVMNGA++  A     +   L E+LQK
Sbjct  660   LLKQGLNIDSKNRQGLTAIQIAMAEDHTDMVKLLVMNGADVIHANTYEFSSETLNEMLQK  719

Query  485   RELGHRIAMPNTIL--HEA--ASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  318
             RE+GHRI +P+T+   HE     +  + +   +         RVSIYRGHP  R+E+ C 
Sbjct  720   REMGHRIMVPDTLPTDHETLLRDQGGEKEFNTNGGFKGTNVPRVSIYRGHPLQRKESCCT  779

Query  317   EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  138
             E GRLI+LP ++ EL +IAGEKLGFDA ++ +T+EEGA IDSI+VIRDND LF+V D NS
Sbjct  780   EAGRLIRLPNSLMELKAIAGEKLGFDARNAMVTNEEGAEIDSIEVIRDNDTLFLVEDPNS  839



>ref|XP_003593018.1| Potassium channel [Medicago truncatula]
 gb|AES63269.1| potassium outward rectifying channel protein [Medicago truncatula]
Length=830

 Score =  1099 bits (2842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/791 (70%), Positives = 648/791 (82%), Gaps = 7/791 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S+    SS+G +ISPMDSRYRCWE++MV+LVAYSAWV PFE++F
Sbjct  38    FNLRNVSKLILPPLGVSKQNSVSSKGWIISPMDSRYRCWESFMVILVAYSAWVYPFEVAF  97

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             + S  + KLY+VDNIVDLFFAVDIVLTFFVAY+D TT LL+   KKI  RYLSTWF+MDV
Sbjct  98    MHSSTNRKLYIVDNIVDLFFAVDIVLTFFVAYVDGTTHLLVRDSKKIVVRYLSTWFIMDV  157

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + +  TGKH L + Y +LGMLRFWR+RRV  FFTRLEKDIRF+YFWVRCARL
Sbjct  158   ASTIPYEAIGYFLTGKHKLSLPYYLLGMLRFWRIRRVKQFFTRLEKDIRFNYFWVRCARL  217

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  VHCAGCLYY LAD YPH+GK W+G++  N RE S +IRYISA+YWS+TTMTTV
Sbjct  218   LSVTLFSVHCAGCLYYMLADMYPHEGKTWIGAVIPNFRETSPRIRYISAIYWSITTMTTV  277

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  278   GYGDLHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  337

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICK IC HLF P VEKVYLFKGV
Sbjct  338   RNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKGICQHLFFPTVEKVYLFKGV  397

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EILL LVA MKAEYIPP+EDVIMQNESPDDVYIIVSGEVE+ID+ +E E+++ TL  G
Sbjct  398   SKEILLSLVAKMKAEYIPPKEDVIMQNESPDDVYIIVSGEVEVIDSIIEKERILGTLTIG  457

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             DMFGEVGALCCRPQ+FTYRTKTL+QLL+LKT +L+EA+Q+K+EDNI ++KNFLQH K+LK
Sbjct  458   DMFGEVGALCCRPQNFTYRTKTLTQLLRLKTNNLIEAMQIKKEDNILILKNFLQHFKQLK  517

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +ED DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSK KTPLHIA
Sbjct  518   DLSIKDLMVENVEED-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKEKTPLHIA  576

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHEECV VLLKH CNIH+KDM G+TALW AIA+K HSIF ILY  +++SDPY AG+L
Sbjct  577   ASNGHEECVKVLLKHTCNIHIKDMNGDTALWYAIASKHHSIFRILYQLSALSDPYTAGNL  636

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             LC AAK ND +VM ELLK GL++DSKDRHG TAIQ AM EN  +M++LLVMNGA++ D  
Sbjct  637   LCTAAKRNDITVMNELLKQGLNIDSKDRHGMTAIQIAMSENHVEMVQLLVMNGADVTDVH  696

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASK-WAKDDHQN--SSSMPQQCSIRVSI  360
                 +   L E++QKRE+GH I +   +  E   K   +++H+         +C  RVSI
Sbjct  697   VHEFSASILNEIMQKREIGHLINVSEVMPSEFVLKVQNQEEHKQIWGRYNGLECP-RVSI  755

Query  359   YRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
             YRGHP  RRE    E G+LI+LP+++ +L +IAGEK GFDA D+ +T+EEGA ID IDVI
Sbjct  756   YRGHPVVRRERGFIEAGKLIRLPDSLEKLKTIAGEKFGFDAKDTMVTNEEGAEIDCIDVI  815

Query  179   RDNDKLFIVAD  147
             RDNDKLF V +
Sbjct  816   RDNDKLFFVEE  826



>ref|XP_004485488.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Cicer arietinum]
Length=840

 Score =  1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/789 (69%), Positives = 647/789 (82%), Gaps = 7/789 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S+     S+G +ISPMDS+YR WE+ MV+LVAYSAWV PFE++F
Sbjct  44    FNLRNVSKLILPPLGVSKQNLVYSKGWIISPMDSKYRSWESLMVVLVAYSAWVYPFEVAF  103

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             + S  + KLY+VDN+VDLFFAVDI+LTFF+AYID TT LL+   KKI  RYLSTWFLMDV
Sbjct  104   MHSSPNRKLYIVDNVVDLFFAVDIILTFFLAYIDRTTHLLVRDSKKIVLRYLSTWFLMDV  163

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             AS+IP+E + ++ TGKH LG+ Y +LGMLRFWRLRRV  FFTRLEKDIRFSYFWVRCARL
Sbjct  164   ASSIPYEAIGYILTGKHKLGLPYLLLGMLRFWRLRRVKQFFTRLEKDIRFSYFWVRCARL  223

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  VHCAGCLYY LADRYPHQGK W+G++  N RE S +IRYISA+YWS+TTMTTV
Sbjct  224   LAVTLFSVHCAGCLYYMLADRYPHQGKTWIGAVFPNFRETSPRIRYISAIYWSITTMTTV  283

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  284   GYGDLHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  343

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RL+EQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLF P VEKVYLFK V
Sbjct  344   RNRLPLRLREQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFFPTVEKVYLFKDV  403

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EILL +VA M AEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+ +E E+V+ TL +G
Sbjct  404   SKEILLSIVAKMTAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSGIEKERVLGTLQTG  463

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             DMFGEVGALCCRPQ+FTYRTKTL+QLL+LKT +L+EA+Q ++EDNI ++KNFLQH K+LK
Sbjct  464   DMFGEVGALCCRPQNFTYRTKTLTQLLRLKTNTLIEAMQTRKEDNIQILKNFLQHFKQLK  523

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  524   DLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIA  582

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHEECV VLLKH CNIH++DM GNTALWDAI +K +SIF ILY  A++SDPY AG+L
Sbjct  583   ASNGHEECVKVLLKHSCNIHIRDMNGNTALWDAIESKHNSIFRILYQLAALSDPYTAGNL  642

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             LC AAK ND +VM ELLK GL++DSKDRHG+TAIQ AM EN  DM++LLVMNGA++ +  
Sbjct  643   LCTAAKRNDLTVMNELLKQGLNIDSKDRHGTTAIQIAMSENLVDMVQLLVMNGADVAEVH  702

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASK---WAKDDHQNSSSMPQQCSIRVSI  360
                 +   L ++L+KRE+GH+I +   +  E A K     +D H        +C  RVSI
Sbjct  703   THEFSASTLKKMLKKREIGHQITVNEAMASEFALKEQNQEEDKHVWGRYNGLECP-RVSI  761

Query  359   YRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
             YR HP  RRE    E G+LI+LP+++ +L +IAGEK GFDA D+ +T+EEGA ID IDVI
Sbjct  762   YRSHPVVRRERGFIEAGKLIRLPDSLEKLKTIAGEKFGFDARDAVVTNEEGAEIDCIDVI  821

Query  179   RDNDKLFIV  153
             RDNDKLF V
Sbjct  822   RDNDKLFFV  830



>ref|XP_003532990.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Glycine max]
Length=834

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/786 (69%), Positives = 643/786 (82%), Gaps = 5/786 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  45    FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  105   MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  164

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + +LFTG+  +G+ Y +LG+LRFWR+RRV  +FTRLEKDIRFSYFWVRCARL
Sbjct  165   ASTIPYEAIGYLFTGRQKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRCARL  224

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  VHCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTMTTV
Sbjct  225   LSVTLFSVHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTV  284

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  285   GYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  344

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLF   VEKVYLFKGV
Sbjct  345   RNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFFATVEKVYLFKGV  404

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EI+L LVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE++D E E E+++ TL++G
Sbjct  405   SKEIILSLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEILDTETEKERILGTLHTG  464

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             +MFGE GALCCRPQS TYRTKTL+QLL+LKT +LLEA+Q+KREDNI ++KNFLQH K++K
Sbjct  465   EMFGEFGALCCRPQSLTYRTKTLTQLLRLKTNTLLEAMQIKREDNIQILKNFLQHFKQVK  524

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  525   DLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIA  583

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHE CV VLLKH CN+H+KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL
Sbjct  584   ASNGHEGCVKVLLKHACNMHIKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDL  643

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             +C AAK N+ +VM +LL+ GL+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D  
Sbjct  644   MCTAAKRNELTVMTDLLRQGLNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVH  703

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIY  357
                     L E+LQKRE+GH I +   +L E   K    + +H    S       RVSIY
Sbjct  704   NHEFCSSTLNEMLQKREIGHLINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIY  763

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  RRE    E G+LI+LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIR
Sbjct  764   RGHPVVRREKCSMEAGKLIRLPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIR  823

Query  176   DNDKLF  159
             DNDKLF
Sbjct  824   DNDKLF  829



>gb|KHN11238.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/786 (69%), Positives = 643/786 (82%), Gaps = 5/786 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  42    FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  101

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  102   MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  161

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + +LFTG+  +G+ Y +LG+LRFWR+RRV  +FTRLEKDIRFSYFWVRCARL
Sbjct  162   ASTIPYEAIGYLFTGRQKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRCARL  221

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  VHCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTMTTV
Sbjct  222   LSVTLFSVHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTV  281

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  282   GYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  341

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLF   VEKVYLFKGV
Sbjct  342   RNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFFATVEKVYLFKGV  401

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EI+L LVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE++D E E E+++ TL++G
Sbjct  402   SKEIILSLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEILDTETEKERILGTLHTG  461

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             +MFGE GALCCRPQS TYRTKTL+QLL+LKT +LLEA+Q+KREDNI ++KNFLQH K++K
Sbjct  462   EMFGEFGALCCRPQSLTYRTKTLTQLLRLKTNTLLEAMQIKREDNIQILKNFLQHFKQVK  521

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  522   DLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIA  580

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHE CV VLLKH CN+H+KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL
Sbjct  581   ASNGHEGCVKVLLKHACNMHIKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDL  640

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             +C AAK N+ +VM +LL+ GL+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D  
Sbjct  641   MCTAAKRNELTVMTDLLRQGLNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVH  700

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIY  357
                     L E+LQKRE+GH I +   +L E   K    + +H    S       RVSIY
Sbjct  701   NHEFCSSTLNEMLQKREIGHLINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIY  760

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  RRE    E G+LI+LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIR
Sbjct  761   RGHPVVRREKCSMEAGKLIRLPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIR  820

Query  176   DNDKLF  159
             DNDKLF
Sbjct  821   DNDKLF  826



>ref|XP_010101161.1| Potassium channel [Morus notabilis]
 gb|EXB87379.1| Potassium channel [Morus notabilis]
Length=851

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/790 (69%), Positives = 650/790 (82%), Gaps = 7/790 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              +L  LSK ILPPLG  SS  T   S+G +ISPM SRYRCWET+MVLLVAYSAW+ P E+
Sbjct  62    LNLKNLSKLILPPLGDSSSNQTQIQSKGWIISPMVSRYRCWETFMVLLVAYSAWMYPIEV  121

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             SFL S     LY+ D++VDLFFA+DIVLTFFVAYID TTQLL+   KKIA RYLSTWFLM
Sbjct  122   SFLNSYPKKPLYIADSVVDLFFAIDIVLTFFVAYIDSTTQLLVRDFKKIALRYLSTWFLM  181

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPFE + +LFTG   + +   +LGMLRFWRLRRV  FFTRLEKDIRF+YFW RCA
Sbjct  182   DVASTIPFETLYYLFTGNRKIPLSCYLLGMLRFWRLRRVKQFFTRLEKDIRFNYFWTRCA  241

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             RLLF TLLLVHCAGCLYY LAD YPH+G+ W+G+   N RE SL IRYISA+YWS+TTMT
Sbjct  242   RLLFATLLLVHCAGCLYYLLADLYPHKGQTWIGTAIPNFRETSLWIRYISALYWSITTMT  301

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHAVNT+EMIFIIF+MLFNLG TAYIIGNMTNLVVEGTRRTMEFRNSI++ASNF
Sbjct  302   TVGYGDLHAVNTVEMIFIIFFMLFNLGFTAYIIGNMTNLVVEGTRRTMEFRNSIESASNF  361

Query  1616  VSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFK  1437
             VSRN LPARLK+QILAYMCLRFKAESLNQQ L+EQLPK+ICKSIC HLFLP V KVYLFK
Sbjct  362   VSRNRLPARLKDQILAYMCLRFKAESLNQQHLLEQLPKSICKSICQHLFLPTVGKVYLFK  421

Query  1436  GVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN  1257
             GVS+EILL LVA MKAEYIPPREDV+MQ E+PDDVYIIVSGEVE+ID EM+ E  V TL 
Sbjct  422   GVSKEILLHLVAKMKAEYIPPREDVVMQTEAPDDVYIIVSGEVEIIDCEMDKELAVGTLQ  481

Query  1256  SGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkk  1077
             SG +FGEVGALCCRPQ FTYRTKTLSQLL+LKTT L+EA+Q ++EDN+ ++KNFLQ+HKK
Sbjct  482   SGHIFGEVGALCCRPQGFTYRTKTLSQLLRLKTTDLIEAMQARKEDNLQILKNFLQYHKK  541

Query  1076  lkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             L+DLK+G L +E G+E+GDPNM+ NL TV  TGN   L+ELLKA LDP+IGDSKG+TPLH
Sbjct  542   LQDLKIGALLVEGGEEEGDPNMADNLLTVAHTGNDGLLDELLKAKLDPDIGDSKGRTPLH  601

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAAS+GHEECV+VLLKH CN+HLKDM GNTALW+AIA+K H+IF++LYH+A +SDPY+AG
Sbjct  602   IAASEGHEECVLVLLKHACNVHLKDMNGNTALWEAIASKHHTIFNMLYHFAVLSDPYIAG  661

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
             +LLC AAK ND +VM+ELLK+GL+VDSK+ HGST +Q AM +N  DM+ LLVMNGAE+ +
Sbjct  662   ELLCTAAKRNDVTVMKELLKYGLNVDSKNHHGSTPVQVAMADNNVDMVNLLVMNGAEVVN  721

Query  536   AVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIY  357
             A         L E+L+KRE+G+RI +P T  +E  S  ++ + + S  +   C  RVSIY
Sbjct  722   ANTYEFPSTALNEMLEKREVGYRINVPETAPNEVLSMQSEAEKRKSDGV--NCP-RVSIY  778

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  R+ET C EPG+LI+LP ++ +L  +AGEK   +  +  +T+EEGA IDSI+VIR
Sbjct  779   RGHPMERKETCCKEPGKLIRLPSSLEDLKKVAGEKFRLNCREIIVTNEEGAEIDSIEVIR  838

Query  176   DNDKLFIVAD  147
             DNDKLFI+ +
Sbjct  839   DNDKLFIMEN  848



>ref|XP_007042250.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
 gb|EOX98081.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
Length=839

 Score =  1091 bits (2822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/781 (70%), Positives = 639/781 (82%), Gaps = 6/781 (1%)
 Frame = -2

Query  2471  PPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             PPLG S        S+G +ISPMDSRYRCWET+MVLLV YSAWV PFE+SF  S    +L
Sbjct  56    PPLGVSSYNQNQIKSKGWIISPMDSRYRCWETFMVLLVFYSAWVYPFEVSFFSSSPPRRL  115

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
             Y+ DNIVDLFFAVDIVLTFFVAYID  T LL+   KKIA RYLSTWFLMD+ASTIPFE +
Sbjct  116   YIADNIVDLFFAVDIVLTFFVAYIDRRTHLLVQDSKKIAVRYLSTWFLMDLASTIPFEAL  175

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
              +LFTGK  +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFW+RCARLL VTL LVH
Sbjct  176   GYLFTGKSKVGISYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLLAVTLFLVH  235

Query  1937  CAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTVGYGDLHAVN  1764
             CAGC+YY LADRYPHQG+ WLGS+N   RE SL+IRYISA+YWS+TTMTTVGYGDLHAVN
Sbjct  236   CAGCIYYLLADRYPHQGRTWLGSVNPNFRETSLRIRYISALYWSITTMTTVGYGDLHAVN  295

Query  1763  TLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLK  1584
             T+EMIFII YMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AASNFVSRN LPARLK
Sbjct  296   TVEMIFIILYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAASNFVSRNRLPARLK  355

Query  1583  EQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             EQILAYMCLRFKAE LNQQ LIEQLPK+I   IC HLFLP V+KVYLF G SRE+LL LV
Sbjct  356   EQILAYMCLRFKAERLNQQQLIEQLPKSIYTGICQHLFLPTVKKVYLFNGTSREMLLHLV  415

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             A MKAEY+PPREDVIMQNE+PDDVYIIVSGEVE+ID EME E  V TL S D+FGE+GAL
Sbjct  416   AKMKAEYLPPREDVIMQNEAPDDVYIIVSGEVEIIDYEMEKELAVGTLRSEDIFGEIGAL  475

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             CCRPQ FT+RTKTLSQLL+LKTT L+ A+Q K+EDN+ ++KNFLQ +K+LKD K+GDL I
Sbjct  476   CCRPQRFTFRTKTLSQLLRLKTTDLIAAMQTKQEDNVAILKNFLQQNKRLKDHKIGDLVI  535

Query  1043  EIGDEDGDP-NMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEEC  867
             E G+EDGDP N++I+L TV   GNA FL+ELLKA LDP++GDS+G+TPLHIAASKGHEEC
Sbjct  536   EGGEEDGDPKNIAISLLTVADAGNAAFLDELLKARLDPDVGDSEGRTPLHIAASKGHEEC  595

Query  866   VMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMN  687
             V+VLLKH CN+H++DM GNTALWDAI+AK HSIF++LYH+A+ISD + AGDLLC AAK N
Sbjct  596   VLVLLKHACNVHVRDMNGNTALWDAISAKHHSIFTVLYHFAAISDSFTAGDLLCTAAKRN  655

Query  686   DSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD  507
             D +VMQELLKHGL VD+KDRHG TA+Q AM E   DM+ LLVMNGA++ +A     +   
Sbjct  656   DLTVMQELLKHGLSVDAKDRHGLTALQIAMREKHEDMVNLLVMNGADVINANTYEFSSTA  715

Query  506   LTEVLQKRELGHRIAMPNTIL-HEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRE  330
             L E+L+KRE+GHRI + +T    E   K  ++D            +RVSIYRGHP  R E
Sbjct  716   LNEMLKKREIGHRITVTDTTSGEELLKKLEREDVCILGKCRGLDPLRVSIYRGHPLMRTE  775

Query  329   TQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
             + C EPG+LI+LP+++ EL + AGEK G D  ++ +TDE GA IDSI+VIRDNDKLFIVA
Sbjct  776   SCCMEPGKLIRLPDSLDELKNFAGEKFGIDPRNAIVTDEGGAEIDSIEVIRDNDKLFIVA  835

Query  149   D  147
             +
Sbjct  836   E  836



>ref|XP_007225285.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
 gb|EMJ26484.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
Length=842

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/804 (69%), Positives = 645/804 (80%), Gaps = 20/804 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTS--SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             D +L  +SK ILPPLG+S    T   S G +ISPMDSRYRCWET+MVLLVAYSAWV PFE
Sbjct  42    DLNLRNISKLILPPLGASSYNQTPIHSNGWIISPMDSRYRCWETFMVLLVAYSAWVYPFE  101

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
              +FL S     LY+ DN+VDLFFA+DI+LTFFVAYIDP TQLL+H  K+IA RYLSTWFL
Sbjct  102   EAFLNSSSHRPLYLADNVVDLFFAIDIILTFFVAYIDPRTQLLVHDSKRIAMRYLSTWFL  161

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+AST+PFE +     GK+ LGV YS+LG+LRFWR+RR    FTRLEKDIRFSYFWVRC
Sbjct  162   MDLASTLPFEAL-----GKNKLGVSYSLLGLLRFWRIRRAKQLFTRLEKDIRFSYFWVRC  216

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VTL  +HCAGCLYY LADRYPHQGK W+G++  N RE SL+IRYISA+YWS+TTM
Sbjct  217   ARLLSVTLFSIHCAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLRIRYISAIYWSITTM  276

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGD+HAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASN
Sbjct  277   TTVGYGDMHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASN  336

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLK+QILAY+CLRFKAESLNQQ +IEQLPK+I K IC HLFLP VE+VY F
Sbjct  337   FVCRNRLPPRLKDQILAYICLRFKAESLNQQHIIEQLPKSITKGICQHLFLPTVERVYFF  396

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             K +SRE LLLLVA MKAEYIPPREDV++QNE PDDVYIIVSGEVE+I  EME E V  TL
Sbjct  397   KDISRETLLLLVAKMKAEYIPPREDVVLQNEVPDDVYIIVSGEVEIIGCEMEKELVAGTL  456

Query  1259  NSGDMFGEV--------GALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              SGDMFGEV        GALCCRPQSFTYRTKTLSQLL+LKTT+L+EA+Q K +D + M+
Sbjct  457   KSGDMFGEVGALCCREVGALCCRPQSFTYRTKTLSQLLRLKTTALIEAMQTKPKDKLQML  516

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             KNF QHHKKL+DLK+G++  E GDE+GD NM+ NL TV + GNA  L+ELLKA LDP+IG
Sbjct  517   KNFKQHHKKLRDLKIGEILAESGDEEGDANMAFNLLTVASKGNAALLDELLKAKLDPDIG  576

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKG+TPLH+AAS GHEECV+VLLK+GCNIH++D+ GNTALWDAIA+K HSIF ILY+ A
Sbjct  577   DSKGRTPLHVAASNGHEECVLVLLKYGCNIHVRDINGNTALWDAIASKHHSIFRILYYCA  636

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDPY  G+LLC AAK ND ++M+ELLKH L+VD+K+  G TA+Q AMEEN ADM+ LL
Sbjct  637   AISDPYTDGNLLCTAAKRNDMTLMEELLKHELNVDAKNHLGKTAVQIAMEENNADMVNLL  696

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +    +     LTE+LQKRE+GHRI +P+T L+E       DD QN      
Sbjct  697   VMNGADVANTHNFSFPSETLTEMLQKREVGHRITVPDTTLNEVP-LMRNDDEQNPDWRKS  755

Query  383   QCS--IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEE  210
                   RVSIYRGHP  RR T C E GRLI+LP ++ EL +IAGEK GFD+ +  +TDE 
Sbjct  756   NGVNFPRVSIYRGHPIVRRNTCCREAGRLIRLPNSVEELKNIAGEKFGFDSRNVLVTDEG  815

Query  209   GAIIDSIDVIRDNDKLFIVADWNS  138
             GA IDSI+VIRDNDKLF+  D  S
Sbjct  816   GAEIDSIEVIRDNDKLFVFEDPKS  839



>ref|XP_003540163.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Glycine 
max]
 gb|KHN45473.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =  1085 bits (2807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/787 (69%), Positives = 639/787 (81%), Gaps = 5/787 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  46    FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  105

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             +    + K+Y+ D++VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  106   MHKSSNMKIYIADSVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  165

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + +LFTGK  LG+ Y +LG+ RFWR+RRV  +FTRLEKDIRFSYFWVRCARL
Sbjct  166   ASTIPYEAIGYLFTGKRKLGLPYFLLGLFRFWRIRRVKQYFTRLEKDIRFSYFWVRCARL  225

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  +HCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTMTTV
Sbjct  226   LSVTLFSIHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTV  285

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNTLEMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFVS
Sbjct  286   GYGDLHAVNTLEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVS  345

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RLKEQILAYMCLRFKAE+LNQ  LIEQLPK+ICKSIC HLF   VEKVYLFK V
Sbjct  346   RNRLPPRLKEQILAYMCLRFKAENLNQHQLIEQLPKSICKSICQHLFFATVEKVYLFKDV  405

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EILL LVA MKAEYIPPREDVIMQNE+PDD+YIIVSGEVE+I  EME E+++ TL++G
Sbjct  406   SKEILLSLVAKMKAEYIPPREDVIMQNEAPDDIYIIVSGEVEIIHTEMERERILGTLHTG  465

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             DMFGEVGAL  RPQSFTYRTKTL+QLL+LKT +L+EA+Q+KRED   ++KNFLQH K+LK
Sbjct  466   DMFGEVGALISRPQSFTYRTKTLTQLLRLKTNTLMEAMQIKREDR-QILKNFLQHIKQLK  524

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  525   DLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIA  583

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             ASKGHEECV VLLKH CN+H+KDM GNTA+WDAIA+K +SIF IL+  +++SDP  AGDL
Sbjct  584   ASKGHEECVKVLLKHACNMHIKDMNGNTAIWDAIASKHYSIFRILFQLSAVSDPNTAGDL  643

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             LC AAK N+ +V+ +LLK GL+VDSKD H +TAIQ AM EN  DM+ LLVMNGA++ D  
Sbjct  644   LCTAAKRNELTVLTDLLKQGLNVDSKDHHDTTAIQIAMAENHVDMVHLLVMNGADVSDVH  703

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVSIYR  354
                     L E+LQKRE+GH I +   +      K    + + +          RVSIYR
Sbjct  704   NHEFCSSTLDEMLQKREIGHLINVTEVMRSGVVLKGKHQEQELNGGRSNGLKFPRVSIYR  763

Query  353   GHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
             GHP  RRE    E G+LI+LP+++ EL +IAGEK GFDA D+ +T+EEGA IDSIDVIRD
Sbjct  764   GHPVVRREKGSVEAGKLIRLPDSLEELKTIAGEKFGFDAKDAMVTNEEGAEIDSIDVIRD  823

Query  173   NDKLFIV  153
             NDKLF V
Sbjct  824   NDKLFFV  830



>ref|XP_010245053.1| PREDICTED: potassium channel AKT2/3-like isoform X2 [Nelumbo 
nucifera]
Length=841

 Score =  1082 bits (2798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/789 (67%), Positives = 646/789 (82%), Gaps = 8/789 (1%)
 Frame = -2

Query  2489  LSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  2316
             LSK ILPPLG   S P    S+G +ISP+DSRYRCWET+MV LVAYSAWV PFE++F ++
Sbjct  48    LSKIILPPLGDSGSNPNQIHSRGWIISPIDSRYRCWETFMVFLVAYSAWVYPFEVAFFKA  107

Query  2315  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  2136
                  LY+ DNIVDLFFA DI+LTFFVAYIDP +QLL+   KKIA RYLSTWF+MD+AST
Sbjct  108   SPTRGLYIADNIVDLFFATDIILTFFVAYIDPRSQLLVRDSKKIAMRYLSTWFVMDIAST  167

Query  2135  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFV  1956
             IPFE +  LFTGK  +G+ Y +LG+LRFWRLRRV   FTRLEKDIRFSYFW+RCARL+ V
Sbjct  168   IPFEALGHLFTGKSKVGLTYCLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLISV  227

Query  1955  TLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYG  1782
             TL +VHCAGC+YY LADRYPHQG+ W+GS+  N RE  L  RY+S++YWS+TTMTTVGYG
Sbjct  228   TLFMVHCAGCVYYLLADRYPHQGRTWIGSVIPNFREAKLWTRYVSSIYWSITTMTTVGYG  287

Query  1781  DLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNH  1602
             DLHAVN++EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAAS+FV RNH
Sbjct  288   DLHAVNSMEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASSFVCRNH  347

Query  1601  LPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             LP RLKEQILAYMCLRF+AESLNQQ L+EQLPK+ICKSIC HLFLP VEKVYLFKGVSRE
Sbjct  348   LPPRLKEQILAYMCLRFRAESLNQQQLMEQLPKSICKSICQHLFLPTVEKVYLFKGVSRE  407

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             ILLLLVA MKAEYIPPRED+IM NE+PDDVYI+VSGEVE+ID EME E+VV TL +GD+F
Sbjct  408   ILLLLVAKMKAEYIPPREDIIMHNEAPDDVYIVVSGEVEIIDYEMEKERVVGTLRTGDIF  467

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GEVGALC RPQSFT+RTKTLSQLL+LKT +L+EA++ K +DN  ++KNFLQH+++LKDL 
Sbjct  468   GEVGALCLRPQSFTFRTKTLSQLLRLKTCALMEAMRAKGQDNKLILKNFLQHYRELKDLN  527

Query  1061  lgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
             + D+ IE G+ DG+PNM++NL TV ++GNA FL+ELL+A LDP+IGDS+G+TPLHIAAS 
Sbjct  528   IHDMLIENGEGDGEPNMAVNLLTVASSGNAAFLDELLRARLDPDIGDSRGRTPLHIAASN  587

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCK  702
             GHEECV+VLLKH C +++KD++GNT LWDAIAA  HSIF ILYH++SISDPY AG+LLC 
Sbjct  588   GHEECVLVLLKHACKVNIKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTAGELLCT  647

Query  701   AAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN  522
             AAK ND S M+ELLKHGL+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D A +  
Sbjct  648   AAKRNDLSTMKELLKHGLNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVDQANQSG  707

Query  521   LAPLDLTEVLQKRELGHRIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---IRVSIYR  354
                  L E++QKR +GH I +P T++H+  S  + K   +  SS  +      +RVSIY+
Sbjct  708   FPAASLNEMVQKRGVGHCITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFLRVSIYK  767

Query  353   GHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
             GHP  R+ T   + G+LIKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDSI+ IRD
Sbjct  768   GHPLVRKYTFASDSGKLIKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDSIETIRD  827

Query  173   NDKLFIVAD  147
             NDKLFIV +
Sbjct  828   NDKLFIVEN  836



>ref|XP_007148520.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
 gb|ESW20514.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
Length=832

 Score =  1082 bits (2798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/788 (68%), Positives = 646/788 (82%), Gaps = 5/788 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S     +S+G +ISPMDS+YRCWE++MVLLVAYSAWV PFE++F
Sbjct  45    FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSKYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             +    + K+YVVD +VD FF +DI+LTFF+AYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  105   MHRSSNMKIYVVDTVVDFFFGIDIILTFFLAYIDQTTHLLVRDKKKIVVRYLSTWFVMDL  164

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + +LFTGKH +G+ Y +LG+LRFWRLRRV  FFTRLEKDIRFSYFWVRCARL
Sbjct  165   ASTIPYEALGYLFTGKHKVGLPYFLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRCARL  224

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  +HCAGCLYY LADRYPH+GK W+G++N   RE SL+IRYISAMYWS+TTMTTV
Sbjct  225   LSVTLFSIHCAGCLYYMLADRYPHKGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTV  284

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLT+Y+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  285   GYGDLHAVNTMEMIFIIFYMLFNLGLTSYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  344

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LPARLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSICHHLF   VEKVYLF+GV
Sbjct  345   RNRLPARLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICHHLFSETVEKVYLFRGV  404

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+E +L LVA MKAEYIPPREDVIMQ+E+PDD+YIIVSGEVE+ID  ME E+ + TL++ 
Sbjct  405   SKETILSLVAKMKAEYIPPREDVIMQSEAPDDLYIIVSGEVEIIDIVMEKEKTLGTLHTR  464

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             DMFGEVGALCCRPQS+TYRTKTL+QLL+LKT +LLEA+Q+KREDN+ ++KNFLQH K++K
Sbjct  465   DMFGEVGALCCRPQSYTYRTKTLTQLLRLKTNTLLEAMQIKREDNMQILKNFLQHFKQIK  524

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             +L + DL +E  DE+ DPNM++NL TV  TGNA FL ELL+AGLDP+IGDS+GKTPLHIA
Sbjct  525   NLSIKDLMVENVDEE-DPNMAVNLLTVANTGNAAFLEELLRAGLDPDIGDSEGKTPLHIA  583

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHEECV VLLKH CNIH++DM GNTALW+AIA+K +SIF +L+ +A++SD   AGD+
Sbjct  584   ASNGHEECVKVLLKHTCNIHIRDMNGNTALWEAIASKHYSIFRLLFQFAALSDQNTAGDI  643

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             LC AAK N+ +VM++LLK GL+VDSKDRH  TAIQ AM EN  +M++LL+MNGA++ D  
Sbjct  644   LCTAAKRNELTVMKDLLKLGLNVDSKDRHDETAIQIAMAENHVEMVQLLLMNGADVSDVQ  703

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS--IRVSIY  357
                     L+E+L   E+GHRI +   +  E ASK    + ++        S   RVSIY
Sbjct  704   NHEFCSSTLSEMLHNCEIGHRINVIELMPSEVASKGKHQEEEHGGERRYNGSKIARVSIY  763

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  RRE    + G+LIK+P+++ EL +IAGEK GFDA D+ +T+EEGA I+SIDVIR
Sbjct  764   RGHPLLRREEGTMQSGKLIKMPDSLDELKNIAGEKFGFDAKDAMVTNEEGAEIESIDVIR  823

Query  176   DNDKLFIV  153
             DNDKLF +
Sbjct  824   DNDKLFFI  831



>ref|XP_006385212.1| potassium channel family protein [Populus trichocarpa]
 gb|ERP63009.1| potassium channel family protein [Populus trichocarpa]
Length=848

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/802 (69%), Positives = 654/802 (82%), Gaps = 11/802 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWV  2346
             ++D   SL  LSK ILPPLG S        S+G +ISP+DSRYRCW T M +LVAYS WV
Sbjct  36    EDDSPLSLSSLSKIILPPLGVSSFNQNPIESKGWIISPVDSRYRCWGTIMAVLVAYSLWV  95

Query  2345  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
              PFE++FL S     LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA RYLS
Sbjct  96    YPFEVAFLNSSPYRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARRYLS  155

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWFLMDVAST+PFE +A+LFTG   +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYF
Sbjct  156   TWFLMDVASTVPFELLAYLFTGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYF  215

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWS  1812
             WVRCARLL VTL LVHCAGCLYY LADRYPH+GK W+G++  N RE SL IRYISAMYWS
Sbjct  216   WVRCARLLCVTLFLVHCAGCLYYLLADRYPHKGKTWIGAVIPNFRETSLWIRYISAMYWS  275

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTMTTVGYGDLHA N++EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+
Sbjct  276   ITTMTTVGYGDLHAQNSMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIE  335

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AASNFVSRN LP RLK+QILAYMCLRFKAE+LNQ  LIEQLPK+ICKSIC HLFLP VEK
Sbjct  336   AASNFVSRNRLPPRLKDQILAYMCLRFKAENLNQHQLIEQLPKSICKSICQHLFLPTVEK  395

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKG+SRE LL LVA +KAEYIPPREDV+MQNE+PDDVYIIVSGEVE+I++ +E E+V
Sbjct  396   VYLFKGISRETLLHLVAKIKAEYIPPREDVVMQNEAPDDVYIIVSGEVEIIESYLEKERV  455

Query  1271  VWTLNS-GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             V TL S GDMFGEVGALCCRPQS   RT+TLSQLL++KTT+LLEA+Q  ++D I +IKNF
Sbjct  456   VGTLRSAGDMFGEVGALCCRPQSHICRTRTLSQLLRIKTTALLEAMQTNQDDYIAIIKNF  515

Query  1094  LQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             LQH+K  KDLK+GDL +E G+E+ DPNM+ NL    +TGNA FL ELLKA LDP+I DSK
Sbjct  516   LQHYKGFKDLKIGDLTVENGEEEDDPNMAFNLLPTASTGNAAFLEELLKAKLDPDIADSK  575

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+TPLHIAASKGHEECV+VLL+HGC+IHL+D+ GNTALW+AI++K HSIF IL+H+ASIS
Sbjct  576   GRTPLHIAASKGHEECVVVLLRHGCDIHLRDINGNTALWEAISSKHHSIFRILFHYASIS  635

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
             DP  AGDLLC AAK ND  VM+ELLK GL+VDSKDRHG TA+Q AM EN  DM+ LLVMN
Sbjct  636   DPNAAGDLLCTAAKQNDLMVMKELLKQGLNVDSKDRHGKTALQVAMAENHGDMVNLLVMN  695

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTIL-HEAASKWAKDDHQNSSSMPQQC  378
             GAE+ +A   + +   L E+LQKRE+GHRI +P+ +  +E   K  + + + +S   +  
Sbjct  696   GAEVAEANTHDFSSTSLNEMLQKREIGHRITVPDVLTANEVLLKRCEGEQECTSCTGKSK  755

Query  377   S-----IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
                   IRVSIYRGHP  RR+T C E GRLIKLP ++ EL SIAGEK GFDA ++ +TDE
Sbjct  756   GSSSDCIRVSIYRGHPMVRRQTCCVEAGRLIKLPNSLEELKSIAGEKFGFDARNAMVTDE  815

Query  212   EGAIIDSIDVIRDNDKLFIVAD  147
             EG+ +DSI+VIRD DKL++V D
Sbjct  816   EGSEVDSIEVIRDKDKLYMVED  837



>ref|XP_010245052.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Nelumbo 
nucifera]
Length=844

 Score =  1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/785 (67%), Positives = 645/785 (82%), Gaps = 7/785 (1%)
 Frame = -2

Query  2480  FILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             F++PPLG S+   + +S G +ISPMDSRYRCWET+MV LVAYSAWV PFE++F ++    
Sbjct  55    FLIPPLGVSTYDENQNSGGGIISPMDSRYRCWETFMVFLVAYSAWVYPFEVAFFKASPTR  114

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              LY+ DNIVDLFFA DI+LTFFVAYIDP +QLL+   KKIA RYLSTWF+MD+ASTIPFE
Sbjct  115   GLYIADNIVDLFFATDIILTFFVAYIDPRSQLLVRDSKKIAMRYLSTWFVMDIASTIPFE  174

Query  2123  FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLL  1944
              +  LFTGK  +G+ Y +LG+LRFWRLRRV   FTRLEKDIRFSYFW+RCARL+ VTL +
Sbjct  175   ALGHLFTGKSKVGLTYCLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLISVTLFM  234

Query  1943  VHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
             VHCAGC+YY LADRYPHQG+ W+GS+  N RE  L  RY+S++YWS+TTMTTVGYGDLHA
Sbjct  235   VHCAGCVYYLLADRYPHQGRTWIGSVIPNFREAKLWTRYVSSIYWSITTMTTVGYGDLHA  294

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN++EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAAS+FV RNHLP R
Sbjct  295   VNSMEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASSFVCRNHLPPR  354

Query  1589  LKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLL  1410
             LKEQILAYMCLRF+AESLNQQ L+EQLPK+ICKSIC HLFLP VEKVYLFKGVSREILLL
Sbjct  355   LKEQILAYMCLRFRAESLNQQQLMEQLPKSICKSICQHLFLPTVEKVYLFKGVSREILLL  414

Query  1409  LVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVG  1230
             LVA MKAEYIPPRED+IM NE+PDDVYI+VSGEVE+ID EME E+VV TL +GD+FGEVG
Sbjct  415   LVAKMKAEYIPPREDIIMHNEAPDDVYIVVSGEVEIIDYEMEKERVVGTLRTGDIFGEVG  474

Query  1229  ALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdL  1050
             ALC RPQSFT+RTKTLSQLL+LKT +L+EA++ K +DN  ++KNFLQH+++LKDL + D+
Sbjct  475   ALCLRPQSFTFRTKTLSQLLRLKTCALMEAMRAKGQDNKLILKNFLQHYRELKDLNIHDM  534

Query  1049  FIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEE  870
              IE G+ DG+PNM++NL TV ++GNA FL+ELL+A LDP+IGDS+G+TPLHIAAS GHEE
Sbjct  535   LIENGEGDGEPNMAVNLLTVASSGNAAFLDELLRARLDPDIGDSRGRTPLHIAASNGHEE  594

Query  869   CVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKM  690
             CV+VLLKH C +++KD++GNT LWDAIAA  HSIF ILYH++SISDPY AG+LLC AAK 
Sbjct  595   CVLVLLKHACKVNIKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTAGELLCTAAKR  654

Query  689   NDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL  510
             ND S M+ELLKHGL+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D A +      
Sbjct  655   NDLSTMKELLKHGLNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVDQANQSGFPAA  714

Query  509   DLTEVLQKRELGHRIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---IRVSIYRGHPA  342
              L E++QKR +GH I +P T++H+  S  + K   +  SS  +      +RVSIY+GHP 
Sbjct  715   SLNEMVQKRGVGHCITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFLRVSIYKGHPL  774

Query  341   TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  162
              R+ T   + G+LIKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDSI+ IRDNDKL
Sbjct  775   VRKYTFASDSGKLIKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDSIETIRDNDKL  834

Query  161   FIVAD  147
             FIV +
Sbjct  835   FIVEN  839



>gb|EYU26523.1| hypothetical protein MIMGU_mgv1a001765mg [Erythranthe guttata]
Length=762

 Score =  1073 bits (2774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/762 (71%), Positives = 638/762 (84%), Gaps = 9/762 (1%)
 Frame = -2

Query  2411  MDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVA  2232
             MDSRYRCWET MV+LVAYSAWVCP+EI+FL+S  +T L++ DNIVD FFAVDIVLTFFVA
Sbjct  1     MDSRYRCWETLMVILVAYSAWVCPYEIAFLKSNPNTPLFIADNIVDFFFAVDIVLTFFVA  60

Query  2231  YIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRF  2052
             YID TTQLLIH  +KIA RYLSTWF+MDVASTIPFE +AF  + + H  + YS+LG+LRF
Sbjct  61    YIDSTTQLLIHDSRKIAKRYLSTWFIMDVASTIPFETIAFFISSERHSPLTYSLLGLLRF  120

Query  2051  WRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLG  1872
             WRLRRV +FFTR+EKDIRFSYFWVRCARLLFVTLL VHCA CL Y LAD YP+ G  W+G
Sbjct  121   WRLRRVKSFFTRIEKDIRFSYFWVRCARLLFVTLLQVHCAACLAYLLADIYPNGGNTWIG  180

Query  1871  SL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYII  1698
             S   N RE SL IRYISAMYWS+TTMTTVGYGD+HAVN LEM+FIIFYMLFNLGLTAYII
Sbjct  181   SAIPNFRETSLLIRYISAMYWSITTMTTVGYGDIHAVNALEMVFIIFYMLFNLGLTAYII  240

Query  1697  GNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLI  1518
             GNMTNLVVEGTRRTMEFRNSI+AAS+FVSRNHLP RLKEQI+AYMCLRFKAESLN Q LI
Sbjct  241   GNMTNLVVEGTRRTMEFRNSIEAASDFVSRNHLPTRLKEQIVAYMCLRFKAESLNHQQLI  300

Query  1517  EQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPD  1338
             EQLPKTICKSI  HLFLP V+KVYLFKG+S EILLLL+ADMKAEYIPPREDVI+QNE+P+
Sbjct  301   EQLPKTICKSIQQHLFLPTVKKVYLFKGISTEILLLLIADMKAEYIPPREDVIIQNEAPE  360

Query  1337  DVYIIVSGEVEMIDNEM-ENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklk  1161
              VYIIVSGEVEMID+E  E E+ VW    GDMFGEVGA C  PQS+TYRTKTL+QLL LK
Sbjct  361   YVYIIVSGEVEMIDSETNEGEKAVWCFRCGDMFGEVGAFCSMPQSYTYRTKTLTQLLSLK  420

Query  1160  ttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT  981
             TTSL+ A++ ++EDN+TM+KNFLQHHKKLKDL+LGDLF+E GDE+ D NMSINL +V  T
Sbjct  421   TTSLIHAMKTRQEDNVTMLKNFLQHHKKLKDLRLGDLFLE-GDEE-DSNMSINLLSVAGT  478

Query  980   GNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTAL  801
             GNA FLNELL+AGLDP++GDSKGKTPLHIAAS+G+E+CV+VLLKH C++HLKD+ GNTAL
Sbjct  479   GNAAFLNELLEAGLDPDVGDSKGKTPLHIAASEGNEDCVLVLLKHACSLHLKDLNGNTAL  538

Query  800   WDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHG  621
             W+AIA+K HSIF ILYHWAS+SDPYVAGDLLC AA+ ND  VM ELL++GL+VDS DRHG
Sbjct  539   WEAIASKHHSIFKILYHWASVSDPYVAGDLLCLAARRNDLVVMHELLRNGLYVDSHDRHG  598

Query  620   STAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILH  441
             +TA+QAA  EN  +M++ L+MNG+E++++VK  +   +L E+L++RE+GHRIA+      
Sbjct  599   TTAVQAATNENHMEMVRYLLMNGSEVNESVKNKIPSENLNEMLKEREVGHRIAVSEMEND  658

Query  440   EAASKWAKDDHQN----SSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAEL  273
             +   +  ++D +      +S       RVS+Y+G    RRE +C EPG+LI+LP +IAEL
Sbjct  659   DVLRRVNENDRKGGLGIGNSKGNVVFSRVSVYKGCSNDRREGRCAEPGKLIRLPNSIAEL  718

Query  272   ISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
               IAGEK GFDA ++ +T+EEGA ID I+VIRDNDKLFIV +
Sbjct  719   KKIAGEKFGFDAENAVVTNEEGAEIDCIEVIRDNDKLFIVEN  760



>gb|AAD16278.1| pulvinus inward-rectifying channel for potassium SPICK1 [Samanea 
saman]
Length=832

 Score =  1070 bits (2768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/800 (68%), Positives = 644/800 (81%), Gaps = 12/800 (2%)
 Frame = -2

Query  2519  QEDE---DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  2355
             +ED+    F+L  +SK ILPPLG S        ++G +ISPMD+RYR W+  MVLLVAYS
Sbjct  35    EEDDMSPSFNLQNVSKLILPPLGVSSYNLNPVENKGWIISPMDTRYRYWQGVMVLLVAYS  94

Query  2354  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  2175
             AWV PFE++FL S  + ++++VDN+VD+FFAVDIVLTFFVA+ID  TQLL+   KKIA R
Sbjct  95    AWVYPFEVAFLHSSPNKEVFIVDNVVDIFFAVDIVLTFFVAFIDRRTQLLVRDAKKIAVR  154

Query  2174  YLSTWFLMDVASTIPFEFVAFLFTGKHHLG-VCYSVLGMLRFWRLRRVSNFFTRLEKDIR  1998
             YLS+WF++DVASTIP+E ++++ TGKH +G VCY +LGMLRFWRLRR+  FFTRLEKDIR
Sbjct  155   YLSSWFVLDVASTIPYEALSYVITGKHKVGLVCY-LLGMLRFWRLRRMKQFFTRLEKDIR  213

Query  1997  FSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISA  1824
             FSYFWVRCARLLFVTL  VHCAGCLYY LADRYPHQGK W+G++  N RE SL IRYISA
Sbjct  214   FSYFWVRCARLLFVTLFSVHCAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLWIRYISA  273

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             MYWS+TTMTTVGYGDLHAVNT EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  274   MYWSITTMTTVGYGDLHAVNTAEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFR  333

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSI+AAS+FV RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+IC SIC HLFLP
Sbjct  334   NSIEAASSFVGRNRLPVRLKEQILAYMCLRFKAESLNQYQLIEQLPKSICTSICQHLFLP  393

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              VEKVYLFK VSRE+LL LVA MKAEY+PPREDV+MQNE+P+DVYIIVSGEVE+ID  ME
Sbjct  394   TVEKVYLFKHVSREVLLSLVAKMKAEYLPPREDVVMQNEAPEDVYIIVSGEVEIIDCVME  453

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              E+++ TL +GDMFGEVGALCC+PQ FTYRTKTL+QLL+LKT +L+EA+Q K+EDN+ ++
Sbjct  454   KERILGTLFAGDMFGEVGALCCKPQYFTYRTKTLTQLLRLKTNALIEAMQSKKEDNMQIL  513

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             KNFLQH K+LKDL + DL +E G+E+ DPNM++NL TV +TGNA FL ELLKAGLDP++G
Sbjct  514   KNFLQHFKQLKDLSIRDLMVESGEEE-DPNMAVNLLTVASTGNAAFLEELLKAGLDPDVG  572

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKGKTPLHIAAS GHE+CV VLL+H CNIH++D  GNTALWDAIA+K  SIF ILY  A
Sbjct  573   DSKGKTPLHIAASNGHEDCVKVLLRHACNIHIRDNNGNTALWDAIASKHLSIFRILYQLA  632

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
               SDP   GDLL  AA+ ND +VM ELLK GL VDSKDRHG TA Q AM EN  +M++LL
Sbjct  633   CFSDPQTGGDLLRTAAERNDLTVMNELLKQGLKVDSKDRHGMTATQVAMAENHMEMVQLL  692

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSS--SM  390
             VMNGA++ D    N +   L E+L+KRE GH+I +      E   +  K + +  S    
Sbjct  693   VMNGADVSDIQNHNFSGSALNEMLRKRETGHQITVDEATPSEHVVREDKGEQEEQSWGRS  752

Query  389   PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEE  210
              +    RVSIYRGHP  RR+  C EPGRLI+ P+++ EL  IAGEK GF+A D+ +T+EE
Sbjct  753   SKSSFPRVSIYRGHPINRRDKNCKEPGRLIRFPDSLEELKKIAGEKFGFEAEDAMVTNEE  812

Query  209   GAIIDSIDVIRDNDKLFIVA  150
             GA +D+++VIRDN+KLFIV 
Sbjct  813   GAEVDTVEVIRDNEKLFIVG  832



>ref|XP_008218775.1| PREDICTED: potassium channel AKT2/3 [Prunus mume]
Length=843

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/803 (69%), Positives = 643/803 (80%), Gaps = 18/803 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTS--SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             D +L  +SK ILPPLG+S    T   S G +ISPMDSRYRCWET+MVLLVAYSAWV PFE
Sbjct  43    DLNLRNISKLILPPLGASSYNQTPIHSNGWIISPMDSRYRCWETFMVLLVAYSAWVYPFE  102

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
              +FL S     LY+ DN+VDLFFA+DI+LTFFVAYIDP +QLL+H  KKIA RYLSTWF+
Sbjct  103   EAFLNSSSYNPLYLADNVVDLFFAIDIILTFFVAYIDPRSQLLVHDSKKIAMRYLSTWFV  162

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVAST+PFE +     GK+ LGV YS+LG+LRFWR+RR    FTRLEKDIRFSYFWVRC
Sbjct  163   MDVASTLPFEAL-----GKNKLGVSYSLLGLLRFWRIRRAKQLFTRLEKDIRFSYFWVRC  217

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VTL  VHCAGCLYY LADRYPHQGK W+G++  N RE SL+IRYISAMYWS+TTM
Sbjct  218   ARLLSVTLFSVHCAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLRIRYISAMYWSITTM  277

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGD+HAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASN
Sbjct  278   TTVGYGDMHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASN  337

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLK QILAY+CLRFKAESLNQQ +IEQLPK+I K IC HLFLP VEKVYLF
Sbjct  338   FVCRNRLPPRLKNQILAYICLRFKAESLNQQHIIEQLPKSITKGICQHLFLPTVEKVYLF  397

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             K +SRE LLLLVA MKAEYIPPREDV++QNE PDDVYIIVSGEVE+I  EME E V  TL
Sbjct  398   KDISRETLLLLVAKMKAEYIPPREDVVLQNEVPDDVYIIVSGEVEIIGCEMEKELVAGTL  457

Query  1259  NSGDMFGEV--------GALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              SGDMFGEV        GALCCRPQSFTYRTKTLSQLL+LKTT+L+EA+Q K ED + M+
Sbjct  458   KSGDMFGEVGALCCREVGALCCRPQSFTYRTKTLSQLLRLKTTALIEAMQTKPEDKLQML  517

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             KNF QHHK+L+DLK+G++  E GDE+GD N++ NL TV + GNA  L ELLKA LDP+IG
Sbjct  518   KNFKQHHKRLRDLKIGEILAESGDEEGDANVAFNLLTVASKGNAALLAELLKAKLDPDIG  577

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             +SKG+TPLH+AAS GHEECV+VLLK+GCNIH++D+ GNTALWDAIA+K HSIF ILY+ A
Sbjct  578   NSKGRTPLHVAASNGHEECVLVLLKYGCNIHVRDINGNTALWDAIASKHHSIFRILYYCA  637

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +IS+PY  GDLLC AAK ND ++M+ELLKH L+VD+K+  G TA+Q AMEEN ADM+ LL
Sbjct  638   AISNPYTDGDLLCTAAKRNDMTLMEELLKHELNVDAKNHLGKTAVQIAMEENNADMVNLL  697

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +    +     LTE+LQKRE+GHRI +P+T L+E       D+         
Sbjct  698   VMNGADVANTHNFSFPSETLTEMLQKREVGHRITVPDTTLNEVPLIRYDDEQNPDWRKSN  757

Query  383   QCSI-RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEG  207
             + +  RV IYRGHP  RR T C E GRLI+LP +I EL +IAGEK GFD+ +  +TDE G
Sbjct  758   RVNFPRVCIYRGHPIVRRNTCCMEAGRLIRLPNSIEELKNIAGEKFGFDSRNVLVTDEGG  817

Query  206   AIIDSIDVIRDNDKLFIVADWNS  138
             A IDSI+VIRDNDKLF+  D  S
Sbjct  818   AEIDSIEVIRDNDKLFVFEDSKS  840



>emb|CAA71598.1| potassium channel [Vicia faba]
Length=807

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/790 (68%), Positives = 642/790 (81%), Gaps = 10/790 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S+     S+  +ISPMDSRYRCWE++MV+L+AYSAW  PFE++F
Sbjct  21    FNLRNVSKLILPPLGVSRENQVYSR-WIISPMDSRYRCWESFMVVLIAYSAWAYPFEVAF  79

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             + S  + KLY+VDNI+DLFFA+DIV+TFF+A+ID TT LL+   KKI  RYLSTWF+MDV
Sbjct  80    MHSSPNRKLYIVDNIIDLFFAIDIVMTFFLAFIDGTTHLLVRDSKKIVVRYLSTWFIMDV  139

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
             ASTIP+E + F+ TGKH LG+ Y +LGMLRFWR+RRV  FFTRLEKDIRFSYFWVRCARL
Sbjct  140   ASTIPYEAIGFILTGKHKLGLPYFLLGMLRFWRIRRVKQFFTRLEKDIRFSYFWVRCARL  199

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  +HCAGCLYY LADRYPHQG  W+G++  N RE S + RYISA+YWS+TTMTTV
Sbjct  200   LSVTLFSIHCAGCLYYMLADRYPHQGNTWIGAVIPNFRETSPRTRYISAIYWSITTMTTV  259

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  260   GYGDLHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  319

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RL+EQILAYMCLRFKAE LNQ  LIEQLPK+ICKSIC HLF P VEKVYLFKGV
Sbjct  320   RNRLPPRLREQILAYMCLRFKAERLNQHQLIEQLPKSICKSICQHLFFPTVEKVYLFKGV  379

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EILL LVA + AEYIPP+EDVIMQNE+ +DVYIIVSGEVE+ID+ +E E+V+ TL +G
Sbjct  380   SKEILLSLVAKICAEYIPPKEDVIMQNEAAEDVYIIVSGEVEIIDSVIEKERVLGTLTTG  439

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             DMFGEVGALCCR QS+TYRTKTL+QLL+LKT +L+EA+Q+K+EDNI ++KNFLQH+K+LK
Sbjct  440   DMFGEVGALCCRSQSYTYRTKTLTQLLRLKTGALIEAMQIKKEDNILILKNFLQHYKQLK  499

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV  TGNA F+ ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  500   DLSIKDLIVENVEEE-DPNMAVNLLTVAGTGNAAFVEELLRAGLDPDIGDSKGKTPLHIA  558

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHEECV VLLKH CNIH+KDM GNTALW AIA+K +SIF ILY  +++SDPY AG+L
Sbjct  559   ASNGHEECVKVLLKHTCNIHIKDMNGNTALWYAIASKHYSIFRILYQLSALSDPYTAGNL  618

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             LC AAK ND +VM ELLK GL++DSKD HG   IQ AM EN  DM++LLVMNGA + D  
Sbjct  619   LCLAAKRNDLTVMNELLKQGLNIDSKDGHGMKPIQIAMTENLVDMVQLLVMNGASVLDMH  678

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVS  363
                 +   L E+LQKRE+GH I +   +  E   K   ++ ++   + ++C+     RVS
Sbjct  679   IPEFSASTLNELLQKREIGHLINVNEEMPSEFVLK--GENQEDQKQVWKRCNGVEFPRVS  736

Query  362   IYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             IYRGHP  RRE    E G+LIKLP+++ +L  IAGEK  FDA D+ +T+EEGA IDSIDV
Sbjct  737   IYRGHPIVRREKGFIEAGKLIKLPDSLEKLKIIAGEKFEFDARDAMVTNEEGAEIDSIDV  796

Query  182   IRDNDKLFIV  153
             IRDNDKL+IV
Sbjct  797   IRDNDKLYIV  806



>emb|CBI23771.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =  1065 bits (2755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/798 (69%), Positives = 647/798 (81%), Gaps = 36/798 (5%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
             + + F+   LSK ILPPLG S       + +G +ISPMDSRYRCWET+MV+LVAYS W+ 
Sbjct  37    DSKPFNSRNLSKVILPPLGVSSYNQNPLAPKGWIISPMDSRYRCWETFMVVLVAYSLWIY  96

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PF+++FL++  + +LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+   +KIA RYLST
Sbjct  97    PFQVAFLKASPNRQLYITDNVVDLFFAVDIVLTFFVAYIDRRTQLLVCDWRKIAVRYLST  156

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             WFLMD+AST+PFE +  L TGK  +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFW
Sbjct  157   WFLMDMASTMPFEALGSLITGKQKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFW  216

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSM  1809
             VRCARLL VTL LVHCAGCLYY LADRYPHQGK W+G++  N RE SL IRYISA+YWS+
Sbjct  217   VRCARLLSVTLFLVHCAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLWIRYISALYWSI  276

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TTMTTVGYGD+HAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+A
Sbjct  277   TTMTTVGYGDMHAVNTMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEA  336

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             ASNFV RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLFLP VEKV
Sbjct  337   ASNFVCRNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFLPTVEKV  396

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLFKG+SREILLLLVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID E E E VV
Sbjct  397   YLFKGISREILLLLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDYEGEKEHVV  456

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
              TL S DMFGEVGALCCRPQ++T+RTKTLSQLL+LKT++L+EA+Q K+EDN+ ++KNFLQ
Sbjct  457   GTLQSADMFGEVGALCCRPQTYTFRTKTLSQLLRLKTSALIEAMQTKKEDNVIILKNFLQ  516

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             HHK+LKDL +GDL +E G+ED +PNM+ NL TV +TGNA FL+ELLKA LDP+IGDSKG+
Sbjct  517   HHKRLKDLNIGDLLVENGEEDVNPNMAFNLLTVASTGNAAFLDELLKAKLDPDIGDSKGR  576

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             TPLHIAASKGHE+CVMVLLKH CN+H++D+ GNTALWDA++AK +SIF ILYH AS+SDP
Sbjct  577   TPLHIAASKGHEDCVMVLLKHACNVHVRDINGNTALWDAVSAKHNSIFWILYHCASLSDP  636

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
             Y +GDLLC AAK ND + M+ELLK GL++DSK+R G TAIQ AM E+  DM+KLLVMNGA
Sbjct  637   YTSGDLLCTAAKRNDLTAMKELLKQGLNIDSKNRQGLTAIQIAMAEDHTDMVKLLVMNGA  696

Query  548   EIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASK-WAKDDHQNSSSMPQQCSI  372
             ++  A                          NT   +   K +  +     +++P     
Sbjct  697   DVIHA--------------------------NTYEDQGGEKEFNTNGGFKGTNVP-----  725

Query  371   RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
             RVSIYRGHP  R+E+ C E GRLI+LP ++ EL +IAGEKLGFDA ++ +T+EEGA IDS
Sbjct  726   RVSIYRGHPLQRKESCCTEAGRLIRLPNSLMELKAIAGEKLGFDARNAMVTNEEGAEIDS  785

Query  191   IDVIRDNDKLFIVADWNS  138
             I+VIRDND LF+V D NS
Sbjct  786   IEVIRDNDTLFLVEDPNS  803



>emb|CAC05489.1| potassium channel 2 [Populus tremula x Populus tremuloides]
Length=830

 Score =  1060 bits (2742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/789 (68%), Positives = 642/789 (81%), Gaps = 10/789 (1%)
 Frame = -2

Query  2483  KFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             K ILPPLG S        S+G +ISP+ SRYRCW T M +LVAYS WV PFE++FL S  
Sbjct  32    KIILPPLGVSSFNQNPIESKGWIISPVGSRYRCWGTIMAVLVAYSLWVYPFEVAFLNSSP  91

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA RYLSTWFLMDVAST+P
Sbjct  92    YRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARRYLSTWFLMDVASTVP  151

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             FE +A+LFTG   +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFWVRCARLL VTL
Sbjct  152   FELLAYLFTGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWVRCARLLCVTL  211

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              LVHC GCLYY LADRYPH+GK W+G++  N RE SL IRYISAMYWS+TTMTTVGYGDL
Sbjct  212   FLVHCTGCLYYLLADRYPHKGKTWIGAVIPNFRETSLWIRYISAMYWSITTMTTVGYGDL  271

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA N++EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFVSRN LP
Sbjct  272   HAQNSMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVSRNRLP  331

Query  1595  ARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
              RLK+QILAYMCLRFKAE+LNQ  LIEQ PK+ICKSIC HLFLP V+KVYLF G+SRE L
Sbjct  332   PRLKDQILAYMCLRFKAENLNQHQLIEQQPKSICKSICLHLFLPTVKKVYLFDGISRETL  391

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
             L LVA +K EYIPPREDV+MQNE+PDD+YIIVSGEVE+I++ +E E+ V TL SGDMFGE
Sbjct  392   LQLVAKIKTEYIPPREDVVMQNEAPDDIYIIVSGEVEIIESHLEKERAVGTLRSGDMFGE  451

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             +GALCCRPQS  +RTKTLSQLL++KTT+LL+A+Q  ++D + ++KNFLQH+K+LK LK+G
Sbjct  452   LGALCCRPQSHLFRTKTLSQLLRIKTTALLKAMQTNQDDYVAIMKNFLQHYKRLKGLKIG  511

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
             DL +E G+E+ +PNM+ NL    +TGNA FL ELL+A LDP++GDSKG+TPLHIAASKGH
Sbjct  512   DLTVENGEEEDEPNMAFNLLATASTGNAAFLEELLRAKLDPDVGDSKGRTPLHIAASKGH  571

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             EECV+VLL+HGC+IHL+D+ GNTALW+AI++K HSIF IL+  AS+SDP+ AGDLLC AA
Sbjct  572   EECVVVLLRHGCDIHLRDVNGNTALWEAISSKHHSIFRILFQNASVSDPHAAGDLLCTAA  631

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA  516
             K ND  VM+ELLK GL+VDSKDRHG TA+Q AM EN  DM+ LLVM+GAE+ +A     +
Sbjct  632   KQNDLMVMKELLKQGLNVDSKDRHGKTALQVAMAENHGDMVNLLVMSGAEVAEANTHEFS  691

Query  515   PLDLTEVLQKRELGHRIAMPNTIL-HEAASKWAKDDHQNSSSMPQQCS-----IRVSIYR  354
                L E+LQKRE+GHRI +P+ +  +E   K  + + + +S   +        IRVSIYR
Sbjct  692   STSLNEMLQKREIGHRITVPDVLTANEVLLKRCEGEQECTSCTGKSKGSSSDCIRVSIYR  751

Query  353   GHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
             GHP  RR+T C E GRLIKLP ++ EL SIAGEK GFDA ++ +TDEEG+ +DSI+VIRD
Sbjct  752   GHPMVRRQTCCVEAGRLIKLPNSLEELKSIAGEKFGFDARNAMVTDEEGSEVDSIEVIRD  811

Query  173   NDKLFIVAD  147
              DKLFIV D
Sbjct  812   KDKLFIVED  820



>gb|AEY75251.1| potassium channel [Malus hupehensis]
Length=869

 Score =  1058 bits (2737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/797 (67%), Positives = 637/797 (80%), Gaps = 14/797 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA RYLSTWFL
Sbjct  125   VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIAMRYLSTWFL  184

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+AST+PFE + FL  GK+ L   YS LG+LRFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  185   MDLASTLPFEAL-FLALGKNKLSASYSFLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  244   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETGLWIRYISALYWSMTTM  303

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVNT+EMIFI FYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+
Sbjct  304   STVGYGDLHAVNTVEMIFITFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASS  363

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAESLNQQ ++EQ PK+ICKSIC HLFLP+VEKVYLF
Sbjct  364   FVCRNRLPQRLRDQILAYICLRFKAESLNQQQMLEQFPKSICKSICQHLFLPIVEKVYLF  423

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVSRE LL LVA MKAEY PPREDV++QNE+P+DVYIIVSGEVE+ID EME E+ V TL
Sbjct  424   RGVSRETLLHLVAKMKAEYTPPREDVVLQNEAPEDVYIIVSGEVEIIDCEMERERAVGTL  483

Query  1259  NSGDMFGEVGALC-------CRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
              SGDMFGEV A C       CRPQSFTYRTKTLSQLL++KTT+L+EA+Q K ED + M+K
Sbjct  484   QSGDMFGEVIAFCGREVGKLCRPQSFTYRTKTLSQLLRIKTTALVEAMQTKPEDKVQMLK  543

Query  1100  NFLQHHkklkdlklgdLFIEIGDEDG-DPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             NF QHHKKL+DL++G++ +E G+++G DP  + N+ T  + G+AT L+ELLKA LDP+IG
Sbjct  544   NFNQHHKKLRDLRVGEILVESGEDEGDDPKAAFNMLTAASKGDATLLDELLKAKLDPDIG  603

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D KG+TPLHIAASKGH ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY  A
Sbjct  604   DFKGRTPLHIAASKGHYECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFRSLYFCA  663

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDPY AGDLLC AAK N+ +VM+ELLK GL+VDSK++ G TA+Q AMEEN ADM+ LL
Sbjct  664   AISDPYTAGDLLCTAAKRNNLTVMEELLKQGLNVDSKNQLGKTAVQIAMEENNADMVNLL  723

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +A         LTE+LQKRE+GHRI +P++ ++E       + +    S   
Sbjct  724   VMNGADVTNAQNCLFPSQGLTEMLQKREVGHRITVPDSTINEVPLMKNGERNSGRESYGV  783

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGA  204
              C  RVSIYRGHP  R+ T C E GR+I+LP ++ EL +IAG K GFD+ +   TDE GA
Sbjct  784   NCP-RVSIYRGHPMVRKTTCCREAGRVIRLPRSLEELRNIAGVKFGFDSGNILATDEGGA  842

Query  203   IIDSIDVIRDNDKLFIV  153
              IDSI+VIRDNDKLF+V
Sbjct  843   EIDSIEVIRDNDKLFLV  859



>ref|XP_009355246.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Pyrus x bretschneideri]
Length=870

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/794 (67%), Positives = 640/794 (81%), Gaps = 11/794 (1%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  69    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  128

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA RYLSTWFL
Sbjct  129   VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIAMRYLSTWFL  188

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  189   MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  247

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  248   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETCLWIRYISALYWSMTTM  307

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVNT+EMIFIIFYMLF+LGLTAY+IGNMTNLVVEGTRRTMEFR+S++AAS+
Sbjct  308   STVGYGDLHAVNTVEMIFIIFYMLFDLGLTAYLIGNMTNLVVEGTRRTMEFRSSVEAASS  367

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAE+LNQQ ++EQ PK+ICKSIC HLFLP+VEKVYLF
Sbjct  368   FVCRNRLPQRLRDQILAYICLRFKAETLNQQQMLEQFPKSICKSICQHLFLPIVEKVYLF  427

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSRE LL LV +MKAEY PPREDV++QNE+P+DVYIIVSGEVE+ID EME E+VV TL
Sbjct  428   KGVSRETLLHLVVNMKAEYTPPREDVLLQNEAPEDVYIIVSGEVEIIDCEMERERVVGTL  487

Query  1259  NSGDMFGEVGALCCR---PQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
              SGDMFGEV A C R   PQSFTYRTKTLSQLL++KTT+L+EA+Q K  D   M+KNF Q
Sbjct  488   QSGDMFGEVIAFCGREVGPQSFTYRTKTLSQLLRIKTTALVEAMQTKPHDKEQMVKNFNQ  547

Query  1088  HHkklkdlklgdLFIEIG-DEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             HHKKL+DL++G++ +E G DE GDP  + N+ T  + G+AT L+ELLKA LDP+IGD KG
Sbjct  548   HHKKLRDLRVGEILVESGEDEGGDPKAAFNVLTAASKGDATLLDELLKAKLDPDIGDFKG  607

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAASKGH+ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY+ A+ISD
Sbjct  608   RTPLHIAASKGHDECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFQSLYYCAAISD  667

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             PY AGDLLC AAK ND +VM+ELLK GL+VDSK+  G TA+Q AMEEN ADM+ LLVMNG
Sbjct  668   PYTAGDLLCTAAKRNDLTVMEELLKQGLNVDSKNHLGKTAVQIAMEENNADMVNLLVMNG  727

Query  551   AEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAA-SKWAKDDHQNSSSMPQQCS  375
             A++ +A         LTE+LQKRE+GHRI +P + ++E    K  ++ +    S    C 
Sbjct  728   ADVTNAQNCLFPSQSLTEMLQKREVGHRITVPESTINEVPLMKNGEERNSGRESYGVNCP  787

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RVSIYRGHP  R+ T C E GR+I+LP ++ EL +IAG K GFD+ ++ +TDE GA ID
Sbjct  788   -RVSIYRGHPMVRKTTCCREAGRVIRLPRSLEELRNIAGVKFGFDSGNTLVTDEGGAEID  846

Query  194   SIDVIRDNDKLFIV  153
             SI+VIRDNDKLF+V
Sbjct  847   SIEVIRDNDKLFLV  860



>ref|NP_001291251.1| potassium channel AKT2/3 [Populus euphratica]
 gb|ACB56631.1| K+ channel protein [Populus euphratica]
Length=831

 Score =  1053 bits (2722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/790 (69%), Positives = 639/790 (81%), Gaps = 13/790 (2%)
 Frame = -2

Query  2483  KFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             K ILPPLG S        S+G +ISP+DSRYRCW T M +LVAYS WV PFE++FL S  
Sbjct  34    KIILPPLGVSSFNQNPIESKGWIISPVDSRYRCWGTIMAVLVAYSLWVYPFEVAFLNSSP  93

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA RYLSTWFLMDVAST+P
Sbjct  94    YRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARRYLSTWFLMDVASTVP  153

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             FE +A+L TG   +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFWVRCARLL VTL
Sbjct  154   FELLAYLITGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWVRCARLLCVTL  213

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              LVHCAGCLYY LADRYPH+GK W+G++  N RE SL IRYISAMYWS+TTMTTVGYGDL
Sbjct  214   FLVHCAGCLYYLLADRYPHKGKTWIGAVIPNFRETSLWIRYISAMYWSITTMTTVGYGDL  273

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA N +EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFVSRN LP
Sbjct  274   HAQNAMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVSRNRLP  333

Query  1595  ARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
              RLK+QILAYMCLRFKAE+LNQ  LIEQLPK+ICK IC HLFLP V+KVYLF+G+SRE L
Sbjct  334   PRLKDQILAYMCLRFKAENLNQNQLIEQLPKSICKCICQHLFLPTVKKVYLFQGISRETL  393

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
             L LVA +KAEYIPPREDV+MQNE+PDDVYIIVSGEVE+I++ +   +++  L SGDMFGE
Sbjct  394   LHLVAKIKAEYIPPREDVVMQNEAPDDVYIIVSGEVEIIESYLRKNELL-DLRSGDMFGE  452

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             VGAL CRPQS   RT+TLSQLL++KTT+L+EA+Q  ++D I +IKNFLQH+K LKDLK+G
Sbjct  453   VGALGCRPQSHICRTRTLSQLLRIKTTALIEAMQTNQDDYIAIIKNFLQHYKGLKDLKIG  512

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
             DL +E G+ED DPNM+ NL    +TGNA FL ELLKA LDP+IGDSKG+TPLHIAASKGH
Sbjct  513   DLTVENGEEDDDPNMASNLLATASTGNAAFLEELLKAKLDPDIGDSKGRTPLHIAASKGH  572

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             EECV+VLL+HGC+IHL+D+ GNTALW+AI++K  SIF IL+H+AS+SDP+ AGDLLC AA
Sbjct  573   EECVVVLLRHGCDIHLRDVNGNTALWEAISSKHLSIFRILFHYASVSDPHAAGDLLCTAA  632

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA  516
             K ND  VM+ELLK GL +DSK+RHG TA+Q AM EN  DM+ LLVMNGAE+ +A    L+
Sbjct  633   KQNDLMVMKELLKQGLDIDSKNRHGKTALQVAMAENHGDMVNLLVMNGAEVAEANTHELS  692

Query  515   PLDLTEVLQKRELGHRIAMPNTIL-HEAASKWAKDDHQ------NSSSMPQQCSIRVSIY  357
                L E+LQKRE+GHRI +P+ +  +E   K  + + +       S      C +RVSIY
Sbjct  693   STSLNEMLQKREIGHRITVPDVLTANEVLLKRCEGEQECTLCTGKSKGSSADC-VRVSIY  751

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  RR+T   E GRLIKLP ++ EL SIAGEK GFDA ++ +TDEEG+ +DSI+VIR
Sbjct  752   RGHPMVRRQTCSMEAGRLIKLPNSLEELKSIAGEKFGFDARNAMVTDEEGSEVDSIEVIR  811

Query  176   DNDKLFIVAD  147
             D DKLFIV D
Sbjct  812   DKDKLFIVED  821



>ref|XP_008378877.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Malus domestica]
Length=869

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/797 (66%), Positives = 637/797 (80%), Gaps = 14/797 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA RYL+TWFL
Sbjct  125   VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIAMRYLTTWFL  184

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  185   MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  244   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETGLWIRYISALYWSMTTM  303

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVN +EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+
Sbjct  304   STVGYGDLHAVNXVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASS  363

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAESLNQQ ++EQ PK+ICKSIC HLFLP+VEKVYLF
Sbjct  364   FVCRNRLPQRLRDQILAYICLRFKAESLNQQQMLEQFPKSICKSICQHLFLPIVEKVYLF  423

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVSRE LL LVA MKAEYIPPREDV++Q+E+P+DVYIIVSGEVE+ID EME E+ V TL
Sbjct  424   RGVSRETLLHLVAKMKAEYIPPREDVVLQSEAPEDVYIIVSGEVEIIDCEMERERAVGTL  483

Query  1259  NSGDMFGEVGALC-------CRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
              SGDM GEV A C       CRPQ+FTYRTKTLSQLL++KTT+L+EA+Q K ED + M+K
Sbjct  484   QSGDMVGEVTAFCGIEVGKLCRPQTFTYRTKTLSQLLRIKTTALVEAMQTKPEDKVXMLK  543

Query  1100  NFLQHHkklkdlklgdLFIEIGDEDG-DPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             NF QHHKKL+DL++G++ +E G+++G DP  + N+ T  + G+AT L+ELLKA LDP+IG
Sbjct  544   NFNQHHKKLRDLRVGEILVESGEDEGDDPKAAFNMLTAASKGDATLLDELLKAKLDPDIG  603

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D KG+TPLHIAASKGH ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY  A
Sbjct  604   DFKGRTPLHIAASKGHYECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFRSLYFCA  663

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDPY AGDLLC AAK N+ +VM+ELLK GL+VDSK++ G TA+Q AMEEN ADM+ LL
Sbjct  664   AISDPYTAGDLLCTAAKRNNLTVMEELLKQGLNVDSKNQLGKTAVQIAMEENNADMVNLL  723

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +A         LTE+LQKRE+GHRI +P++ ++E       + +    S   
Sbjct  724   VMNGADVTNAQNCLFPSQSLTEMLQKREVGHRITVPDSTINEVPLMKNGERNSGRESYGV  783

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGA  204
              C  RVSIYRGHP  R+ T C E GR+I+LP ++ EL + AG K GFD+ +  +TDE GA
Sbjct  784   NCP-RVSIYRGHPMVRKTTCCREAGRVIRLPXSLEELRNXAGVKFGFDSGNILVTDEGGA  842

Query  203   IIDSIDVIRDNDKLFIV  153
              IDSI+VIRDNDKLF+V
Sbjct  843   EIDSIEVIRDNDKLFLV  859



>ref|XP_010065457.1| PREDICTED: potassium channel AKT2/3 [Eucalyptus grandis]
 gb|KCW62963.1| hypothetical protein EUGRSUZ_G00560 [Eucalyptus grandis]
Length=832

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/800 (66%), Positives = 625/800 (78%), Gaps = 22/800 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTS--SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG+S  +     S+G V+SPMDSRYRCWET+MV+LV YSAWV PFE+
Sbjct  42    LSLKNLSKLILPPLGASTDSQNQIESRGRVLSPMDSRYRCWETFMVVLVFYSAWVFPFEV  101

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL+S  +  LY+ DN+VD FFAVDI+LTFFVAYIDP TQLL+   ++IATRYLSTWFLM
Sbjct  102   AFLDSSPNRGLYIADNVVDSFFAVDIILTFFVAYIDPRTQLLVRDSRRIATRYLSTWFLM  161

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVAST+PFE + +LF+GK  + +  S+LG+LRFWRLRRV   FTRLEKDIRF+YFWVRC 
Sbjct  162   DVASTLPFEALGYLFSGKPKVVLSCSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWVRCT  221

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMT  1797
             RLL VT+ L HCA CL Y LADRYPHQGK WLG++N   RE SL IRYISA+YWS+TTMT
Sbjct  222   RLLLVTVFLAHCASCLCYLLADRYPHQGKTWLGAVNPNFRETSLWIRYISALYWSVTTMT  281

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA+NF
Sbjct  282   TVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAANNF  341

Query  1616  VSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFK  1437
             V RN LP RLKEQILAYMCLRF+AESLNQ  LIEQLPK+ICKSIC HLFLP VE VYLFK
Sbjct  342   VCRNRLPPRLKEQILAYMCLRFRAESLNQHQLIEQLPKSICKSICQHLFLPTVETVYLFK  401

Query  1436  GVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN  1257
             GVSRE LLLLVA MKAEY+PPREDVIMQNE+P+DVYIIVSGEVE+ + E E EQV   L 
Sbjct  402   GVSRETLLLLVAKMKAEYLPPREDVIMQNEAPEDVYIIVSGEVEIFNCETEREQVAGALQ  461

Query  1256  SGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkk  1077
             SGD+FGEVGALCCRPQ +TYRTK+LSQLL+LK   L+EA+  +  DNIT+IKNFLQHHK+
Sbjct  462   SGDIFGEVGALCCRPQDYTYRTKSLSQLLRLKRNDLIEAMHSQHNDNITVIKNFLQHHKE  521

Query  1076  lkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             LKDL + D F + G E  D    ++L TV +TGNA  L +LLKA LDP++G+ +GKT LH
Sbjct  522   LKDLCIEDFFTDAGHEHDD----LHLLTVASTGNAAILEKLLKAKLDPDVGNLEGKTSLH  577

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAAS GHE+CV +LLK+GCN+HL+D  GN ALW AI++K+HSIF +LY  A+ SDP  AG
Sbjct  578   IAASLGHEDCVWLLLKNGCNMHLRDRNGNNALWHAISSKQHSIFRVLYSCAASSDPCTAG  637

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
             DLLC AAK ND  VM+ELL HGL++DS +  G TA+Q AM EN  DM+ LLVMNGA + +
Sbjct  638   DLLCTAAKRNDLEVMKELLNHGLNIDSMNHQGFTALQIAMAENHEDMVNLLVMNGANVAN  697

Query  536   AVKLNLAPLDLTEVLQKRELGHRIAMPNTI--------LHEAASKWAKDDHQNSSSMPQQ  381
             +   +  P  L E+L +RE GHRIA+ +          +HE   +      Q  S M   
Sbjct  698   SNLPDFPPEALNEMLSRRETGHRIAVSDGATLQDMPMRMHEVERELT----QEKSDMA--  751

Query  380   CSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
                RVSIYRGHP  RRE +C E GRLI+LP +I +L SIAG+K GFDAT++ + DEEGA 
Sbjct  752   ICARVSIYRGHPVARRENRCAEAGRLIRLPGSIEDLKSIAGKKFGFDATNTIIVDEEGAE  811

Query  200   IDSIDVIRDNDKLFIVADWN  141
             ID I+VIRDNDKLF+V D N
Sbjct  812   IDCIEVIRDNDKLFVVEDSN  831



>ref|XP_006585489.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Glycine max]
Length=808

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/786 (66%), Positives = 619/786 (79%), Gaps = 31/786 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  2325
             F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  45    FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  2324  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  2145
             +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  R          
Sbjct  105   MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVR----------  154

Query  2144  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARL  1965
                               +G+ Y +LG+LRFWR+RRV  +FTRLEKDIRFSYFWVRCARL
Sbjct  155   ----------------QKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRCARL  198

Query  1964  LFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTV  1791
             L VTL  VHCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTMTTV
Sbjct  199   LSVTLFSVHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTV  258

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV 
Sbjct  259   GYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVC  318

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLF   VEKVYLFKGV
Sbjct  319   RNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFFATVEKVYLFKGV  378

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S+EI+L LVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE++D E E E+++ TL++G
Sbjct  379   SKEIILSLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEILDTETEKERILGTLHTG  438

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             +MFGE GALCCRPQS TYRTKTL+QLL+LKT +LLEA+Q+KREDNI ++KNFLQH K++K
Sbjct  439   EMFGEFGALCCRPQSLTYRTKTLTQLLRLKTNTLLEAMQIKREDNIQILKNFLQHFKQVK  498

Query  1070  dlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
             DL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIA
Sbjct  499   DLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIA  557

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             AS GHE CV VLLKH CN+H+KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL
Sbjct  558   ASNGHEGCVKVLLKHACNMHIKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDL  617

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
             +C AAK N+ +VM +LL+ GL+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D  
Sbjct  618   MCTAAKRNELTVMTDLLRQGLNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVH  677

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIY  357
                     L E+LQKRE+GH I +   +L E   K    + +H    S       RVSIY
Sbjct  678   NHEFCSSTLNEMLQKREIGHLINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIY  737

Query  356   RGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
             RGHP  RRE    E G+LI+LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIR
Sbjct  738   RGHPVVRREKCSMEAGKLIRLPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIR  797

Query  176   DNDKLF  159
             DNDKLF
Sbjct  798   DNDKLF  803



>ref|XP_004299918.1| PREDICTED: potassium channel AKT2/3-like [Fragaria vesca subsp. 
vesca]
Length=843

 Score =  1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/804 (68%), Positives = 646/804 (80%), Gaps = 24/804 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             ++ +L  LSK ILPPLG+S    T   S+G +ISPMDSRYR WE +MVLLVAYSAWV PF
Sbjct  43    DELNLRNLSKLILPPLGASSYNQTQMQSKGYIISPMDSRYRSWEVFMVLLVAYSAWVYPF  102

Query  2336  EISFLESKLDTK---LYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
             E++FL S   T    LY+ D IVDLFF +DIVLTFFVAYIDP TQLL+    KIA RYLS
Sbjct  103   EVAFLNSTTGTSINPLYLADYIVDLFFGIDIVLTFFVAYIDPRTQLLVLDSNKIAIRYLS  162

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWF MD+AST+PFE +     G+H LG+ YS+LG+LRFWRLRR    FTRLEKDIRFSYF
Sbjct  163   TWFFMDLASTLPFEVI-----GRHKLGLSYSLLGLLRFWRLRRAKKLFTRLEKDIRFSYF  217

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWS  1812
             WVRCARLL VTLL VHCAGCLYY LADRYPH+G+ W+G++  N RE SL IRYISA+YWS
Sbjct  218   WVRCARLLSVTLLSVHCAGCLYYLLADRYPHEGRTWIGAVIPNFRETSLWIRYISALYWS  277

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTM+TVGYGDLHAVNT+EMIFII YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS++
Sbjct  278   ITTMSTVGYGDLHAVNTMEMIFIILYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSVE  337

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AASNFVSRN LP RLK+QILAY+CLRFKAESLNQQ +IEQLPK+ICKSIC +LFLP VEK
Sbjct  338   AASNFVSRNRLPPRLKDQILAYICLRFKAESLNQQQIIEQLPKSICKSICQYLFLPTVEK  397

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKGVSREILL+LVA+MKAEYIPPREDV+MQNE+PDD+YIIVSGEVE+ID EM+ E V
Sbjct  398   VYLFKGVSREILLILVANMKAEYIPPREDVVMQNEAPDDIYIIVSGEVEIIDCEMDKELV  457

Query  1271  VWTLNSGDMFGEV--------GALCCRPQSFTYRtktlsqllklkttslLEALQMKREDN  1116
             V TL SGDMFGEV        GALCCRPQSFTYRTKTLSQLL+LKTT+L+EA++ K+EDN
Sbjct  458   VGTLKSGDMFGEVGALCCREVGALCCRPQSFTYRTKTLSQLLRLKTTALIEAMRTKQEDN  517

Query  1115  ITMIKNFLQHHkklkdlklgdLFIEIGDED--GDPNMSINLFTVVATGNATFLNELLKAG  942
               M+KNF QHH+KL+ LKLG++ +E G+E+  GD N++ +L TV + GNA  L ELLK+ 
Sbjct  518   AQMLKNFKQHHRKLRVLKLGEILVESGEEEAMGDSNLAFDLMTVASKGNAALLEELLKSK  577

Query  941   LDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFS  762
             LDP+IGDSKG+TPLH+AAS GHEECV+VLLK+ CNIH++DM GNTALW+AIA+K HSIF 
Sbjct  578   LDPDIGDSKGRTPLHVAASNGHEECVLVLLKYACNIHVRDMNGNTALWEAIASKHHSIFK  637

Query  761   ILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQA  582
             IL ++A+ S PY AGDLLC A + ND ++M+ELLKH LHVDSKD +G TA+Q AMEEN  
Sbjct  638   ILNYYATFSYPYTAGDLLCTAVRRNDLTMMKELLKHELHVDSKDCNGKTAVQVAMEENNV  697

Query  581   DMIKLLVMNGAEIDDAVKLNLAPLD-LTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ  405
             DM+ LLVMNGA+I +     L P   L+++LQKRE+GHRI +P++I+ E        +  
Sbjct  698   DMVNLLVMNGADITNVSHDYLFPSQTLSDMLQKREVGHRITVPDSIVTEMLLFRNDGEKN  757

Query  404   NSSSMPQQCSI-RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDS  228
               S +  + +  RVSIYRGHP TR    C E GRLI+LP ++ EL +IAGEK GFD  + 
Sbjct  758   VDSKISNKVNFPRVSIYRGHPVTRSNACCTEAGRLIRLPHSLEELKNIAGEKFGFDPGNV  817

Query  227   SLTDEEGAIIDSIDVIRDNDKLFI  156
              +TDEEGA ID I+VIRDNDKLFI
Sbjct  818   IITDEEGAEIDCIEVIRDNDKLFI  841



>ref|XP_010277671.1| PREDICTED: potassium channel AKT2/3-like [Nelumbo nucifera]
Length=838

 Score =  1028 bits (2659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/803 (65%), Positives = 633/803 (79%), Gaps = 16/803 (2%)
 Frame = -2

Query  2516  EDED--FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  2349
             ED+D    L  LSK ILPPLG  SS      S+G +ISPMDSRYRCWET+MVLLVAYSAW
Sbjct  38    EDDDAPLDLRYLSKIILPPLGDSSSNLNQIKSKGWIISPMDSRYRCWETFMVLLVAYSAW  97

Query  2348  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  2169
             V PFE++FL++     LY+ D IVDLFFA+DIVLTFF+AYIDP TQLL+   +KIA RYL
Sbjct  98    VYPFEVAFLKATPTRGLYIADTIVDLFFAIDIVLTFFLAYIDPRTQLLVRDSRKIAVRYL  157

Query  2168  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSY  1989
             STWF+MDVASTIPFE +AFLFTGK  +G+ Y +LG+LRFWRLRRV  FFTRLEKDIRFSY
Sbjct  158   STWFIMDVASTIPFEALAFLFTGKSKVGLSYCILGLLRFWRLRRVKQFFTRLEKDIRFSY  217

Query  1988  FWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYW  1815
             F +RC  LL VTL L+HCAGCLYYF+ADRYPHQG+ W+GS+  N  E ++  RYI+A+YW
Sbjct  218   FLIRCTTLLSVTLFLIHCAGCLYYFMADRYPHQGRTWIGSVMTNFSEANVWTRYITAIYW  277

Query  1814  SMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI  1635
             S TTMTTVGYGDLHAVN+ EMIF  FYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI
Sbjct  278   STTTMTTVGYGDLHAVNSTEMIFNTFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSI  337

Query  1634  QAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             QAAS+FVSRNHLP RLK  ILAYMCLRF+AE LNQQ LIEQLPK+IC  IC HLFLP VE
Sbjct  338   QAASSFVSRNHLPRRLKHHILAYMCLRFRAECLNQQQLIEQLPKSICTGICQHLFLPTVE  397

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             KVYLFKGVSREILLLLVA+MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+E E E+
Sbjct  398   KVYLFKGVSREILLLLVANMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSETEKER  457

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             V+  L +GD+FGEVGALC RPQSFT+RTKTLSQLL+LK ++L+EA+  K  DN  +++NF
Sbjct  458   VMGVLKTGDIFGEVGALCLRPQSFTFRTKTLSQLLRLKKSALIEAMHAKAHDNKLILRNF  517

Query  1094  LQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             L+H K+L+DL + D+  E G  DGDPNM+ +L TV + GNA  L+ELLKA LDP+I DSK
Sbjct  518   LEHFKELRDLSIHDILTENGG-DGDPNMAADLLTVASGGNAALLDELLKAKLDPDIEDSK  576

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+TPLH+AAS+GHEECV+VLLKHGC I+ +D++GNT LWDA+AA  HSIF ILYH++SIS
Sbjct  577   GRTPLHMAASRGHEECVLVLLKHGCKINTQDVDGNTPLWDAVAANHHSIFRILYHFSSIS  636

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
             DPY  GDLLC AA+ ND   M +LLKHGL+V+SK+R G  A+Q A++ +  DM+ LLV N
Sbjct  637   DPYTDGDLLCTAARRNDLQTMNKLLKHGLNVNSKNRDGVAALQIAVDGDYVDMVNLLVTN  696

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTIL-HEAASKWAKDDHQNSSSMPQQC  378
             GA+   A +   +     E++QK E G+RI     IL H+A     +   +   S  ++ 
Sbjct  697   GAKAYQANQNGHS----DEMMQKPEGGYRITGSEAILPHDALVGRFRKMQEGKESRERRS  752

Query  377   S----IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEE  210
             +    +RV+IY+GHP  RR +   + GRLIKLP ++ EL  IAGEK GFD  D+ +T+EE
Sbjct  753   NGGNCLRVNIYKGHPTVRRYSFGRDAGRLIKLPNSMEELKRIAGEKFGFDPKDAIVTNEE  812

Query  209   GAIIDSIDVIRDNDKLFIVADWN  141
             G+II+SI+VIRDN+KLFI  + N
Sbjct  813   GSIIESIEVIRDNEKLFIAENTN  835



>ref|XP_010539347.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Tarenaya hassleriana]
Length=801

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/782 (68%), Positives = 628/782 (80%), Gaps = 27/782 (3%)
 Frame = -2

Query  2471  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  42    PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  101

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
             Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  102   YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  161

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
              +L TGK +L +  S+LG+LRFWR+RRV + FTRLEKDIRFSYFWVRC RLL VTLLLVH
Sbjct  162   GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRCLRLLSVTLLLVH  221

Query  1937  CAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVN  1764
             CAGCLYY LADRYPHQGK W+G++  N RE SL +RYISA+YWS+TTMTTVGYGDLHAVN
Sbjct  222   CAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLSVRYISAIYWSITTMTTVGYGDLHAVN  281

Query  1763  TLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLK  1584
             T+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV RN LPARLK
Sbjct  282   TMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFVCRNRLPARLK  341

Query  1583  EQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             EQILAYMCL+FKAE+LNQQ LIEQLPK+I KSIC HLFLP VEKVYLFKGVS EILLLLV
Sbjct  342   EQILAYMCLKFKAENLNQQHLIEQLPKSIYKSICQHLFLPSVEKVYLFKGVSPEILLLLV  401

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             + MKAEYIPPREDVIMQNESPDDVY+I+SGEVE++D+EME E V+ TL SGD+FGEVGAL
Sbjct  402   SKMKAEYIPPREDVIMQNESPDDVYVIISGEVEIVDSEMERESVLGTLRSGDIFGEVGAL  461

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             CCRP SFT+RTK+LSQLL+LKTTSL+E +Q K+ DN+TM+KNFLQHHKKL DL  G+   
Sbjct  462   CCRPHSFTFRTKSLSQLLRLKTTSLIETIQTKQHDNVTMLKNFLQHHKKLNDLNFGEQLA  521

Query  1043  EIG-DEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEEC  867
             E G +E+ DPNM+ NL TV + GNA  L+ELLKA LDP+I DS G+TPLH+AASKG EEC
Sbjct  522   EGGEEEESDPNMASNLLTVASAGNAALLDELLKAKLDPDIVDSNGRTPLHVAASKGFEEC  581

Query  866   VMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMN  687
             V++LLKHGCNIH++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N
Sbjct  582   VLILLKHGCNIHVRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQN  641

Query  686   DSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD  507
             +  VM++LLK GL++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +   
Sbjct  642   NLEVMKDLLKLGLNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSST  701

Query  506   LTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRET  327
               E++ +RE  +R  +      +A  K A                RVSI+RGHP  RR  
Sbjct  702   FDEMMLEREARNRTNV------QAGEKRA----------------RVSIFRGHPLERRGL  739

Query  326   QCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
                E G+LI LP ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V +
Sbjct  740   GFAEYGKLIMLPSSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEE  799

Query  146   WN  141
              N
Sbjct  800   DN  801



>ref|XP_010539338.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Tarenaya hassleriana]
Length=807

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/782 (68%), Positives = 628/782 (80%), Gaps = 27/782 (3%)
 Frame = -2

Query  2471  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  48    PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  107

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
             Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  108   YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  167

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
              +L TGK +L +  S+LG+LRFWR+RRV + FTRLEKDIRFSYFWVRC RLL VTLLLVH
Sbjct  168   GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRCLRLLSVTLLLVH  227

Query  1937  CAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVN  1764
             CAGCLYY LADRYPHQGK W+G++  N RE SL +RYISA+YWS+TTMTTVGYGDLHAVN
Sbjct  228   CAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLSVRYISAIYWSITTMTTVGYGDLHAVN  287

Query  1763  TLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLK  1584
             T+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV RN LPARLK
Sbjct  288   TMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFVCRNRLPARLK  347

Query  1583  EQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             EQILAYMCL+FKAE+LNQQ LIEQLPK+I KSIC HLFLP VEKVYLFKGVS EILLLLV
Sbjct  348   EQILAYMCLKFKAENLNQQHLIEQLPKSIYKSICQHLFLPSVEKVYLFKGVSPEILLLLV  407

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             + MKAEYIPPREDVIMQNESPDDVY+I+SGEVE++D+EME E V+ TL SGD+FGEVGAL
Sbjct  408   SKMKAEYIPPREDVIMQNESPDDVYVIISGEVEIVDSEMERESVLGTLRSGDIFGEVGAL  467

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             CCRP SFT+RTK+LSQLL+LKTTSL+E +Q K+ DN+TM+KNFLQHHKKL DL  G+   
Sbjct  468   CCRPHSFTFRTKSLSQLLRLKTTSLIETIQTKQHDNVTMLKNFLQHHKKLNDLNFGEQLA  527

Query  1043  EIG-DEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEEC  867
             E G +E+ DPNM+ NL TV + GNA  L+ELLKA LDP+I DS G+TPLH+AASKG EEC
Sbjct  528   EGGEEEESDPNMASNLLTVASAGNAALLDELLKAKLDPDIVDSNGRTPLHVAASKGFEEC  587

Query  866   VMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMN  687
             V++LLKHGCNIH++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N
Sbjct  588   VLILLKHGCNIHVRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQN  647

Query  686   DSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD  507
             +  VM++LLK GL++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +   
Sbjct  648   NLEVMKDLLKLGLNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSST  707

Query  506   LTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRET  327
               E++ +RE  +R  +      +A  K A                RVSI+RGHP  RR  
Sbjct  708   FDEMMLEREARNRTNV------QAGEKRA----------------RVSIFRGHPLERRGL  745

Query  326   QCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
                E G+LI LP ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V +
Sbjct  746   GFAEYGKLIMLPSSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEE  805

Query  146   WN  141
              N
Sbjct  806   DN  807



>ref|XP_008783360.1| PREDICTED: potassium channel AKT2 [Phoenix dactylifera]
Length=844

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/804 (64%), Positives = 632/804 (79%), Gaps = 19/804 (2%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  2346
             + +  F+L  LSK +LPPLG+     T   S+G +ISPMDSRYRCWE +MV+LVAYSAWV
Sbjct  35    KHEASFNLRTLSKLVLPPLGALGYNQTQVESRGRIISPMDSRYRCWEAFMVILVAYSAWV  94

Query  2345  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
              PFE++F+ S     L + D+I D+FFA+DIVLTFF+AYID  TQLL+   K+IA RYLS
Sbjct  95    YPFEVAFMNSSPKGVLCITDSITDIFFAIDIVLTFFLAYIDSKTQLLVQDPKRIAIRYLS  154

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWF+MDVASTIPFE + +L TG+   G+ YS+LGMLR WRLR+V  FFTRLEKDIRFSYF
Sbjct  155   TWFIMDVASTIPFEGLGYLITGEIKEGISYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYF  214

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWS  1812
             W+RCARLL VTL LVHCAGCLYY LADRYPHQGK W+G++N   RE SL IRYIS++YWS
Sbjct  215   WIRCARLLSVTLFLVHCAGCLYYLLADRYPHQGKTWIGAVNPNFREASLSIRYISSLYWS  274

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTMTTVGYGDLHAVNT EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQ
Sbjct  275   ITTMTTVGYGDLHAVNTREMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQ  334

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AASNFV RNHLP RLK+QILAYMCLRF+AESLNQQ L++QLP +ICKSIC HLFLPV++ 
Sbjct  335   AASNFVCRNHLPPRLKQQILAYMCLRFRAESLNQQQLMDQLPNSICKSICEHLFLPVIKD  394

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKGVSRE+LLLLV  MKAEYIPP+EDVIMQNE+PDDVY++VSG+VE+I ++ E EQV
Sbjct  395   VYLFKGVSREMLLLLVTKMKAEYIPPKEDVIMQNEAPDDVYVVVSGQVEIIYSDNEREQV  454

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             +  L +GD+FGEV ALC RPQ FT+RT+TLSQLL+LK ++L EA+Q K+ED++ +I+NFL
Sbjct  455   LGALRTGDIFGEVSALCDRPQDFTFRTRTLSQLLRLKQSTLREAMQTKQEDSVVIIRNFL  514

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +H  + K++++ DL  E  DE  + N+  NL TV ATGN++FL ELLKAG+DP+ GDSKG
Sbjct  515   KHQIECKNIRIEDLLGE-SDEYDEANIPCNLLTVAATGNSSFLEELLKAGMDPDTGDSKG  573

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAASKG+E+CV+VLLKH  NI+++DMEGNT LW AI AK H IF+ILYH+A  S+
Sbjct  574   RTPLHIAASKGYEDCVLVLLKHASNINIQDMEGNTLLWLAITAKHHKIFNILYHYACNSN  633

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             P+V G+LLC AAK ND S M+ELLKHGL ++S++  G T++QAA  EN  DMIK LVMNG
Sbjct  634   PHVGGNLLCLAAKRNDLSTMKELLKHGLDINSENNEGLTSLQAAFAENHTDMIKFLVMNG  693

Query  551   AEIDDAVKLNLAPL--------DLTEVLQKRELGHRIAMPNTILHEAASKWAKDD-HQNS  399
             A +++   +NL+ L        DL E++QKRE+G+ IA+  +      +K ++++ H   
Sbjct  694   ANVEN---INLSNLETRKMTQADLQELVQKREVGYPIAILESHEELKQTKVSEEESHMMK  750

Query  398   SSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLT  219
                      RVSIY+GHP  R    C E G+LI LP TI +L  IAG+K G  A  + +T
Sbjct  751   WGTRDGLYPRVSIYKGHPLLR--NSCLEAGKLINLPSTIEDLREIAGKKFGVVANSTVIT  808

Query  218   DEEGAIIDSIDVIRDNDKLFIVAD  147
             +EEGA IDSI+VIRDNDKLFIV +
Sbjct  809   NEEGAEIDSIEVIRDNDKLFIVEN  832



>ref|XP_010539356.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Tarenaya hassleriana]
Length=794

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/782 (66%), Positives = 619/782 (79%), Gaps = 40/782 (5%)
 Frame = -2

Query  2471  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  48    PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  107

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
             Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  108   YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  167

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
              +L TGK +L +  S+LG+LRFWR+RRV + FTRLEKDIRFSYFWVRC RLL VTLLLVH
Sbjct  168   GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRCLRLLSVTLLLVH  227

Query  1937  CAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVN  1764
             CAGCLYY LADRYPHQGK W+G++  N RE SL +RYISA+YWS+TTMTTVGYGDLHAVN
Sbjct  228   CAGCLYYLLADRYPHQGKTWIGAVIPNFRETSLSVRYISAIYWSITTMTTVGYGDLHAVN  287

Query  1763  TLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLK  1584
             T+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV RN LPARLK
Sbjct  288   TMEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFVCRNRLPARLK  347

Query  1583  EQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             EQILAYMCL+FKAE+LNQQ LIEQLPK+I KSIC HLFLP VEKVYLFKGVS EILLLLV
Sbjct  348   EQILAYMCLKFKAENLNQQHLIEQLPKSIYKSICQHLFLPSVEKVYLFKGVSPEILLLLV  407

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             + MKAEYIPPREDVIMQNESPDDVY+I+SGEVE++D+EME E V+ TL SGD+FGEVGAL
Sbjct  408   SKMKAEYIPPREDVIMQNESPDDVYVIISGEVEIVDSEMERESVLGTLRSGDIFGEVGAL  467

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             CCRP SFT+RTK+LSQLL+LKTTSL+E +Q K+ DN+TM+KNFLQ               
Sbjct  468   CCRPHSFTFRTKSLSQLLRLKTTSLIETIQTKQHDNVTMLKNFLQ-------------LA  514

Query  1043  EIG-DEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEEC  867
             E G +E+ DPNM+ NL TV + GNA  L+ELLKA LDP+I DS G+TPLH+AASKG EEC
Sbjct  515   EGGEEEESDPNMASNLLTVASAGNAALLDELLKAKLDPDIVDSNGRTPLHVAASKGFEEC  574

Query  866   VMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMN  687
             V++LLKHGCNIH++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N
Sbjct  575   VLILLKHGCNIHVRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQN  634

Query  686   DSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD  507
             +  VM++LLK GL++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +   
Sbjct  635   NLEVMKDLLKLGLNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSST  694

Query  506   LTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRET  327
               E++ +RE  +R  +      +A  K A                RVSI+RGHP  RR  
Sbjct  695   FDEMMLEREARNRTNV------QAGEKRA----------------RVSIFRGHPLERRGL  732

Query  326   QCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
                E G+LI LP ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V +
Sbjct  733   GFAEYGKLIMLPSSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEE  792

Query  146   WN  141
              N
Sbjct  793   DN  794



>gb|KFK28793.1| hypothetical protein AALP_AA7G048900 [Arabis alpina]
Length=789

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/802 (64%), Positives = 629/802 (78%), Gaps = 57/802 (7%)
 Frame = -2

Query  2519  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  2361
             +E+E++     SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE++MVLLVA
Sbjct  29    REEEEYDASSLSLNNLSKLILPPLGVASYNQNHICSSGWIISPMDSRYRCWESFMVLLVA  88

Query  2360  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  2181
             YSAWV PFE++FL S     L + DNIVDLFF VDIVLTFFVAYID  TQLL+   K+IA
Sbjct  89    YSAWVYPFEVAFLNSSPKRNLCIADNIVDLFFTVDIVLTFFVAYIDQRTQLLVREPKQIA  148

Query  2180  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDI  2001
              RYLSTWFLMDVASTIPF+ + +L TG   L +  S+LG+LRFWRLRRV N FTRLEKDI
Sbjct  149   VRYLSTWFLMDVASTIPFDAIGYLVTGTSKLKLTCSLLGLLRFWRLRRVKNLFTRLEKDI  208

Query  2000  RFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISA  1824
             R+SYFWVRC RLL VTL LVHCAGC+YY LADRYP+QGK W+  + ++R++SL I+YI+A
Sbjct  209   RYSYFWVRCLRLLCVTLFLVHCAGCIYYLLADRYPNQGKTWIDDIPSIRDKSLSIKYIAA  268

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHA NT+EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  269   IYWSITTMTTVGYGDLHARNTIEMLFITAYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFR  328

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSIQAASNFV+RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP
Sbjct  329   NSIQAASNFVNRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIHKSICQHLFLP  388

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              VEKVYLFKG+SREILLL+V+ MKAEYIPPREDVIMQNESPDDVYIIVSGEVE+ID+EME
Sbjct  389   SVEKVYLFKGISREILLLMVSKMKAEYIPPREDVIMQNESPDDVYIIVSGEVEIIDSEME  448

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              E V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN TM+
Sbjct  449   RENVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSYLIETMQIKQQDNATML  508

Query  1103  KNFLQHHkklkdlklgdLFIEIGD----EDGDPNMSI-NLFTVVATGNATFLNELLKAGL  939
             KNFLQHHKKL D       ++IGD    +D + N  + NL TVV+TGNA FL+ELLKA L
Sbjct  509   KNFLQHHKKLSD-------LDIGDLKTQQDEENNGFVSNLNTVVSTGNAAFLDELLKAKL  561

Query  938   DPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSI  759
             +P+I DSKGKTPLHIAAS+G+E+CV+VLLKHGCNIH +D+ GNTALW+AI++K H IF I
Sbjct  562   NPDIADSKGKTPLHIAASRGYEDCVLVLLKHGCNIHKRDVNGNTALWEAISSKHHEIFRI  621

Query  758   LYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQAD  579
             LYH+A+ISDP++AGDLLC+A + N+  VM++LLK G+ VD+K+ HG TA+Q AM EN  D
Sbjct  622   LYHFAAISDPHIAGDLLCEAVRQNNIEVMKDLLKQGISVDTKNHHGFTALQVAMSENHMD  681

Query  578   MIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNS  399
             M+ LL+MNGA++     + + PL+    ++                       ++D +  
Sbjct  682   MVNLLMMNGADV-----VGVTPLEKLRAVE-----------------------EEDKERG  713

Query  398   SSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLT  219
                      RVSI+RG+P  RRE  C E G++I LP T+ +L  IAGEK GFD +++ +T
Sbjct  714   ---------RVSIFRGNPLERREQNCNEAGKVILLPPTLDDLKKIAGEKFGFDGSETMVT  764

Query  218   DEEGAIIDSIDVIRDNDKLFIV  153
             +E+GA IDSI+VIRDNDKL+ V
Sbjct  765   NEDGAEIDSIEVIRDNDKLYFV  786



>ref|NP_567651.1| potassium channel AKT2/3 [Arabidopsis thaliana]
 sp|Q38898.1|AKT2_ARATH RecName: Full=Potassium channel AKT2/3 [Arabidopsis thaliana]
 gb|AAA97865.1| potassium channel [Arabidopsis thaliana]
 dbj|BAF01572.1| potassium channel [Arabidopsis thaliana]
 gb|AEE84571.1| potassium channel AKT2/3 [Arabidopsis thaliana]
Length=802

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/796 (65%), Positives = 619/796 (78%), Gaps = 44/796 (6%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38    LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  97

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98    AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDERTQLLVREPKQIAVRYLSTWFLM  157

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDIR+SYFW+RC 
Sbjct  158   DVASTIPFDAIGYLITGTSTLNITCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCF  217

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC YY +ADRYPHQGK W  ++ N  E SL IRYI+A+YWS+TTMTT
Sbjct  218   RLLSVTLFLVHCAGCSYYLIADRYPHQGKTWTDAIPNFTETSLSIRYIAAIYWSITTMTT  277

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  278   VGYGDLHASNTIEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFV  337

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP VEKVYLFKG
Sbjct  338   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSVEKVYLFKG  397

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  398   VSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERESVLGTLRC  457

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN TM+KNFLQHHKKL
Sbjct  458   GDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNATMLKNFLQHHKKL  517

Query  1073  kdlklgdLFIEIGDEDGD---PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              +L +GDL  +   E+ D   PN++ NL  VV TGNA  L+ELLKA L P+I DSKGKTP
Sbjct  518   SNLDIGDLKAQQNGENTDVVPPNIASNLIAVVTTGNAALLDELLKAKLSPDITDSKGKTP  577

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LH+AAS+G+E+CV+VLLKHGCNIH++D+ GN+ALW+AI +K + IF ILYH+A+ISDP++
Sbjct  578   LHVAASRGYEDCVLVLLKHGCNIHIRDVNGNSALWEAIISKHYEIFRILYHFAAISDPHI  637

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AGDLLC+AAK N+  VM+ LLK GL+VD++D HG TA+Q AM E+Q DM+ LL  NGA  
Sbjct  638   AGDLLCEAAKQNNVEVMKALLKQGLNVDTEDHHGVTALQVAMAEDQMDMVNLLATNGA--  695

Query  542   DDAVKLN----LAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS  375
              D V +N      PL+   V+++ E   R                               
Sbjct  696   -DVVCVNTHNEFTPLEKLRVVEEEEEEER-------------------------------  723

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RVSIYRGHP  RRE  C E G+LI LP ++ +L  IAGEK GFD +++ +T+E+GA ID
Sbjct  724   GRVSIYRGHPLERRERSCNEAGKLILLPPSLDDLKKIAGEKFGFDGSETMVTNEDGAEID  783

Query  194   SIDVIRDNDKLFIVAD  147
             SI+VIRDNDKL+ V +
Sbjct  784   SIEVIRDNDKLYFVVN  799



>gb|AAA96153.1| AKT3 [Arabidopsis thaliana]
 gb|AAA96154.1| AKT3 [Arabidopsis thaliana]
 emb|CAA16770.1| potassium channel protein AKT3 [Arabidopsis thaliana]
 emb|CAB79175.1| potassium channel protein AKT3 [Arabidopsis thaliana]
Length=787

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/796 (65%), Positives = 619/796 (78%), Gaps = 44/796 (6%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  23    LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  82

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  83    AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDERTQLLVREPKQIAVRYLSTWFLM  142

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDIR+SYFW+RC 
Sbjct  143   DVASTIPFDAIGYLITGTSTLNITCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCF  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC YY +ADRYPHQGK W  ++ N  E SL IRYI+A+YWS+TTMTT
Sbjct  203   RLLSVTLFLVHCAGCSYYLIADRYPHQGKTWTDAIPNFTETSLSIRYIAAIYWSITTMTT  262

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  263   VGYGDLHASNTIEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFV  322

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP VEKVYLFKG
Sbjct  323   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSVEKVYLFKG  382

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  383   VSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERESVLGTLRC  442

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN TM+KNFLQHHKKL
Sbjct  443   GDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNATMLKNFLQHHKKL  502

Query  1073  kdlklgdLFIEIGDEDGD---PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              +L +GDL  +   E+ D   PN++ NL  VV TGNA  L+ELLKA L P+I DSKGKTP
Sbjct  503   SNLDIGDLKAQQNGENTDVVPPNIASNLIAVVTTGNAALLDELLKAKLSPDITDSKGKTP  562

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LH+AAS+G+E+CV+VLLKHGCNIH++D+ GN+ALW+AI +K + IF ILYH+A+ISDP++
Sbjct  563   LHVAASRGYEDCVLVLLKHGCNIHIRDVNGNSALWEAIISKHYEIFRILYHFAAISDPHI  622

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
             AGDLLC+AAK N+  VM+ LLK GL+VD++D HG TA+Q AM E+Q DM+ LL  NGA  
Sbjct  623   AGDLLCEAAKQNNVEVMKALLKQGLNVDTEDHHGVTALQVAMAEDQMDMVNLLATNGA--  680

Query  542   DDAVKLN----LAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS  375
              D V +N      PL+   V+++ E   R                               
Sbjct  681   -DVVCVNTHNEFTPLEKLRVVEEEEEEER-------------------------------  708

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RVSIYRGHP  RRE  C E G+LI LP ++ +L  IAGEK GFD +++ +T+E+GA ID
Sbjct  709   GRVSIYRGHPLERRERSCNEAGKLILLPPSLDDLKKIAGEKFGFDGSETMVTNEDGAEID  768

Query  194   SIDVIRDNDKLFIVAD  147
             SI+VIRDNDKL+ V +
Sbjct  769   SIEVIRDNDKLYFVVN  784



>ref|XP_006283121.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
 gb|EOA16019.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
Length=820

 Score =  1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/800 (65%), Positives = 620/800 (78%), Gaps = 53/800 (7%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  57    LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWELFMVLLVAYSAWVYPFEV  116

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  117   AFLNFSPKRNLSIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  176

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG   L + +++LG+LRFWRLRRV + FTRLEKDIR+SYFW+RC 
Sbjct  177   DVASTIPFDAIGYLITGTAKLNLTFNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCL  236

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC YY +ADRYPHQGK W  ++ N  E SL IRYI+A+YWS+TTMTT
Sbjct  237   RLLSVTLFLVHCAGCSYYLIADRYPHQGKTWTDAIPNFTETSLSIRYIAAIYWSITTMTT  296

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV
Sbjct  297   VGYGDLHASNTIEMVFITLYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFV  356

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSI  HLFLP VEKVYLFKG
Sbjct  357   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSISQHLFLPSVEKVYLFKG  416

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VSREILLLLV+ MKAEYIPPREDVIMQNE+ DDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  417   VSREILLLLVSKMKAEYIPPREDVIMQNEAADDVYIIVSGEVEIIDSEMERESVLGTLRC  476

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEVGALCCRPQS+T++T++LSQLL+LKT+ L+E +Q+K++DN T++KNFLQHHKKL
Sbjct  477   GDIFGEVGALCCRPQSYTFQTRSLSQLLRLKTSFLIETMQIKQQDNATVLKNFLQHHKKL  536

Query  1073  kdlklgdLFIEIGD----EDGD------PNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
              D       I+IGD    ++G+      PN++ NL TVV TGNA  L+ELLKA L P+I 
Sbjct  537   SD-------IDIGDLTTQQNGEHNGVVPPNIASNLITVVTTGNAALLDELLKAKLSPDIT  589

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKGKTPLHIAAS+G+E+CV+VLLKHGCNIH+KD+ GNTALW+AI+ K ++IF ILYH+A
Sbjct  590   DSKGKTPLHIAASRGYEDCVLVLLKHGCNIHIKDVNGNTALWEAISTKHYAIFRILYHFA  649

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDP++AGDLLC+A K N+  V++ LLK GL+VD++D +G TA+Q AMEENQ  M+ LL
Sbjct  650   AISDPHIAGDLLCEAVKQNNVEVIKALLKQGLNVDTEDHNGFTALQVAMEENQTYMVNLL  709

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
              MNGA   D V +N    + T V +K  +                            + Q
Sbjct  710   AMNGA---DVVGVNTHD-EYTLVEKKLRV----------------------------VEQ  737

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL-TDEEG  207
             +   RVSIYRGHP  RRE  C E G+LI LP T+ +L  +AGEK GFD +++++ T+E+G
Sbjct  738   EERGRVSIYRGHPLERREQSCNEAGKLILLPPTLDDLKKLAGEKFGFDGSETTMVTNEDG  797

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A IDSI+VIRDNDKL+ V +
Sbjct  798   AEIDSIEVIRDNDKLYFVEN  817



>ref|XP_010448923.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=802

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/807 (63%), Positives = 619/807 (77%), Gaps = 53/807 (7%)
 Frame = -2

Query  2519  QEDED---FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  2355
             +ED D    SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYS
Sbjct  30    EEDYDASSLSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYS  89

Query  2354  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  2175
             AWV PFE++FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA R
Sbjct  90    AWVYPFEVAFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVR  149

Query  2174  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRF  1995
             YLSTWFLMDVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRLEKDIR+
Sbjct  150   YLSTWFLMDVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRY  209

Query  1994  SYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMY  1818
             SYFW+RC RLL VTL LVHCAGC YY +ADRY HQGK W  ++ N  E SL IRYI+A+Y
Sbjct  210   SYFWIRCLRLLSVTLFLVHCAGCSYYLIADRYQHQGKTWTDAIPNFTETSLSIRYIAAIY  269

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+TTMTTVGYGDLHA NT+EM+FII YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS
Sbjct  270   WSITTMTTVGYGDLHASNTIEMVFIIVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNS  329

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVV  1458
             I+AASNFV+RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP V
Sbjct  330   IEAASNFVNRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSV  389

Query  1457  EKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENE  1278
             EKVYLFKGVSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E
Sbjct  390   EKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERE  449

Query  1277  QVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN  1098
              V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN T++KN
Sbjct  450   SVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNATVLKN  509

Query  1097  FLQHHkklkdlklgdLFIEIGD----EDGD------PNMSINLFTVVATGNATFLNELLK  948
             FLQHHKKL D       I+IGD    ++G+      PN++ NL  VV TGNA  L+ELLK
Sbjct  510   FLQHHKKLSD-------IDIGDLMTQQNGENNGSVLPNIASNLIAVVTTGNAALLDELLK  562

Query  947   AGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSI  768
             A L P+I DSKGKTPLHIAAS+G+E+CV+VLLKHGCNIH++D+ GNTALW+AI+ K ++I
Sbjct  563   AKLSPDITDSKGKTPLHIAASRGYEDCVLVLLKHGCNIHIRDVNGNTALWEAISTKHYAI  622

Query  767   FSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEEN  588
             F ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK GL+VDS+D HG TA+Q AMEEN
Sbjct  623   FRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQGLNVDSEDHHGFTALQVAMEEN  682

Query  587   QADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDH  408
             Q DM+ LL MNGA++D                               ++     +   + 
Sbjct  683   QMDMVNLLTMNGADVDG------------------------------VNTHGELFTPLEK  712

Query  407   QNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDS  228
                    ++   RVSIYRGHP  RRE  C E G+L+ +P ++ +L  IAG+K GFD +++
Sbjct  713   SRVVGEEEEERGRVSIYRGHPLERREQSCNEAGKLVLIPPSLDDLKKIAGDKFGFDGSET  772

Query  227   SLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              +T+E+GA IDSI+VIRDNDK++ V +
Sbjct  773   MVTNEDGAEIDSIEVIRDNDKIYFVEN  799



>ref|XP_010439358.1| PREDICTED: potassium channel AKT2/3 [Camelina sativa]
Length=803

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/808 (64%), Positives = 619/808 (77%), Gaps = 54/808 (7%)
 Frame = -2

Query  2519  QEDED---FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  2355
             +ED D    SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYS
Sbjct  30    EEDYDASSLSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYS  89

Query  2354  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  2175
             AWV PFE++FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA R
Sbjct  90    AWVYPFEVAFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVR  149

Query  2174  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRF  1995
             YLSTWFLMDVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRLEKDIR+
Sbjct  150   YLSTWFLMDVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRY  209

Query  1994  SYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMY  1818
             SYFW+RC RLL VTL LVHCAGC YY +ADRY HQGK W  ++ N  E SL IRYI+A+Y
Sbjct  210   SYFWIRCLRLLSVTLFLVHCAGCSYYLIADRYQHQGKTWTDAIPNFTETSLAIRYIAAIY  269

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+TTMTTVGYGDLHA NT+EM+FII YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS
Sbjct  270   WSITTMTTVGYGDLHASNTIEMVFIIVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNS  329

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVV  1458
             I+AASNFV+RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP V
Sbjct  330   IEAASNFVNRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSV  389

Query  1457  EKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENE  1278
             EKVYLFKGVSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E
Sbjct  390   EKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERE  449

Query  1277  QVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN  1098
              V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN T++KN
Sbjct  450   SVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNATVLKN  509

Query  1097  FLQHHkklkdlklgdLFIEIGD----EDGD-------PNMSINLFTVVATGNATFLNELL  951
             FLQHHKKL D       I+IGD    ++G+       PN++ NL  VV TGNA  L+ELL
Sbjct  510   FLQHHKKLGD-------IDIGDLMTQQNGENNGAVVPPNIASNLIAVVTTGNAALLDELL  562

Query  950   KAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHS  771
             KA L P+I D KGKTPLHIAAS+G+E+CV+VLLKHGCNIH++D+ GNTALW+AI  K ++
Sbjct  563   KAKLSPDITDVKGKTPLHIAASRGYEDCVLVLLKHGCNIHIRDVNGNTALWEAITTKHYA  622

Query  770   IFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEE  591
             IF ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK GL+VD++D HG TA+Q AMEE
Sbjct  623   IFRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQGLNVDTEDHHGFTALQVAMEE  682

Query  590   NQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDD  411
             NQ DM+ LL MNGA   D V +N    +L   L+K                         
Sbjct  683   NQMDMVNLLTMNGA---DVVGVNTHG-ELFTPLEKLR-----------------------  715

Query  410   HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATD  231
                     ++   RVSIYRGHP  RRE  C E G+L+ LP ++ +L  IAGEK GFD ++
Sbjct  716   ---VVGEEEEERGRVSIYRGHPLERREQSCNEAGKLVLLPPSLDDLKKIAGEKFGFDGSE  772

Query  230   SSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
             + +T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  773   TMVTNEDGAEIDSIEVIRDNDKLYFVEN  800



>ref|XP_010434070.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
 ref|XP_010434071.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=801

 Score =   992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/799 (64%), Positives = 612/799 (77%), Gaps = 51/799 (6%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38    LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYSAWVYPFEV  97

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98    AFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  157

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRLEKDIR+SYFW+RC 
Sbjct  158   DVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCL  217

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC YY +ADRY HQGK W  ++ N  E SL IRYI+A+YWS+TTMTT
Sbjct  218   RLLSVTLFLVHCAGCSYYLIADRYQHQGKTWTDAIPNFTETSLSIRYIAAIYWSITTMTT  277

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM+FII YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  278   VGYGDLHASNTIEMVFIIVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFV  337

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP VEKVYLFKG
Sbjct  338   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSVEKVYLFKG  397

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  398   VSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERESVLGTLRC  457

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEVGALCCRPQS+T++TK+LSQLL+LK++ L+E +Q+K++DN T++KNFLQHHKKL
Sbjct  458   GDIFGEVGALCCRPQSYTFQTKSLSQLLRLKSSFLIETMQIKQQDNATVLKNFLQHHKKL  517

Query  1073  kdlklgdLFIEIGD----EDGDPNMSI------NLFTVVATGNATFLNELLKAGLDPNIG  924
              D       I+IGD    ++G+ N S+      NL  VV TGNA  L+ELLKA L P+I 
Sbjct  518   SD-------IDIGDLMTQQNGENNGSVPRNVTSNLIAVVTTGNAALLDELLKAKLSPDIT  570

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKGKTPLHIAAS+G+E+CV+VLLKHGCNIH++D+ GNTALW+AI  K ++IF ILYH+A
Sbjct  571   DSKGKTPLHIAASRGYEDCVLVLLKHGCNIHIRDVNGNTALWEAITTKHYAIFRILYHFA  630

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDP++AGDLLC+A K N+  VM+ LLK GL+VD++D HG TA+Q AME+NQ DM+ LL
Sbjct  631   AISDPHIAGDLLCEAVKQNNVEVMKALLKQGLNVDTEDHHGFTALQVAMEDNQMDMVNLL  690

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
              MNGA   D V +N                               ++   +        +
Sbjct  691   TMNGA---DVVGVN----------------------------THGEFTPLEKLRVVEEEE  719

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGA  204
             +   RVSIYRGHP  RRE  C E  +L+ LP ++ +L  IAGEK GFD +++ +T+E+GA
Sbjct  720   EERGRVSIYRGHPLGRREQSCNEAWKLVLLPPSLDDLKKIAGEKFGFDGSETMVTNEDGA  779

Query  203   IIDSIDVIRDNDKLFIVAD  147
              IDSI+VIRDNDKL+ V +
Sbjct  780   EIDSIEVIRDNDKLYFVEN  798



>emb|CDX79135.1| BnaA01g12020D [Brassica napus]
Length=788

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/806 (63%), Positives = 618/806 (77%), Gaps = 63/806 (8%)
 Frame = -2

Query  2519  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  2361
             + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  24    ERDEEYDASSLSLNNLSKLILPPLGVASYNQNQIISNGWVISPMDSRYRWWESFMVLLVA  83

Query  2360  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  2181
             YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  84    YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  143

Query  2180  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDI  2001
              RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDI
Sbjct  144   VRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  203

Query  2000  RFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISA  1824
             RFSYF +RC RLL VTL LVHCAGC+YY LADRYPH GK W+ ++ ++R++SL I+YI+A
Sbjct  204   RFSYFCIRCIRLLCVTLFLVHCAGCIYYLLADRYPH-GKTWIDAIPSIRDKSLSIKYIAA  262

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHA NT EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  263   IYWSITTMTTVGYGDLHASNTTEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFR  322

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSIQAASNFV+RN LP RLK+QILAYMCLRFKAESLNQQ +I+QLPK+I KSIC HLFLP
Sbjct  323   NSIQAASNFVNRNRLPPRLKDQILAYMCLRFKAESLNQQHVIDQLPKSIHKSICQHLFLP  382

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              VEKVYLFKGVSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME
Sbjct  383   SVEKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME  442

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              + V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN  M+
Sbjct  443   RDSVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNAVML  502

Query  1103  KNFLQHHkklkdlklgdLFIEIG---------DEDGDPNMSINLFTVVATGNATFLNELL  951
             KNFLQHHKKL D       +++G         D+DG PN++ NL TVV+TGNA  L+E+L
Sbjct  503   KNFLQHHKKLSD-------LDVGDLKAQQNGEDDDGSPNIASNLITVVSTGNAALLDEIL  555

Query  950   KAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHS  771
             KA L P+I DSKGKTPLHIAASKG+E+CV+VLLKHGCNIH++D+ GNTALW+AI+ K HS
Sbjct  556   KAKLSPDITDSKGKTPLHIAASKGYEDCVLVLLKHGCNIHIRDVSGNTALWEAISKKHHS  615

Query  770   IFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEE  591
             IF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LL  G++VD+KD HG TA++ A+ E
Sbjct  616   IFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIKDLLNQGINVDTKDHHGFTALKVALSE  675

Query  590   NQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDD  411
             NQ DM+ LL  NGA   D V   L  L+   V++K +                       
Sbjct  676   NQMDMVNLLNTNGA---DMVTNELTSLEKLSVVEKEKE----------------------  710

Query  410   HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATD  231
                          RVSI+RGHP  R+E    E G LI LP ++ +L  IA EKLGFD ++
Sbjct  711   -------------RVSIFRGHPLERKERSSYEAGMLILLPPSLDDLKKIAEEKLGFDGSE  757

Query  230   SSLTDEEGAIIDSIDVIRDNDKLFIV  153
               +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  758   MMVTNEDGAEIDSIEVIRDNDKLYFV  783



>ref|XP_009135705.1| PREDICTED: potassium channel AKT2/3 [Brassica rapa]
Length=788

 Score =   991 bits (2562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/806 (63%), Positives = 618/806 (77%), Gaps = 63/806 (8%)
 Frame = -2

Query  2519  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  2361
             + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  24    ERDEEYDASSLSLNNLSKLILPPLGVASYNQNQIISSGWVISPMDSRYRWWESFMVLLVA  83

Query  2360  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  2181
             YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  84    YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  143

Query  2180  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDI  2001
              RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDI
Sbjct  144   VRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  203

Query  2000  RFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISA  1824
             RFSYF +RC RLL VTL LVHCAGC+YY LADRYPH GK W+ ++ ++R++SL I+YI+A
Sbjct  204   RFSYFCIRCIRLLCVTLFLVHCAGCIYYLLADRYPH-GKTWIDAIPSIRDKSLSIKYIAA  262

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHA NT EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  263   IYWSITTMTTVGYGDLHASNTTEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFR  322

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSIQAASNFV+RN LP RLK+QILAYMCLRFKAESLNQQ +I+QLPK+I KSIC HLFLP
Sbjct  323   NSIQAASNFVNRNRLPPRLKDQILAYMCLRFKAESLNQQHVIDQLPKSIHKSICQHLFLP  382

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              VEKVYLFKGVSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME
Sbjct  383   SVEKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME  442

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              + V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN  M+
Sbjct  443   RDSVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNAVML  502

Query  1103  KNFLQHHkklkdlklgdLFIEIG---------DEDGDPNMSINLFTVVATGNATFLNELL  951
             KNFLQHHKKL D       +++G         D+DG PN++ NL TVV+TGNA  L+E+L
Sbjct  503   KNFLQHHKKLSD-------LDVGDLKAQQNGEDDDGSPNIASNLITVVSTGNAALLDEIL  555

Query  950   KAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHS  771
             KA L P+I DSKGKTPLHIAASKG+E+CV+VLLKHGCNIH++D+ GNTALW+AI+ K HS
Sbjct  556   KAKLSPDITDSKGKTPLHIAASKGYEDCVLVLLKHGCNIHIRDVSGNTALWEAISKKHHS  615

Query  770   IFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEE  591
             IF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LL  G++VD+KD HG TA++ A+ E
Sbjct  616   IFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIKDLLNQGINVDTKDHHGFTALKVALSE  675

Query  590   NQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDD  411
             NQ DM+ LL  NGA   D V   L  L+   V++K +                       
Sbjct  676   NQMDMVNLLNTNGA---DMVTNELTSLEKLSVVEKEKE----------------------  710

Query  410   HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATD  231
                          RVSI+RGHP  R+E    E G LI LP ++ +L  IA EKLGFD ++
Sbjct  711   -------------RVSIFRGHPLERKERSSYEAGMLILLPPSLDDLKKIAEEKLGFDGSE  757

Query  230   SSLTDEEGAIIDSIDVIRDNDKLFIV  153
               +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  758   MMVTNEDGAEIDSIEVIRDNDKLYFV  783



>ref|XP_002867783.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44042.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
Length=801

 Score =   991 bits (2562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/800 (64%), Positives = 615/800 (77%), Gaps = 53/800 (7%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38    LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  97

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98    AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  157

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDIR+SYFW+RC 
Sbjct  158   DVASTIPFDAIGYLITGTSKLNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCL  217

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC YY +ADRYPH+GK W  ++ N  E SL IRYI+A+YWS+TTMTT
Sbjct  218   RLLSVTLFLVHCAGCSYYLIADRYPHEGKTWTDAIPNFTETSLSIRYIAAIYWSITTMTT  277

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  278   VGYGDLHASNTIEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFV  337

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP VEKVYLFKG
Sbjct  338   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIYKSICQHLFLPSVEKVYLFKG  397

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VSREILLL+V+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  398   VSREILLLMVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERESVLGTLRC  457

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEV ALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN TM+KNFLQHHKKL
Sbjct  458   GDIFGEVAALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNATMLKNFLQHHKKL  517

Query  1073  kdlklgdLFIEIGD----EDGDP------NMSINLFTVVATGNATFLNELLKAGLDPNIG  924
              D       ++IGD    ++G+       N++ NL  V+ TGNA  L+ELLKA L P+I 
Sbjct  518   SD-------LDIGDLRTQQNGENNGFVPLNIASNLIAVMTTGNAALLDELLKAKLSPDIT  570

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKGKTPLHIAAS+G+E+CV+VLLKHGCNIH++D+ GNTALW+AI++K ++IF ILYH+A
Sbjct  571   DSKGKTPLHIAASRGYEDCVLVLLKHGCNIHIRDVNGNTALWEAISSKHYAIFRILYHFA  630

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDP++AGDLLC+A K N+  VM+ LLK GL+VD++D  G TA+Q A+ E+Q DM+ LL
Sbjct  631   AISDPHIAGDLLCEAVKQNNVEVMKALLKQGLNVDTEDHQGVTALQVALAEDQMDMVNLL  690

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
              MNGA   D V +N                          H+  +   K          +
Sbjct  691   AMNGA---DVVGVN-------------------------THDEFTPLEK----LRVVEEE  718

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL-TDEEG  207
             +   RVSIYRGHP  RRE  C E G+LI LP ++ +L  IAGEK GFD +D ++ T+E+G
Sbjct  719   EERGRVSIYRGHPLERRERGCNEAGKLILLPPSLDDLKKIAGEKYGFDGSDETMVTNEDG  778

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A IDSI+VIRDNDKL+ V +
Sbjct  779   AEIDSIEVIRDNDKLYFVEN  798



>emb|CDX82921.1| BnaC01g13710D [Brassica napus]
Length=862

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/806 (63%), Positives = 619/806 (77%), Gaps = 63/806 (8%)
 Frame = -2

Query  2519  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  2361
             + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  98    ERDEEYGASSLSLNNLSKLILPPLGVASYNQNQIISSGWVISPMDSRYRWWESFMVLLVA  157

Query  2360  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  2181
             YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  158   YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  217

Query  2180  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDI  2001
              RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDI
Sbjct  218   IRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  277

Query  2000  RFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISA  1824
             RFSY  +RC RLL VTL LVHCAGC+YY LADRYPH GK W+ S+ ++R++SL I+YI+A
Sbjct  278   RFSYLCIRCIRLLCVTLFLVHCAGCIYYLLADRYPH-GKTWIDSIPSIRDKSLSIKYIAA  336

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHA NT EM+FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  337   IYWSITTMTTVGYGDLHASNTTEMVFITVYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFR  396

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSIQAASNFV+RN LP RLKEQILAYMCLRFKAESLNQQ +I+QLPK+I KSIC HLFLP
Sbjct  397   NSIQAASNFVNRNRLPPRLKEQILAYMCLRFKAESLNQQHVIDQLPKSIHKSICQHLFLP  456

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              VEKVYLFKGVSREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME
Sbjct  457   SVEKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME  516

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              + V+ TL  GD+FGEVGALCCRPQS+T++TK+LSQLL+LKT+ L+E +Q+K++DN  M+
Sbjct  517   RDSVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQIKQQDNAVML  576

Query  1103  KNFLQHHkklkdlklgdLFIEIGD---------EDGDPNMSINLFTVVATGNATFLNELL  951
             KNFLQHHKKL D       +++GD         ++G PN++ NL TVV+TGNA  L+E+L
Sbjct  577   KNFLQHHKKLSD-------LDVGDLSAQQDGEKDEGSPNIASNLITVVSTGNAALLDEIL  629

Query  950   KAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHS  771
             KA L P+I DSKGKTPLHIAASKG+E+CV+VLLKHGCNIH++D+ GNTALW+AI+ K HS
Sbjct  630   KAKLSPDITDSKGKTPLHIAASKGYEDCVLVLLKHGCNIHIRDVTGNTALWEAISKKHHS  689

Query  770   IFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEE  591
             IF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LLK G++VD+KD HG TA++ AM +
Sbjct  690   IFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIEDLLKQGINVDTKDHHGFTALKVAMSQ  749

Query  590   NQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDD  411
             NQ D++ LL MNGA   D V   L  L+   V++K +                       
Sbjct  750   NQMDLVNLLNMNGA---DMVTNELTSLEKLRVVEKEKE----------------------  784

Query  410   HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATD  231
                          RVSI+RGHP  R+E    E G LI LP ++ +L  IA EKLGF+ ++
Sbjct  785   -------------RVSIFRGHPLERKERSSYEAGMLILLPPSLDDLKKIAEEKLGFNGSE  831

Query  230   SSLTDEEGAIIDSIDVIRDNDKLFIV  153
               +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  832   MMVTNEDGAEIDSIEVIRDNDKLYFV  857



>ref|XP_006413681.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
 gb|ESQ55134.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
Length=796

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/796 (64%), Positives = 617/796 (78%), Gaps = 53/796 (7%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              SL  LSK ILPPLG  S    H  S G +ISPMDSRYR WE++MVLLVAYSAWV PFE+
Sbjct  41    LSLNNLSKLILPPLGVASYNQNHIISSGWIISPMDSRYRWWESFMVLLVAYSAWVYPFEV  100

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  101   AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  160

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRLEKDIRF YFW+RC 
Sbjct  161   DVASTIPFDAIGYLITGTGKLNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRFCYFWIRCI  220

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTT  1794
             RLL VTL LVHCAGC+YY LADRYPH GK W+ ++ ++R++SL I+YI+A+YWS+TTMTT
Sbjct  221   RLLCVTLFLVHCAGCIYYLLADRYPH-GKTWIDAIPSIRDKSLSIKYIAAIYWSITTMTT  279

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT+EM FI  YMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV
Sbjct  280   VGYGDLHASNTIEMAFITIYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFV  339

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP RLK+QILAYMCLRFKAESLNQQ LI+QLPK+I KSIC HLFLP VEKVYLFKG
Sbjct  340   NRNRLPPRLKDQILAYMCLRFKAESLNQQHLIDQLPKSIHKSICQHLFLPSVEKVYLFKG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SREILLLLV+ MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE+ID+EME E V+ TL  
Sbjct  400   ISREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEMERESVLGTLRC  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GD+FGEVGALCCRPQS+T++T++LSQLL+LKT+ L+E +Q+K++DN TM+KNFLQHHKKL
Sbjct  460   GDIFGEVGALCCRPQSYTFQTRSLSQLLRLKTSFLIETMQIKQQDNATMLKNFLQHHKKL  519

Query  1073  kdlklgdLFIEIGD-------EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
              D       ++IGD       E+ D   S NL TVV+TGNA  L+ELLKA L P+I D+K
Sbjct  520   SD-------VDIGDLSEQQNGENDDVQPS-NLITVVSTGNAALLDELLKAKLSPDIADAK  571

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             GKTPLHIAAS+G+E+CV+VLLKHGCNIH++D+ GNTALW+AI+ K ++IF ILYH+A+IS
Sbjct  572   GKTPLHIAASRGYEDCVLVLLKHGCNIHIRDVSGNTALWEAISTKHYAIFRILYHFAAIS  631

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
             DP++AGDLLC A K N+  VM++LLK G+ VD++D HG TA+Q AM EN+ DM+ LL MN
Sbjct  632   DPHIAGDLLCSAVKQNNVEVMKDLLKQGISVDTEDHHGFTALQVAMAENRMDMVNLLTMN  691

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS  375
             GA++     + + PL+   V++                             +    ++  
Sbjct  692   GADV-----VGVRPLENLRVVE-----------------------------NGKEEEEER  717

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RV IYRGHP  RRE  C E G+LI LP ++ +L  IAG+K GFD +++ +T+E+G  ID
Sbjct  718   KRVGIYRGHPLERRERSCIEAGKLILLPPSLDDLKKIAGKKFGFDGSETMVTNEDGEEID  777

Query  194   SIDVIRDNDKLFIVAD  147
             SI+VIRDNDKL+ V D
Sbjct  778   SIEVIRDNDKLYFVED  793



>ref|XP_009355247.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Pyrus x bretschneideri]
Length=831

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/794 (64%), Positives = 609/794 (77%), Gaps = 50/794 (6%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  69    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  128

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA         
Sbjct  129   VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIA---------  179

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
                                            +RFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  180   -------------------------------MRFWRLRRAKQLFTRLEKDIRFSYFWVRC  208

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  209   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETCLWIRYISALYWSMTTM  268

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVNT+EMIFIIFYMLF+LGLTAY+IGNMTNLVVEGTRRTMEFR+S++AAS+
Sbjct  269   STVGYGDLHAVNTVEMIFIIFYMLFDLGLTAYLIGNMTNLVVEGTRRTMEFRSSVEAASS  328

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAE+LNQQ ++EQ PK+ICKSIC HLFLP+VEKVYLF
Sbjct  329   FVCRNRLPQRLRDQILAYICLRFKAETLNQQQMLEQFPKSICKSICQHLFLPIVEKVYLF  388

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSRE LL LV +MKAEY PPREDV++QNE+P+DVYIIVSGEVE+ID EME E+VV TL
Sbjct  389   KGVSRETLLHLVVNMKAEYTPPREDVLLQNEAPEDVYIIVSGEVEIIDCEMERERVVGTL  448

Query  1259  NSGDMFGEVGALCCR---PQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
              SGDMFGEV A C R   PQSFTYRTKTLSQLL++KTT+L+EA+Q K  D   M+KNF Q
Sbjct  449   QSGDMFGEVIAFCGREVGPQSFTYRTKTLSQLLRIKTTALVEAMQTKPHDKEQMVKNFNQ  508

Query  1088  HHkklkdlklgdLFIEIG-DEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             HHKKL+DL++G++ +E G DE GDP  + N+ T  + G+AT L+ELLKA LDP+IGD KG
Sbjct  509   HHKKLRDLRVGEILVESGEDEGGDPKAAFNVLTAASKGDATLLDELLKAKLDPDIGDFKG  568

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAASKGH+ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY+ A+ISD
Sbjct  569   RTPLHIAASKGHDECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFQSLYYCAAISD  628

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             PY AGDLLC AAK ND +VM+ELLK GL+VDSK+  G TA+Q AMEEN ADM+ LLVMNG
Sbjct  629   PYTAGDLLCTAAKRNDLTVMEELLKQGLNVDSKNHLGKTAVQIAMEENNADMVNLLVMNG  688

Query  551   AEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAA-SKWAKDDHQNSSSMPQQCS  375
             A++ +A         LTE+LQKRE+GHRI +P + ++E    K  ++ +    S    C 
Sbjct  689   ADVTNAQNCLFPSQSLTEMLQKREVGHRITVPESTINEVPLMKNGEERNSGRESYGVNCP  748

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RVSIYRGHP  R+ T C E GR+I+LP ++ EL +IAG K GFD+ ++ +TDE GA ID
Sbjct  749   -RVSIYRGHPMVRKTTCCREAGRVIRLPRSLEELRNIAGVKFGFDSGNTLVTDEGGAEID  807

Query  194   SIDVIRDNDKLFIV  153
             SI+VIRDNDKLF+V
Sbjct  808   SIEVIRDNDKLFLV  821



>ref|XP_010529461.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Tarenaya hassleriana]
Length=786

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/785 (64%), Positives = 608/785 (77%), Gaps = 47/785 (6%)
 Frame = -2

Query  2483  KFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             K ILPPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++FL S  
Sbjct  44    KLILPPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAFLHSSP  103

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  LY+ DN+VDLFFA+DIVLTFFVAYID  TQLL+   +KIATRYLSTWFLMD+AST+P
Sbjct  104   NRDLYIADNVVDLFFAIDIVLTFFVAYIDQRTQLLVREPRKIATRYLSTWFLMDMASTLP  163

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             +E + +L TGK  + +  S+LG+LRFWR+RRV + FTRLEKDIR+SYFWVRC RLL VTL
Sbjct  164   YEAIGYLVTGKSKVSISCSLLGLLRFWRIRRVKHLFTRLEKDIRYSYFWVRCLRLLCVTL  223

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              LVHCAGCLYY LADRYPHQGK W+G++  N R+ SL +RYISA+YWS+TTMTTVGYGDL
Sbjct  224   FLVHCAGCLYYLLADRYPHQGKTWIGAVIPNFRKTSLSVRYISAIYWSITTMTTVGYGDL  283

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HAVNT+EMIFIIF MLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASNFV RN LP
Sbjct  284   HAVNTMEMIFIIFCMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASNFVCRNRLP  343

Query  1595  ARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
              RLKEQILAYMCLRFKAESLNQQ LIEQLPK+I KSIC HLFLP VEKVYLF+GVSREIL
Sbjct  344   VRLKEQILAYMCLRFKAESLNQQHLIEQLPKSIYKSICQHLFLPSVEKVYLFEGVSREIL  403

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
             LLLV+ MKAEYIPPREDVIMQNE P+DVYII+SGEVE++D+E E E+V+ TL SGD+FGE
Sbjct  404   LLLVSRMKAEYIPPREDVIMQNEXPEDVYIIISGEVEIVDSETEGERVLGTLRSGDIFGE  463

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             VGALCCRP SF + T +LSQLL+LKTTSL+  +Q K+ DN+TM+KNFLQHHKKL DL +G
Sbjct  464   VGALCCRPHSFNFLTXSLSQLLRLKTTSLIGTIQTKQHDNVTMLKNFLQHHKKLNDLNIG  523

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
             D  +E G+++ D  M+ NL TV +TGNA  L+ELL A LDP+IGDS G+TPLH+AASKG+
Sbjct  524   DRLVEGGEDESDRYMASNLLTVASTGNAALLDELLNAKLDPDIGDSNGRTPLHVAASKGY  583

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             EECV+VLLKHGCNIH++D++GNTALW+AI +  H+ F ILY +A+ISDP+ AGDLLC A+
Sbjct  584   EECVLVLLKHGCNIHVRDVKGNTALWEAITSGNHATFRILYRFAAISDPHTAGDLLCTAS  643

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA  516
             + N+  VM++LL+ GL + SKD++G T +Q A+ EN  D++ LLV               
Sbjct  644   RQNNVHVMKDLLQLGLDIYSKDQNGLTPLQVALAENHIDIVNLLV---------------  688

Query  515   PLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATR  336
                   V  +R L                    +D +N         +RVSIYRG P  R
Sbjct  689   -----NVPNRRRL---------------MVGGGEDSKN--------RVRVSIYRGDPLER  720

Query  335   RETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  156
             R  +  E G+LI LP ++ +L  IAGEK G+DA+ + +  E GA +DS++VIRDNDK++ 
Sbjct  721   RGKRLREAGKLILLPTSLDKLKEIAGEKFGYDASGTVVRAEAGAEVDSVEVIRDNDKIYF  780

Query  155   VADWN  141
             V ++N
Sbjct  781   VEEFN  785



>ref|XP_010910948.1| PREDICTED: potassium channel AKT2-like isoform X1 [Elaeis guineensis]
Length=836

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/806 (63%), Positives = 626/806 (78%), Gaps = 23/806 (3%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  2346
             + +  F+L  LSK +LPPLG+     T   S G ++SPMDSRYRCWE +MV+LVAYSAWV
Sbjct  35    KPEASFNLRNLSKVVLPPLGAPGYNQTQAESGGRIVSPMDSRYRCWEAFMVILVAYSAWV  94

Query  2345  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
              PFE++F+ S     L + D+I+D+FFA+DIVLTFF+AYID  TQLL+   K+IA RYLS
Sbjct  95    YPFEVAFMNSSPKGVLCITDSIIDIFFAIDIVLTFFLAYIDSKTQLLVRDPKRIAIRYLS  154

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWF+MDVASTIPFE + +L TG+   GV YS+LGMLR WRLR+V  FFTRLEKDIRFSYF
Sbjct  155   TWFIMDVASTIPFEGLGYLITGEIKEGVSYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYF  214

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWS  1812
             W+RCARLL VTL LVHCAGCLYY LADRYPHQGK W+G++N   RE SL  RYISA+YWS
Sbjct  215   WIRCARLLSVTLFLVHCAGCLYYLLADRYPHQGKTWIGAVNPNFREASLWTRYISALYWS  274

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
              TTMTTVGYGDLHAVNT EM+F IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQ
Sbjct  275   TTTMTTVGYGDLHAVNTEEMVFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQ  334

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AASNFV RNHLP RLK+QILAYMCLRF+AESLNQQ L++QLP +ICKSIC HLFLPV+++
Sbjct  335   AASNFVCRNHLPPRLKQQILAYMCLRFRAESLNQQQLMDQLPNSICKSICEHLFLPVIKE  394

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKG+S+E+LLLLV  MKAEYIPP+EDVIMQNE+PDDVY++VSGEVE+I  + E EQV
Sbjct  395   VYLFKGISKEMLLLLVTKMKAEYIPPKEDVIMQNEAPDDVYVVVSGEVEIIHFDNEREQV  454

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             +  L +GD+FGEV ALC RPQ FT+RT+TLSQLL+LK  +L EA+Q K+ED++ +I+NFL
Sbjct  455   LGALRTGDIFGEVSALCDRPQDFTFRTRTLSQLLRLKQRTLREAMQTKQEDSVVIIRNFL  514

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +H  + K++++ DLF E  DE    N+  NL TV ATGN+ FL ELLKAG+DP+IGDSKG
Sbjct  515   KHQIEFKNIRIEDLFGE-SDEYDAANIPCNLLTVAATGNSCFLEELLKAGMDPDIGDSKG  573

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAASKG+E+CV+VLLKH  NI+++DM+GNT LW AI  K H IF+ILYH+A IS+
Sbjct  574   RTPLHIAASKGYEDCVLVLLKHASNINIQDMDGNTPLWLAITGKHHKIFNILYHYACISN  633

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             P++ G+LL  AAK ND S ++ELLKHGL ++S++  G T +QAA  EN  DMIKLLVMNG
Sbjct  634   PHIGGNLLVLAAKRNDLSTIKELLKHGLDINSENNEGLTPLQAAFAENHTDMIKLLVMNG  693

Query  551   AEIDDAVKLNLAPL--------DLTEVLQKRELGHRIAMPNTILHEAASKWA---KDDHQ  405
             A +++   +NL+ L        D+ E++QKRE+G+ IA+  +  HE   +     +  H 
Sbjct  694   ANVEN---INLSSLETRKMTEADIQELVQKREVGYPIAILES--HEELKQIKVSEEKSHM  748

Query  404   NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSS  225
                        RVSIY+GHP  R  +   E G+LI LP TI +L  IAGEK G  A  + 
Sbjct  749   TKWGTRGGIYPRVSIYKGHPFLRNSSS--EAGKLINLPNTIEDLKEIAGEKFGVVANRTV  806

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVAD  147
             +T+EEGA IDSI+VIRDNDKLFIV +
Sbjct  807   ITNEEGAEIDSIEVIRDNDKLFIVEN  832



>ref|XP_008378875.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Malus domestica]
Length=821

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/762 (64%), Positives = 596/762 (78%), Gaps = 29/762 (4%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA RYL+TWFL
Sbjct  125   VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIAMRYLTTWFL  184

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  185   MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  244   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETGLWIRYISALYWSMTTM  303

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVN +EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+
Sbjct  304   STVGYGDLHAVNXVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASS  363

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAESLNQQ ++EQ PK+ICKSIC HLFLP+VEKV   
Sbjct  364   FVCRNRLPQRLRDQILAYICLRFKAESLNQQQMLEQFPKSICKSICQHLFLPIVEKV---  420

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
                         A MKAEYIPPREDV++Q+E+P+DVYIIVSGEVE+ID EME E+ V TL
Sbjct  421   ------------AKMKAEYIPPREDVVLQSEAPEDVYIIVSGEVEIIDCEMERERAVGTL  468

Query  1259  NSGDMFGEVGALC-------CRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
              SGDM GEV A C       CRPQ+FTYRTKTLSQLL++KTT+L+EA+Q K ED + M+K
Sbjct  469   QSGDMVGEVTAFCGIEVGKLCRPQTFTYRTKTLSQLLRIKTTALVEAMQTKPEDKVXMLK  528

Query  1100  NFLQHHkklkdlklgdLFIEIGDEDGD-PNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             NF QHHKKL+DL++G++ +E G+++GD P  + N+ T  + G+AT L+ELLKA LDP+IG
Sbjct  529   NFNQHHKKLRDLRVGEILVESGEDEGDDPKAAFNMLTAASKGDATLLDELLKAKLDPDIG  588

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D KG+TPLHIAASKGH ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY  A
Sbjct  589   DFKGRTPLHIAASKGHYECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFRSLYFCA  648

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDPY AGDLLC AAK N+ +VM+ELLK GL+VDSK++ G TA+Q AMEEN ADM+ LL
Sbjct  649   AISDPYTAGDLLCTAAKRNNLTVMEELLKQGLNVDSKNQLGKTAVQIAMEENNADMVNLL  708

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +A         LTE+LQKRE+GHRI +P++ ++E       + +    S   
Sbjct  709   VMNGADVTNAQNCLFPSQSLTEMLQKREVGHRITVPDSTINEVPLMKNGERNSGRESYGV  768

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAG  258
              C  RVSIYRGHP  R+ T C E GR+I+LP ++ EL + AG
Sbjct  769   NCP-RVSIYRGHPMVRKTTCCREAGRVIRLPXSLEELRNXAG  809



>ref|XP_009405920.1| PREDICTED: potassium channel AKT2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/802 (62%), Positives = 618/802 (77%), Gaps = 16/802 (2%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  2346
             +  E F+L  LSK +LPPLG S        S+G VI PMDSRYRCWET+MV+LVAYSAWV
Sbjct  14    ERSESFNLRNLSKLVLPPLGVSTYNQNQNDSRGKVILPMDSRYRCWETFMVVLVAYSAWV  73

Query  2345  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  2166
              PFEI+F+ +     L++ DN++D FFAVDIVLTFFVAYID  TQ+L+   +KIA RYLS
Sbjct  74    YPFEIAFMGAAPKGGLFIADNVIDAFFAVDIVLTFFVAYIDSRTQVLVRDPRKIAVRYLS  133

Query  2165  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYF  1986
             TWF+MD+AST+PFE + +L TG+   GV YS+LGMLR WRLR+V  FFTRLEKDIRFSYF
Sbjct  134   TWFIMDLASTLPFEGLGYLITGRVKSGVSYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYF  193

Query  1985  WVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWS  1812
             W+RCARLL VT+ LVHCAGCLYY LADRYPHQGK W+G++  N RE SL +RYI+++YWS
Sbjct  194   WIRCARLLCVTVFLVHCAGCLYYLLADRYPHQGKTWIGAVMPNFREASLWMRYIASIYWS  253

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTMTTVGYGDLHAVNT EMIF IFYML NLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+
Sbjct  254   ITTMTTVGYGDLHAVNTREMIFNIFYMLCNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIE  313

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
              ASNFV RNHLPARL+EQILAYMCLRF+AE+LNQQ L++QLPK+ICKSIC HLFLP V++
Sbjct  314   VASNFVCRNHLPARLREQILAYMCLRFRAETLNQQHLMDQLPKSICKSICQHLFLPTVKE  373

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLFKGVSRE LLLLV  MKAEYIPPREDVIMQNE+P+DVYI+VSGEVE++ ++ E EQV
Sbjct  374   VYLFKGVSRETLLLLVTTMKAEYIPPREDVIMQNEAPEDVYIVVSGEVEIVYSDTETEQV  433

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  L++GDMFGE+ AL  RPQSFT+RT+TLSQLL+LK ++L E LQ K+ED I +IKNFL
Sbjct  434   VGALSAGDMFGEISALSDRPQSFTFRTRTLSQLLRLKQSTLKEVLQTKQEDGIAIIKNFL  493

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +H  + KD+ + DL  E G+ D + ++  NL TV ATGN+ FL +LLKAG+DP+I DS+G
Sbjct  494   KHQIEFKDISIEDLIGENGECD-EVSIPCNLLTVAATGNSCFLEKLLKAGMDPDIADSRG  552

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +TPLHIAASKG+E+CV+VLL H  N++++DM+GNT LWDAIAAK H IF++L+  A IS+
Sbjct  553   RTPLHIAASKGYEDCVLVLLNHAGNLNIQDMDGNTPLWDAIAAKHHKIFNLLHQCACISN  612

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
             P  +GDLLC AAK ND S M+ELLKHGL++DS++  G TA+Q A+ EN  DM+  LV+NG
Sbjct  613   PNTSGDLLCLAAKRNDLSTMKELLKHGLNIDSENHEGLTALQIALAENYEDMVAFLVLNG  672

Query  551   AEIDDAVKLN------LAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSM  390
             A I+ A  LN      +    L E+ Q+R+ G    +P +   +       +  +NS  +
Sbjct  673   ASIEKA-NLNGRGARKIRNGVLKEMDQQRDAGCVNTLPESN-GQFTQTLVLEKQENSFKL  730

Query  389   PQQC-SIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
                    R+S+Y+GHP  R    C   G+L+ LP T+ EL +I G K   DA +  LT+E
Sbjct  731   ETNGYPPRISVYKGHPLLR--NNCSGSGKLMCLPSTMEELKTIIGNKFEIDARNRILTNE  788

Query  212   EGAIIDSIDVIRDNDKLFIVAD  147
             +GA ++SI+V+RDNDKLF+V D
Sbjct  789   DGAEVESIEVLRDNDKLFVVED  810



>gb|AAD39492.1|AF145272_1 pulvinus inward-rectifying channel SPICK2 [Samanea saman]
Length=810

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/797 (61%), Positives = 600/797 (75%), Gaps = 29/797 (4%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSS-------QPTHTSSQGLVISPMDSRYRCWETWMVLLVAY  2358
             E   F+L  +SK ILPPLG+S        P H  +   +ISP+D+RYRCWE+ MV+LV Y
Sbjct  33    ESPTFNLQNVSKVILPPLGASTYNDRNSSPHHPKT--WIISPLDTRYRCWESLMVVLVGY  90

Query  2357  SAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIAT  2178
             SAWV PFEI FL S    KLY+VDNI+D+FF VDIVLTFF+AYID +TQLL+   K+IA 
Sbjct  91    SAWVYPFEIGFLMSSPTHKLYIVDNIIDIFFGVDIVLTFFLAYIDSSTQLLVQDSKQIAL  150

Query  2177  RYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIR  1998
             RYLSTWF+MDVAS+IP+E + +LFTGKH +G+ + +LGMLR WRLRRV  +FTRLEKDIR
Sbjct  151   RYLSTWFVMDVASSIPYEALGYLFTGKHKVGLTFFLLGMLRLWRLRRVKQYFTRLEKDIR  210

Query  1997  FSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISA  1824
             FSYF +RC RLL VT  + HC GCLYY LAD YPH G+ W+G+ N   +  S+ IRYISA
Sbjct  211   FSYFLIRCVRLLCVTFFIAHCGGCLYYLLADVYPHLGRTWIGTTNPSFKGTSIGIRYISA  270

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             MYWS+TTMTTVGYGD HAVN +EM F I YM FNLGLTAY+IGNMTNLVV+GT RTMEFR
Sbjct  271   MYWSLTTMTTVGYGDFHAVNPMEMAFTICYMFFNLGLTAYLIGNMTNLVVQGTCRTMEFR  330

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             N+I+AA+NFVSRN + ARLKEQI+AYMCLR+KAESLN   L+EQLPK+I K+IC HLFLP
Sbjct  331   NNIEAATNFVSRNIVSARLKEQIIAYMCLRYKAESLNHHQLMEQLPKSIRKNICQHLFLP  390

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              V+KVYLFKG+SREILL L A MKAEYIPP+E+VIMQ ++ +DVYIIVSGEVE+I   M+
Sbjct  391   AVQKVYLFKGLSREILLSLAAKMKAEYIPPKEEVIMQGDAAEDVYIIVSGEVEIIGFAMD  450

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              E+V+  L   DMFGEVGALCC+PQSFTYRTKTL+QLL+L+T+   + +Q K++DN+ M+
Sbjct  451   KERVLGILQRWDMFGEVGALCCKPQSFTYRTKTLTQLLRLRTSDFTDTMQTKKDDNMQML  510

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             KNFLQH KKL +L   DL I+   ED DP+M++NL  V +TGN+  L ELLKAGLD ++ 
Sbjct  511   KNFLQHLKKLHNLNDKDLVIDWSRED-DPSMAVNLLHVASTGNSALLEELLKAGLDSSVA  569

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DSKGKTPLHIAA  GHEECV VLLKH CN+H +DM G+TALWDAI +K +SIF ILY   
Sbjct  570   DSKGKTPLHIAALNGHEECVKVLLKHACNVHARDMNGDTALWDAIFSKHYSIFRILYQLC  629

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
               SDP+ AGDLLCKAAK N+ +VM ELLK GL+++SKD HG TA+Q A + N  DMI+LL
Sbjct  630   VQSDPHTAGDLLCKAAKRNELTVMSELLKQGLNIESKDHHGCTAMQVAWQHNHVDMIQLL  689

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
              MNG+++  A+       D     Q+    H             S W   ++ N+S+  +
Sbjct  690   FMNGSDVVGALN-----YDNNNNNQEERGQHN------------SIWGTYNNNNNSNNHR  732

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGA  204
               + RVSI+RGHP  RR+  C E G++I+ P +I EL +IAGE+ GFDA D+ +TDE GA
Sbjct  733   HIASRVSIFRGHPILRRQQGCIEAGKMIRFPNSIKELKTIAGERFGFDAKDAMVTDEGGA  792

Query  203   IIDSIDVIRDNDKLFIV  153
              IDSID+IRDNDKLFIV
Sbjct  793   EIDSIDLIRDNDKLFIV  809



>ref|XP_002441141.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
 gb|EES19571.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
Length=838

 Score =   952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/805 (60%), Positives = 605/805 (75%), Gaps = 24/805 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             F+L  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV PFE
Sbjct  24    FNLRNLSKVILPPLGGPSGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYPFE  83

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R+KI  RYLST+F+
Sbjct  84    VAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDHRTQLLVRDRRKITLRYLSTFFI  143

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRLEKDIRFSYFW+RC
Sbjct  144   MDVASTIPFQGLAYLVTGEVRENAAYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIRC  203

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL LVHCAGCLYY +ADRYPH+ K W+G++  N R+ SL+IRYIS++YWS+TTM
Sbjct  204   ARLVAVTLFLVHCAGCLYYLIADRYPHREKTWIGAVIPNFRQASLRIRYISSIYWSITTM  263

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AAS+
Sbjct  264   TTVGYGDLHAENTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASS  323

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYLF
Sbjct  324   FVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYLF  383

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVSRE+LL LV  MK EYIPP+EDVI+QNE+PDDVY++VSGEVE+I     +E V  TL
Sbjct  384   NGVSREMLLSLVTKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVILFNGIDEHVKATL  443

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+H  
Sbjct  444   GTRDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVIIKNFLKHQV  503

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             ++  +K  DL   +GD  G+ +   N+ TV A GN+  L +LL+AG D ++GD+KG+T L
Sbjct  504   EMHGMKADDL---LGDNTGEHDDDANVLTVAAMGNSGLLEDLLRAGKDADVGDAKGRTAL  560

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAAS G+E+CV+VLLKH CN+++KD +GNTA+W+AIAA  H IF+ILYH+A  S+P+  
Sbjct  561   HIAASNGYEDCVLVLLKHACNVNIKDAQGNTAMWNAIAAGHHKIFNILYHFARASNPHAG  620

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GD+LC AA+  D   ++ELLK GL VDS+D  G+TA++ AM E  AD  + L+MNGA +D
Sbjct  621   GDVLCFAARRGDLGALRELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLIMNGASVD  680

Query  539   D-----------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQN  402
                         A +L ++P +L E+LQKRELGH I +   P  I    +S  ++     
Sbjct  681   KASLDDDGSGSGAARLTMSPTELRELLQKRELGHSITIVDSPAVIPDGGSSGHSRPGRLQ  740

Query  401   SSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL  222
              +S   QC  RVS+Y+GHP  R  +   E G+LI LP T+ E  +I GEKL  DA    +
Sbjct  741   GTSSDNQCWPRVSVYKGHPFLRNRSS--EAGKLINLPGTLEEFKAIVGEKLKVDAKKGLI  798

Query  221   TDEEGAIIDSIDVIRDNDKLFIVAD  147
              ++EGA IDSIDVIRDNDKLF+V +
Sbjct  799   VNDEGAEIDSIDVIRDNDKLFVVTE  823



>ref|XP_006654434.1| PREDICTED: potassium channel AKT2-like [Oryza brachyantha]
Length=847

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/813 (59%), Positives = 611/813 (75%), Gaps = 30/813 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQG-----LVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             F+L  LSK ILPPLG     H    G      VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  21    FNLRNLSKLILPPLGVPAGGHAQHHGGSNDKRVISPLDSRYRCWDTFMVVLVAYSAWVYP  80

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID TTQLL+  R++I  RYLST+
Sbjct  81    FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSTTQLLVRDRRRITMRYLSTF  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F+MDVASTIPFE +A+L TG+      +S+LG+LR WRLR+V  FFTRLEKDIRF+YFW+
Sbjct  141   FIMDVASTIPFEGLAYLVTGEVRESPVFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  200

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  + +E SL IRY S++YWS+T
Sbjct  201   RCARLIAVTLFLVHCAGCLYYLIADRYPQREKTWIGAVIPDFQEASLWIRYTSSVYWSIT  260

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             TMTTVGYGD+HA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA
Sbjct  261   TMTTVGYGDMHAQNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAA  320

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             S+FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICK IC +LFLPVV+ VY
Sbjct  321   SSFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKGICEYLFLPVVKDVY  380

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LFKGVSRE+LLL+V  MK EYIPP+EDVI+QNE+PDDVYI+VSGEVE +  + E EQVV 
Sbjct  381   LFKGVSREVLLLMVTKMKPEYIPPKEDVIVQNEAPDDVYIVVSGEVEAVYFDGEREQVVA  440

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
             TL +  +FGEV AL  RPQ  T+RT+TLSQLL+L+  +L E +Q K ED++ +IKNFL+H
Sbjct  441   TLGTRGIFGEVSALSDRPQGLTFRTRTLSQLLRLRQATLREGMQSKPEDSVVIIKNFLKH  500

Query  1085  HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
               ++ D+K+ DL  E   E    N+  NL TV ATGN++FL +LLK G+DP++GDSKG+T
Sbjct  501   QIEMHDMKVEDLLGEDAGEYDHGNIPCNLLTVAATGNSSFLEDLLKVGMDPDVGDSKGRT  560

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIAASKG+EECV+VLLKH CN+++KD +GNTALW+AIAA+ H IF+ILYH+A +S P+
Sbjct  561   ALHIAASKGYEECVLVLLKHACNVNIKDAQGNTALWNAIAARHHKIFNILYHFARVSSPH  620

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
              AGDLLC AA+  D   ++ELLKHGL VDS+D  G+TA++AA+ E  AD  + LV++GA 
Sbjct  621   AAGDLLCLAARRGDVDTLRELLKHGLAVDSEDHDGATALRAALAEGHADAARFLVLSGAS  680

Query  545   IDDA-----------VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAA---------SK  426
             +D A            +  ++P +L E++QKREL H +++ ++    AA         + 
Sbjct  681   VDKANLDGSGSGSFPRQTTVSPDELRELMQKRELAHAVSIVDSTSPAAAAVVREIGSPAD  740

Query  425   WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLG  246
               K    ++ S    C  RVSIY+GHP  R  +   E G+LI LP T+    +I  EKL 
Sbjct  741   RRKARAPSTRSDGDHCP-RVSIYKGHPFVRNPSS--EAGKLINLPGTMEAFKAIIEEKLK  797

Query  245   FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              DA  + + ++EGA IDSIDVIRDNDKLFIV +
Sbjct  798   VDAKKTLIMNDEGAEIDSIDVIRDNDKLFIVTE  830



>ref|XP_006431831.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
 gb|ESR45071.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
Length=679

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/673 (71%), Positives = 557/673 (83%), Gaps = 8/673 (1%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPFE + +L TG     + YS+LG+LRFWRLRRV   FTRLEKDIRF+YFW+RC
Sbjct  1     MDVASTIPFEAIGYLITGNKKAALSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWIRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
              +LLFVTL LVHCAGCLYY LADRYPH+G+ WLGS+N    E SL IRYISAMYWS+TTM
Sbjct  61    IKLLFVTLFLVHCAGCLYYLLADRYPHKGETWLGSVNPNFTETSLWIRYISAMYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASN
Sbjct  121   TTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLK+QILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLFL  VEKVYLF
Sbjct  181   FVGRNRLPPRLKKQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFLHTVEKVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             K VS+EI++LLVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVEMID EME E  V TL
Sbjct  241   KDVSKEIIVLLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEMIDYEMEKEIAVGTL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GDMFGEVGALCCRPQ +TYRTKTLSQLL+LKT++L+EA+Q K+EDN++++KNFLQ HK
Sbjct  301   QTGDMFGEVGALCCRPQIYTYRTKTLSQLLRLKTSALIEAMQSKQEDNVSILKNFLQQHK  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             KLKDL +GDL  E G+EDGDPNMS+NL TV +TGNA FL+ELLKA LDP+IGDSKG+TPL
Sbjct  361   KLKDLNIGDLIAESGEEDGDPNMSVNLLTVASTGNAAFLDELLKARLDPDIGDSKGRTPL  420

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKGHEECV+VLLKH  N+HL+DM GNTALW+AI++K HSIF ILYH  +ISDPY A
Sbjct  421   HIAASKGHEECVLVLLKHASNVHLRDMNGNTALWEAISSKHHSIFRILYHCTAISDPYTA  480

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GDLLC AAK ND SVM+EL+K+GL+VDSKDRHG TAI+ AM EN  +M+  LVMNG+++ 
Sbjct  481   GDLLCTAAKRNDMSVMEELVKYGLNVDSKDRHGRTAIEIAMAENNVEMVNFLVMNGSDVV  540

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAM--PNTILHEAASKWAKD---DHQNSSSMPQQCS  375
              A K   +  +L ++LQKRE+GHRI +   N+  +E   K  +    + +   S    C 
Sbjct  541   GANKCEFSSTNLNDMLQKREIGHRITVHDDNSTQNEVLLKKLEIIDFEAKEGKSKGGNCQ  600

Query  374   IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
              RVSIYRGHP  R++  C E GRLIKLP ++ EL  IAGEK GFDA ++ +TDE GA ID
Sbjct  601   -RVSIYRGHPLVRKQACCMEAGRLIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAEID  659

Query  194   SIDVIRDNDKLFI  156
             SI+VIRDNDK+FI
Sbjct  660   SIEVIRDNDKIFI  672



>ref|XP_004961990.1| PREDICTED: potassium channel AKT2-like isoform X2 [Setaria italica]
Length=857

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/813 (60%), Positives = 603/813 (74%), Gaps = 32/813 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG     H  S G     VISP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  35    FNLRNLSKVILPPLGGPSSGHGQSHGGSDKRVISPLDSRYRCWETFMVVLVAYSAWVYPF  94

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F
Sbjct  95    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITFRYLSTFF  154

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A+L TG+   G  YS+LG+LR WRLR+V  FFTRLEKDIRFSYFW+R
Sbjct  155   IMDVASTIPFQGLAYLVTGEVREGAAYSLLGILRLWRLRKVKQFFTRLEKDIRFSYFWIR  214

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
             CARL+ VTL LVHCAGC+YY +ADRYPH+ K W+G+   N R+ SL+IRYIS++YWS+TT
Sbjct  215   CARLVAVTLFLVHCAGCVYYLIADRYPHRDKTWIGAAIPNFRQASLRIRYISSIYWSITT  274

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHA NTLEM+F IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS++AAS
Sbjct  275   MTTVGYGDLHAENTLEMVFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSVRAAS  334

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             +FV RN LP RLK+QILAYMCL+F+AESLNQQ L++QLPK+I KSIC  LFLPVV+ VYL
Sbjct  335   SFVVRNRLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSIYKSICERLFLPVVKDVYL  394

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVSRE LL LV  MK EYIPPREDVI+Q+E+PDDVY++VSGEVE+I  +   E+V  T
Sbjct  395   FRGVSREGLLCLVTKMKPEYIPPREDVIVQDEAPDDVYVVVSGEVEVIRFDGAEERVEAT  454

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L S D+FGEV AL  R Q FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+H 
Sbjct  455   LVSRDIFGEVSALSNRAQGFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVIIKNFLKHQ  514

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K+ DL  E   E  D N   N+ TV A GNA  L +LL+AG D ++GD+KG+T 
Sbjct  515   VEMHGMKVEDLLAENAGEQDDAN---NVLTVAAMGNAGLLEDLLRAGKDADVGDAKGRTA  571

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN+++KD +GNTALW A+AA  H IF+ILYH+A +S P  
Sbjct  572   LHIAASKGYEDCVLVLLKHACNVNIKDAQGNTALWHAVAAGHHKIFNILYHFARVSSPRA  631

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD+LC AA+ ND   ++ELLK GL VDS+D  G+TA++ AM E  AD  + L+MNGA +
Sbjct  632   GGDVLCLAARRNDVGALRELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLIMNGASV  691

Query  542   DD----------------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWA  420
             D                 A +L ++P +L E+L+KRELGH+I +   P  +     S   
Sbjct  692   DKAGLDDDDGSGSSSGSGAARLAMSPGELRELLKKRELGHQITIIDSPAVVPDGGGSSRH  751

Query  419   KDD--HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLG  246
             +     Q S+S       RVSIY+GHP  R  +   E G+LI LP T+ E  +I  EKL 
Sbjct  752   RRQGRFQQSTSSDSARWPRVSIYKGHPFLRNHSS--EAGKLINLPGTMEEFKAIIREKLK  809

Query  245   FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              DA  + + ++EGA IDSIDVIRDNDKLF+V +
Sbjct  810   VDAEKALIVNDEGAEIDSIDVIRDNDKLFVVTE  842



>ref|XP_010681784.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=810

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/787 (59%), Positives = 594/787 (75%), Gaps = 24/787 (3%)
 Frame = -2

Query  2501  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40    TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100   FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRLEKDIRFSYFWVRCAR
Sbjct  160   LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRCAR  219

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTT  1794
             LLFVTL LVHCAGCLYY LADRYPH+GK W+G++N   RE SL +RYISA+YWS+TTMTT
Sbjct  220   LLFVTLFLVHCAGCLYYLLADRYPHEGKTWIGAMNPNFRETSLWVRYISAIYWSITTMTT  279

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NTLEMIFIIFYMLFNL LTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+FV
Sbjct  280   VGYGDLHANNTLEMIFIIFYMLFNLSLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASSFV  339

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             SRN LP RLKEQIL YMCLRFKAE+LNQ  LIE LP +I K+IC HLFLP +EKVYLF+G
Sbjct  340   SRNRLPTRLKEQILGYMCLRFKAENLNQFQLIEHLPNSIYKNICQHLFLPTIEKVYLFRG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             ++R+ LL+LVA+ KAEY+PPRED+IMQNE   D+YIIVSGEVEMID E E E VV TL  
Sbjct  400   ITRKSLLVLVANTKAEYLPPREDIIMQNEVASDIYIIVSGEVEMIDYESEKEIVVGTLQV  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GDMFGEV A+C  PQSFT RT+TL+QLL+L  ++L+EA++ ++ED++ M+ NFLQH++KL
Sbjct  460   GDMFGEVAAICSTPQSFTIRTRTLAQLLRLNNSTLIEAMKFRQEDHVVMVNNFLQHNRKL  519

Query  1073  kdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
                  GD  IE  D DG+   ++NL  V A GN+ FL++LLKA LDP++ DS+G+TPLH 
Sbjct  520   NVASAGDWRIENADRDGELFKALNLLNVAAAGNSVFLDKLLKAKLDPDVCDSRGRTPLHE  579

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AAS+GHEECV++LL HGCN+ L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGD
Sbjct  580   AASRGHEECVILLLNHGCNVLLRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGD  639

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
             LL  A K ND +V+++LLK GL VDS + HG TA+Q A+  N  ++  LL+  GA+  D 
Sbjct  640   LLTTATKRNDIAVIKDLLKCGLDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD-  698

Query  533   VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYR  354
                          L    +    A  N    +   K   D     S     C+ R+++++
Sbjct  699   -------------LNGNTISSIFAARNQHFVQVNKKRGND-----SKFEPSCA-RINLFK  739

Query  353   GHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
             G+P +         GRLI+LP +  EL  IAGEK   +AT+ ++ +EEGA +DSI VIRD
Sbjct  740   GYPTSSNTFDKNSTGRLIRLPSSFEELQVIAGEKFKVNATNLTIVNEEGAEVDSIQVIRD  799

Query  173   NDKLFIV  153
             NDKL++V
Sbjct  800   NDKLYVV  806



>ref|XP_010930758.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2-like [Elaeis 
guineensis]
Length=834

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/831 (58%), Positives = 615/831 (74%), Gaps = 21/831 (3%)
 Frame = -2

Query  2603  PVYYTYVAQAPNSMMNKDTAAssssssSQEDEDFSLGKLSKFILPPLG--SSQPTHTSSQ  2430
             P + T  A   ++   K+  A  +    +    F LG L++ ILPPLG  SS  T    +
Sbjct  7     PTFETSTAAQSST---KERHARRNKHEDESSTSFILGNLAELILPPLGVSSSNQTQVDPK  63

Query  2429  GLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIV  2250
             G VI+PMDSRYR WET+MV+LVAYSAWV P EI F+ +     L++ DNI+  FFAVDI+
Sbjct  64    GRVIAPMDSRYRYWETFMVMLVAYSAWVFPLEIGFMNAAPKGGLFIADNIIHAFFAVDII  123

Query  2249  LTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSV  2070
             LTFFVAYI+P TQLL+   KKIA RYLSTWF+MDV STIP+E + +  TG+   GV YS+
Sbjct  124   LTFFVAYIEPRTQLLVQDSKKIAIRYLSTWFIMDVVSTIPYEALGYFITGRVKAGVSYSL  183

Query  2069  LGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQ  1890
             LGMLR WRL ++  FFTRLEKDIRFSYFW+RC RLL VTL L+HCAGCLYY LADRYP+Q
Sbjct  184   LGMLRLWRLSKIKQFFTRLEKDIRFSYFWIRCCRLLSVTLFLMHCAGCLYYLLADRYPNQ  243

Query  1889  GKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLG  1716
             GK W+G++  N RE SL +RYIS++YWS+TTMTTVGYGDLHAVN  EMIF I YMLFNLG
Sbjct  244   GKTWIGAVIPNFREASLSVRYISSIYWSITTMTTVGYGDLHAVNAREMIFNILYMLFNLG  303

Query  1715  LTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESL  1536
             LTAY+IGNMTNLVVEGTR TMEFRNSIQAASNFV RNHLP  L EQILA+MCL FKAESL
Sbjct  304   LTAYLIGNMTNLVVEGTRHTMEFRNSIQAASNFVYRNHLPPHLGEQILAHMCLTFKAESL  363

Query  1535  NQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIM  1356
             NQ  L++QLPK+I KSIC H FLP +++VYLFKGVS+++LLLLV  MKAEY+PPREDVIM
Sbjct  364   NQHQLMDQLPKSIRKSICQHFFLPTLKEVYLFKGVSKDMLLLLVTKMKAEYVPPREDVIM  423

Query  1355  QNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsq  1176
             QNE+PDDVY++VSG+VE +  + E E+VV  L++GD+FGE+ ALC RPQS+T+RTKTL Q
Sbjct  424   QNETPDDVYVVVSGKVETVYCDNEKEEVVGELSTGDIFGEISALCNRPQSYTFRTKTLCQ  483

Query  1175  llklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLF  996
             LL++K  SL E LQ K++D I +I+NFL+H  + KD+ + +L  E G+ D + N+  NL 
Sbjct  484   LLRMKQCSLREVLQTKQKDRIVIIENFLKHQIEYKDISIANLIEENGECD-EANIPCNLL  542

Query  995   TVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDME  816
             TVVATG++  L ELLKAG+DP+IGDS+G+ PLHIAASKG E+CV+VLL H CN++++DM+
Sbjct  543   TVVATGSSCLLEELLKAGMDPDIGDSRGRRPLHIAASKGFEDCVLVLLNHACNVNIQDMD  602

Query  815   GNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDS  636
             GNT LW AI AK H IF++LY  A IS+P + G+LLC AAK ND S ++ELLKH L++DS
Sbjct  603   GNTPLWIAITAKHHKIFNLLYRCACISNPNIGGNLLCLAAKRNDLSTVKELLKHSLNMDS  662

Query  635   KDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA--VKLNLAPLD---LTEVLQKRELGH  471
             ++  G TA+Q A+ EN  ++I+ LVMNGA I+ A     N   +    L E++ KRE+G+
Sbjct  663   ENHEGLTALQVALAENHEEIIRFLVMNGANIEKAGLSGRNXRKMKHHLLEEMVHKREVGY  722

Query  470   RIA---MPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLI  300
              I    +P+       S   +  H  +      C  RVS+Y+GHP  R  +   E G+LI
Sbjct  723   PITVLELPSETKQIKVS--GEQGHMLNWERIGHCP-RVSVYKGHPLLRIPSS--EAGKLI  777

Query  299   KLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              LP T+ EL +I G++LG DA++ ++T+ +GA IDSI+V+R NDKLFIV D
Sbjct  778   SLPSTMKELKNIIGKRLGIDASNRTVTNADGAEIDSIEVLRHNDKLFIVED  828



>ref|XP_004961989.1| PREDICTED: potassium channel AKT2-like isoform X1 [Setaria italica]
Length=855

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/813 (60%), Positives = 602/813 (74%), Gaps = 34/813 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG     H  S G     VISP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  35    FNLRNLSKVILPPLGGPSSGHGQSHGGSDKRVISPLDSRYRCWETFMVVLVAYSAWVYPF  94

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F
Sbjct  95    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITFRYLSTFF  154

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A+L TG+   G  YS+LG+LR WRLR+V  FFTRLEKDIRFSYFW+R
Sbjct  155   IMDVASTIPFQGLAYLVTGEVREGAAYSLLGILRLWRLRKVKQFFTRLEKDIRFSYFWIR  214

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
             CARL+ VTL LVHCAGC+YY +ADRYPH+ K W+G+   N R+ SL+IRYIS++YWS+TT
Sbjct  215   CARLVAVTLFLVHCAGCVYYLIADRYPHRDKTWIGAAIPNFRQASLRIRYISSIYWSITT  274

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHA NTLEM+F IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS++AAS
Sbjct  275   MTTVGYGDLHAENTLEMVFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSVRAAS  334

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             +FV RN LP RLK+QILAYMCL+F+AESLNQQ L++QLPK+I KSIC  LFLPVV+ VYL
Sbjct  335   SFVVRNRLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSIYKSICERLFLPVVKDVYL  394

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVSRE LL LV  MK EYIPPREDVI+Q+E+PDDVY++VSGEVE+I  +   E+V  T
Sbjct  395   FRGVSREGLLCLVTKMKPEYIPPREDVIVQDEAPDDVYVVVSGEVEVIRFDGAEERVEAT  454

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L S D+FGEV AL  R Q FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+  
Sbjct  455   LVSRDIFGEVSALSNRAQGFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVIIKNFLK--  512

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K+ DL  E   E  D N   N+ TV A GNA  L +LL+AG D ++GD+KG+T 
Sbjct  513   VEMHGMKVEDLLAENAGEQDDAN---NVLTVAAMGNAGLLEDLLRAGKDADVGDAKGRTA  569

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN+++KD +GNTALW A+AA  H IF+ILYH+A +S P  
Sbjct  570   LHIAASKGYEDCVLVLLKHACNVNIKDAQGNTALWHAVAAGHHKIFNILYHFARVSSPRA  629

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD+LC AA+ ND   ++ELLK GL VDS+D  G+TA++ AM E  AD  + L+MNGA +
Sbjct  630   GGDVLCLAARRNDVGALRELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLIMNGASV  689

Query  542   DD----------------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWA  420
             D                 A +L ++P +L E+L+KRELGH+I +   P  +     S   
Sbjct  690   DKAGLDDDDGSGSSSGSGAARLAMSPGELRELLKKRELGHQITIIDSPAVVPDGGGSSRH  749

Query  419   KDD--HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLG  246
             +     Q S+S       RVSIY+GHP  R  +   E G+LI LP T+ E  +I  EKL 
Sbjct  750   RRQGRFQQSTSSDSARWPRVSIYKGHPFLRNHSS--EAGKLINLPGTMEEFKAIIREKLK  807

Query  245   FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              DA  + + ++EGA IDSIDVIRDNDKLF+V +
Sbjct  808   VDAEKALIVNDEGAEIDSIDVIRDNDKLFVVTE  840



>sp|Q75HP9.1|AKT2_ORYSJ RecName: Full=Potassium channel AKT2 [Oryza sativa Japonica Group]
 gb|AAS90668.1| putative potassium channel protein [Oryza sativa Japonica Group]
 gb|EEE63802.1| hypothetical protein OsJ_18626 [Oryza sativa Japonica Group]
 gb|AFC96958.1| AKT2/3-like potassium channel [Oryza sativa Japonica Group]
Length=855

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/813 (60%), Positives = 613/813 (75%), Gaps = 31/813 (4%)
 Frame = -2

Query  2501  SLGKLSKFILPPLGSSQPTHTSS------QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +L  LSK ILPPLG     H  S         VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  31    NLRNLSKLILPPLGVPAGGHAQSGHAGPNDRRVISPLDSRYRCWDTFMVVLVAYSAWVYP  90

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R++IATRYLST+
Sbjct  91    FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRRIATRYLSTF  150

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F+MDVASTIPF+ +A++ TG+      +S+LG+LR WRLR+V  FFTRLEKDIRF+YFW+
Sbjct  151   FIMDVASTIPFQGLAYIVTGEVRESPAFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  210

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCARL+ VTL LVHCAGCLYY +ADRYPH+ K W+G++  + +E SL IRY S++YWS+T
Sbjct  211   RCARLIAVTLFLVHCAGCLYYLIADRYPHREKTWIGAVIPDFQEASLWIRYTSSVYWSIT  270

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             TMTTVGYGD+HA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA
Sbjct  271   TMTTVGYGDMHAQNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAA  330

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             SNFV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICK IC +LFLPVV+ VY
Sbjct  331   SNFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKGICEYLFLPVVKDVY  390

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMI--DNEMENEQV  1272
             LFKGVSRE+LLL+V  MK EYIPP+EDVI+QNE+PDDVYI+VSGEVE+I  D E E E+V
Sbjct  391   LFKGVSREVLLLMVTKMKPEYIPPKEDVIVQNEAPDDVYIVVSGEVEVIYSDGEAE-ERV  449

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V TL +  +FGEV AL  RPQSFT RT+TL QLL+L+  +L EA+Q K ED++ +IKNFL
Sbjct  450   VATLGTRGVFGEVSALSDRPQSFTLRTRTLCQLLRLRQAALKEAMQSKPEDSVVIIKNFL  509

Query  1091  QHHkklkdlklgdLFIEIGDEDGD-PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             +H  ++ D+K+ DL  E    + D  N+  NL TV ATGN++FL +LLK G+DP++GDSK
Sbjct  510   KHQIEMHDMKVEDLLGEDAAGEYDHGNIPCNLLTVAATGNSSFLEDLLKVGMDPDVGDSK  569

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+T LHIAASKG+E+CV+VLLK  CN+++KD +GNTALW+AIAA+ H IF+ILYH+A +S
Sbjct  570   GRTALHIAASKGYEDCVLVLLKQACNVNIKDAQGNTALWNAIAARHHKIFNILYHFARVS  629

Query  734   DP-YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              P + AGDLLC AA+  D   ++ELLKHGL VDS+DR G+TA++ A+ E  AD+ +LLV+
Sbjct  630   SPHHAAGDLLCLAARRGDLDTLRELLKHGLAVDSEDRDGATALRVALAEGHADVARLLVL  689

Query  557   NGAEIDDAVKLN-------LAPLDLTEVLQKRELGHRI---------AMPNTILHEAASK  426
             NGA +D A   N       ++  +L E+++ REL H +         A    I    +S 
Sbjct  690   NGASVDRAASHNEQQAAAAVSVDELRELMKTRELAHPVTIVVDSPSPAAAAVIREVGSSG  749

Query  425   WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLG  246
              +++  + S+        RVSIYRGHP  R  +   E G+LI LP T+ E   I  EKL 
Sbjct  750   DSRNGRRQSARSDGAHWPRVSIYRGHPFVRNRSS--EAGKLINLPGTMEEFRIIIEEKLK  807

Query  245   FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              DA  + + ++EGA IDSIDVIRDNDKLFIV +
Sbjct  808   VDARKTLIMNDEGAEIDSIDVIRDNDKLFIVTE  840



>ref|XP_008378876.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Malus domestica]
Length=797

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/762 (63%), Positives = 578/762 (76%), Gaps = 53/762 (7%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65    ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA         
Sbjct  125   VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIA---------  175

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
                                            +RFWRLRR    FTRLEKDIRFSYFWVRC
Sbjct  176   -------------------------------MRFWRLRRAKQLFTRLEKDIRFSYFWVRC  204

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARLL VT+  VHCAGCLYY LADRYPH+GK W+G++  N RE  L IRYISA+YWSMTTM
Sbjct  205   ARLLSVTVFSVHCAGCLYYLLADRYPHRGKTWIGTVFPNFRETGLWIRYISALYWSMTTM  264

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +TVGYGDLHAVN +EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+
Sbjct  265   STVGYGDLHAVNXVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASS  324

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RL++QILAY+CLRFKAESLNQQ ++EQ PK+ICKSIC HLFLP+VEKVYLF
Sbjct  325   FVCRNRLPQRLRDQILAYICLRFKAESLNQQQMLEQFPKSICKSICQHLFLPIVEKVYLF  384

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVSRE LL LVA MKAEYIPPREDV++Q+E+P+DVYIIVSGEVE+ID EME E+ V TL
Sbjct  385   RGVSRETLLHLVAKMKAEYIPPREDVVLQSEAPEDVYIIVSGEVEIIDCEMERERAVGTL  444

Query  1259  NSGDMFGEVGALC-------CRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
              SGDM GEV A C       CRPQ+FTYRTKTLSQLL++KTT+L+EA+Q K ED + M+K
Sbjct  445   QSGDMVGEVTAFCGIEVGKLCRPQTFTYRTKTLSQLLRIKTTALVEAMQTKPEDKVXMLK  504

Query  1100  NFLQHHkklkdlklgdLFIEIGDEDG-DPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             NF QHHKKL+DL++G++ +E G+++G DP  + N+ T  + G+AT L+ELLKA LDP+IG
Sbjct  505   NFNQHHKKLRDLRVGEILVESGEDEGDDPKAAFNMLTAASKGDATLLDELLKAKLDPDIG  564

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D KG+TPLHIAASKGH ECV+VLLK+ CN+H++D  GNTALWDAIA+K HSIF  LY  A
Sbjct  565   DFKGRTPLHIAASKGHYECVLVLLKYACNVHVRDTNGNTALWDAIASKHHSIFRSLYFCA  624

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +ISDPY AGDLLC AAK N+ +VM+ELLK GL+VDSK++ G TA+Q AMEEN ADM+ LL
Sbjct  625   AISDPYTAGDLLCTAAKRNNLTVMEELLKQGLNVDSKNQLGKTAVQIAMEENNADMVNLL  684

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             VMNGA++ +A         LTE+LQKRE+GHRI +P++ ++E       + +    S   
Sbjct  685   VMNGADVTNAQNCLFPSQSLTEMLQKREVGHRITVPDSTINEVPLMKNGERNSGRESYGV  744

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAG  258
              C  RVSIYRGHP  R+ T C E GR+I+LP ++ EL + AG
Sbjct  745   NCP-RVSIYRGHPMVRKTTCCREAGRVIRLPXSLEELRNXAG  785



>gb|EAY98139.1| hypothetical protein OsI_20054 [Oryza sativa Indica Group]
Length=855

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/812 (60%), Positives = 613/812 (75%), Gaps = 29/812 (4%)
 Frame = -2

Query  2501  SLGKLSKFILPPLGSSQPTHTSS------QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +L  LSK ILPPLG     H  S         VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  31    NLRNLSKLILPPLGVPAGGHAQSGHAGPNDRRVISPLDSRYRCWDTFMVVLVAYSAWVYP  90

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R++IATRYLST+
Sbjct  91    FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRRIATRYLSTF  150

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F+MDVASTIPF+ +A++ TG+      +S+LG+LR WRLR+V  FFTRLEKDIRF+YFW+
Sbjct  151   FIMDVASTIPFQGLAYIVTGEVRESPAFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  210

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCARL+ VTL LVHCAGCLYY +ADRYPH+ K W+G++  + +E SL IRY S++YWS+T
Sbjct  211   RCARLIAVTLFLVHCAGCLYYLIADRYPHREKTWIGAVIPDFQEASLWIRYTSSVYWSIT  270

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             TMTTVGYGD+HA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AA
Sbjct  271   TMTTVGYGDMHAQNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAA  330

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             SNFV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICK IC +LFLPVV+ VY
Sbjct  331   SNFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKGICEYLFLPVVKDVY  390

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME-NEQVV  1269
             LFKGVSRE+LLL+V  MK EYIPP+EDVI+QNE+PDDVYI+VSGEVE+I ++ E  E+VV
Sbjct  391   LFKGVSREVLLLMVTKMKPEYIPPKEDVIVQNEAPDDVYIVVSGEVEVIYSDGEAGERVV  450

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
              TL +  +FGEV AL  RPQSFT RT+TL QLL+L+  +L EA+Q K ED++ +IKNFL+
Sbjct  451   ATLGTRGVFGEVSALSDRPQSFTLRTRTLCQLLRLRQAALKEAMQSKPEDSVVIIKNFLK  510

Query  1088  HHkklkdlklgdLFIEIGDEDGD-PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             H  ++ D+K+ DL  E    + D  N+  NL TV ATGN++FL +LLK G+DP++GDSKG
Sbjct  511   HQIEMHDMKVEDLLGEDAAGEYDHGNIPCNLLTVAATGNSSFLEDLLKVGMDPDVGDSKG  570

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +T LHIAASKG+E+CV+VLLK  CN+++KD +GNTALW+AIAA+ H IF+ILYH+A +S 
Sbjct  571   RTALHIAASKGYEDCVLVLLKQACNVNIKDAQGNTALWNAIAARHHKIFNILYHFARVSS  630

Query  731   P-YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
             P + AGDLLC AA+  D   ++ELLKHGL VDS+DR G+TA++ A+ E  AD+ +LLV+N
Sbjct  631   PHHAAGDLLCLAARRGDLDTLRELLKHGLAVDSEDRDGATALRVALAEGHADVARLLVLN  690

Query  554   GAEIDDAVKLN-------LAPLDLTEVLQKRELGHRI---------AMPNTILHEAASKW  423
             GA +D A   N       ++  +L E+++ REL H +         A    I    +S  
Sbjct  691   GASVDRAASHNEQQAAAAVSVDELRELMKTRELAHPVTIVVDSPSPAAAAVIREVGSSGD  750

Query  422   AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGF  243
             +++  + S+        RVSIYRGHP  R  +   E G+LI LP T+ E   I  EKL  
Sbjct  751   SRNGRRQSARSDGAHWPRVSIYRGHPFVRNRSS--EAGKLINLPGTMEEFRIIIEEKLKV  808

Query  242   DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
             DA  + + ++EGA IDSIDVIRDNDKLFIV +
Sbjct  809   DARKTLIMNDEGAEIDSIDVIRDNDKLFIVTE  840



>ref|XP_006585490.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Glycine max]
Length=673

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/669 (70%), Positives = 550/669 (82%), Gaps = 5/669 (1%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+ASTIP+E + +LFTG+  +G+ Y +LG+LRFWR+RRV  +FTRLEKDIRFSYFWVRC
Sbjct  1     MDLASTIPYEAIGYLFTGRQKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARLL VTL  VHCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTM
Sbjct  61    ARLLSVTLFSVHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASN
Sbjct  121   TTVGYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RN LP RLKEQILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLF   VEKVYLF
Sbjct  181   FVCRNRLPPRLKEQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFFATVEKVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVS+EI+L LVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVE++D E E E+++ TL
Sbjct  241   KGVSKEIILSLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEILDTETEKERILGTL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
             ++G+MFGE GALCCRPQS TYRTKTL+QLL+LKT +LLEA+Q+KREDNI ++KNFLQH K
Sbjct  301   HTGEMFGEFGALCCRPQSLTYRTKTLTQLLRLKTNTLLEAMQIKREDNIQILKNFLQHFK  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             ++KDL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPL
Sbjct  361   QVKDLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPL  419

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAAS GHE CV VLLKH CN+H+KDM GNTALWDAIA+K +SIF IL+  +++SDP +A
Sbjct  420   HIAASNGHEGCVKVLLKHACNMHIKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIA  479

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GDL+C AAK N+ +VM +LL+ GL+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ 
Sbjct  480   GDLMCTAAKRNELTVMTDLLRQGLNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVS  539

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRV  366
             D          L E+LQKRE+GH I +   +L E   K    + +H    S       RV
Sbjct  540   DVHNHEFCSSTLNEMLQKREIGHLINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRV  599

Query  365   SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             SIYRGHP  RRE    E G+LI+LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+D
Sbjct  600   SIYRGHPVVRREKCSMEAGKLIRLPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVD  659

Query  185   VIRDNDKLF  159
             VIRDNDKLF
Sbjct  660   VIRDNDKLF  668



>ref|XP_008655420.1| PREDICTED: potassium channel protein ZMK2 isoform X1 [Zea mays]
Length=847

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/810 (58%), Positives = 603/810 (74%), Gaps = 29/810 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG      + S G     V+SP+DSRYR W+T+MV+LVAYSAWV PF
Sbjct  28    FNLRNLSKVILPPLGGPSGGQSQSHGGSDKWVVSPLDSRYRWWDTFMVVLVAYSAWVYPF  87

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RKKI  RYLST+F
Sbjct  88    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDGRTQLLVRDRKKITLRYLSTFF  147

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRLEKDIRFSYFW+R
Sbjct  148   IMDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIR  207

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
              ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  N R+ SL+IRYIS++YWS+TT
Sbjct  208   SARLVAVTLFLVHCAGCLYYLIADRYPDRQKTWIGAVIPNFRQASLRIRYISSIYWSITT  267

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHA N +EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  268   MTTVGYGDLHAQNNVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAAS  327

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             +FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYL
Sbjct  328   SFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYL  387

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVSRE+LL LV  MK EYIPP+EDVI+QNE+PDDVY++VSGEVE+I  +   EQV  T
Sbjct  388   FRGVSREMLLSLVTKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVILFDGIYEQVQAT  447

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+H 
Sbjct  448   LGARDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVVIKNFLKHQ  507

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K+ DL   +GD  G+ +   N+ TV A GN+  L +LL+AG D ++GD+KG+T 
Sbjct  508   VEMHGMKVEDL---LGDNTGEHDDDANVLTVAAMGNSGLLEDLLRAGKDADVGDAKGRTA  564

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN++++D +GNTA+W+AIAA  H  F++LY +   S+P  
Sbjct  565   LHIAASKGYEDCVLVLLKHACNVNIRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRA  624

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD++C AA+      +QELLK GL VDS+D  G+TA++ AM E  AD  + L++NGA +
Sbjct  625   GGDVMCLAARRGHLGALQELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLILNGASV  684

Query  542   DD---------------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAK  417
             D                A +L ++P +L E+LQKRELGH I +   P  + +  +S  ++
Sbjct  685   DKASLDDDGSGSGSGSGAARLAMSPTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSR  744

Query  416   DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDA  237
                  S+S   Q   RVS+Y+GHP  R  T   E G+LI LP T+ E  +I GEKL  DA
Sbjct  745   PGRLQSTSSDSQRWPRVSVYKGHPFLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDA  802

Query  236   TDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
               + +  +EGA IDSIDVIRDNDKLF+V +
Sbjct  803   EKALIVSDEGAEIDSIDVIRDNDKLFMVTE  832



>ref|XP_006859218.1| hypothetical protein AMTR_s00070p00197870 [Amborella trichopoda]
 gb|ERN20685.1| hypothetical protein AMTR_s00070p00197870 [Amborella trichopoda]
Length=814

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/806 (59%), Positives = 604/806 (75%), Gaps = 38/806 (5%)
 Frame = -2

Query  2498  LGKLSKFILPPLGSSQP----THTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             L  LSKF+LPPLG+S      T  +S+G +ISP+DS YRCWET+MVLLVAYSAW  PFEI
Sbjct  17    LRNLSKFLLPPLGASSSDCGQTPINSKGSMISPLDSGYRCWETFMVLLVAYSAWTYPFEI  76

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +F+ S    +L++ DNIV+LFFA+DI LTFF+AYIDP TQ+L+H+R+KIA RY+STWF+M
Sbjct  77    AFINSTPKGELFIADNIVNLFFAMDIALTFFLAYIDPKTQILVHNRRKIAVRYISTWFIM  136

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ STIPF  +  LFTG++  G+  S LGMLR WRL RV  FFTR+EKDIRFSYFW+RC 
Sbjct  137   DLVSTIPFGALTKLFTGEYRCGLSCSFLGMLRLWRLLRVKQFFTRIEKDIRFSYFWIRCT  196

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMT  1797
             RLL VTLLLVH AGC YYFLAD+YP +G+ W+GS   N ++  L +RYIS++YWS+TTMT
Sbjct  197   RLLSVTLLLVHLAGCFYYFLADKYPQEGRTWIGSGNPNFKDSGLWVRYISSIYWSITTMT  256

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHAVNT+EMIFIIFYML NLGLTAYIIGNMTNL+VEGTRRTMEFRNSI+AASNF
Sbjct  257   TVGYGDLHAVNTIEMIFIIFYMLLNLGLTAYIIGNMTNLIVEGTRRTMEFRNSIKAASNF  316

Query  1616  VSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFK  1437
             V RNHLP +LK QIL YMCL+++ ESLNQQ L+EQLPK+ICKSIC HLFLP+VE VYLFK
Sbjct  317   VCRNHLPPKLKGQILTYMCLKYRTESLNQQQLMEQLPKSICKSICRHLFLPIVEPVYLFK  376

Query  1436  GVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN  1257
             GVS E+LL+LV +MKAEY PP ED+IMQNE+ +D+YI+VSGEVE I  + E EQV+  L+
Sbjct  377   GVSSELLLILVTEMKAEYFPPGEDIIMQNEAANDIYILVSGEVETIICKEEKEQVLGNLS  436

Query  1256  SGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkk  1077
              GD+FGE+ ALC RPQSFTYRTK LSQLL+L    LLEA+Q K EDNIT+++NFLQH  +
Sbjct  437   IGDVFGEIAALCNRPQSFTYRTKALSQLLRLNRRVLLEAMQAKHEDNITILRNFLQHLGE  496

Query  1076  lkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             L+    G+  +E  + + D   S ++ +V ATGN+  L ELL  G+DP+  DS+G+TPLH
Sbjct  497   LEVSNFGET-VEKVERNADLESSNDMCSVAATGNSDLLAELLITGMDPDTEDSRGRTPLH  555

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAA+KG++ECV VLL++GCN++  D  GNT LW+AI++K HSIF +LY++ASI++P   G
Sbjct  556   IAAAKGYDECVHVLLRYGCNVNTSDDSGNTPLWEAISSKNHSIFRLLYNYASITNPDCGG  615

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI--  543
             DLLC AAK N+  V+QELLK G+ ++S  R GST +  A+ E   DM+  LV NGA+I  
Sbjct  616   DLLCLAAKRNNLIVLQELLKQGISINSTSRCGSTPLHIAITEKHIDMVSFLVTNGADINK  675

Query  542   -------------DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDH--  408
                          +D  +L  + L+  E+LQ + L HRI    T+  E + +  + +H  
Sbjct  676   TDLKGQTVREMVAEDPEQLPCSVLE--EMLQSQGLDHRI----TVFEEPSERPTRREHLI  729

Query  407   -QNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATD  231
                +  +P     RVSIY+GHP  R    C E G+L+ LP T+A L +IAG+K G +A++
Sbjct  730   IGRNGFLP-----RVSIYKGHPWERE--ICSESGKLVPLPSTLAGLKNIAGKKFGLNASN  782

Query  230   SSLTDEEGAIIDSIDVIRDNDKLFIV  153
               +T+EEGA ID I+VIRDND+LF+V
Sbjct  783   MIITNEEGAEIDCIEVIRDNDRLFLV  808



>ref|NP_001105120.1| potassium channel protein ZMK2 [Zea mays]
 emb|CAB54856.1| potassium channel protein ZMK2 [Zea mays]
Length=849

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/810 (58%), Positives = 601/810 (74%), Gaps = 29/810 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGS----SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG        +H  S   V+SP+DSRYR W+T+MV+LVAYSAWV PF
Sbjct  30    FNLRNLSKVILPPLGGPSGGQSQSHGGSDKWVVSPLDSRYRWWDTFMVVLVAYSAWVYPF  89

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RKKI  RYLST+F
Sbjct  90    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDGRTQLLVRDRKKITLRYLSTFF  149

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRLEKDIRFSYFW+R
Sbjct  150   IMDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIR  209

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
              ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  N R+ SL+IRYIS++YWS+TT
Sbjct  210   SARLVAVTLFLVHCAGCLYYLIADRYPDRQKTWIGAVIPNFRQASLRIRYISSIYWSITT  269

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHA N +EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  270   MTTVGYGDLHAQNNVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAAS  329

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             +FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYL
Sbjct  330   SFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYL  389

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVSRE+LL LV  MK EYIPP+EDVI+QNE+PDDVY++VSGEVE+I  +   EQV  T
Sbjct  390   FRGVSREMLLSLVTKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVILFDGIYEQVQAT  449

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+H 
Sbjct  450   LGARDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVVIKNFLKHQ  509

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K+ DL   +GD  G+ +    + TV A GN+  L +LL+AG   ++GD+KG+T 
Sbjct  510   VEMHGMKVEDL---LGDNTGEHDDDAIVLTVAAMGNSGLLEDLLRAGKAADVGDAKGRTA  566

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN++++D +GNTA+W+AIAA  H IF++LY +   S+P  
Sbjct  567   LHIAASKGYEDCVLVLLKHACNVNIRDAQGNTAMWNAIAAGHHKIFNLLYQFGRASNPRA  626

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD++C AA+      +QELLK GL VDS+D  G+TA++ AM E  AD  + L++NGA +
Sbjct  627   GGDVMCLAARRGHLGALQELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLILNGASV  686

Query  542   DD---------------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAK  417
             D                A +L ++P +L E+LQKRELGH I +   P  + +  +S  ++
Sbjct  687   DKASLDDDGSGSGSGSGAARLAMSPTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSR  746

Query  416   DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDA  237
                  S+S   Q   RVS+Y+GHP  R  T   E G+LI LP T+ E   I GEKL  DA
Sbjct  747   PGRLQSTSSDSQRWPRVSVYKGHPFLRNRTS--EAGKLINLPGTMEEFKVIVGEKLKVDA  804

Query  236   TDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
               + +  +EGA IDSIDVIRDNDKLF+V +
Sbjct  805   EKALIVSDEGAEIDSIDVIRDNDKLFMVTE  834



>ref|XP_006592673.1| PREDICTED: potassium channel AKT2/3-like isoform X2 [Glycine 
max]
Length=669

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/670 (70%), Positives = 546/670 (81%), Gaps = 5/670 (1%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+ASTIP+E + +LFTGK  LG+ Y +LG+ RFWR+RRV  +FTRLEKDIRFSYFWVRC
Sbjct  1     MDLASTIPYEAIGYLFTGKRKLGLPYFLLGLFRFWRIRRVKQYFTRLEKDIRFSYFWVRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARLL VTL  +HCAGCLYY LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTM
Sbjct  61    ARLLSVTLFSIHCAGCLYYMLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASN
Sbjct  121   TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FVSRN LP RLKEQILAYMCLRFKAE+LNQ  LIEQLPK+ICKSIC HLF   VEKVYLF
Sbjct  181   FVSRNRLPPRLKEQILAYMCLRFKAENLNQHQLIEQLPKSICKSICQHLFFATVEKVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             K VS+EILL LVA MKAEYIPPREDVIMQNE+PDD+YIIVSGEVE+I  EME E+++ TL
Sbjct  241   KDVSKEILLSLVAKMKAEYIPPREDVIMQNEAPDDIYIIVSGEVEIIHTEMERERILGTL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
             ++GDMFGEVGAL  RPQSFTYRTKTL+QLL+LKT +L+EA+Q+KRED   ++KNFLQH K
Sbjct  301   HTGDMFGEVGALISRPQSFTYRTKTLTQLLRLKTNTLMEAMQIKREDR-QILKNFLQHIK  359

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             +LKDL + DL +E  +E+ DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPL
Sbjct  360   QLKDLSIKDLMVENVEEE-DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPL  418

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKGHEECV VLLKH CN+H+KDM GNTA+WDAIA+K +SIF IL+  +++SDP  A
Sbjct  419   HIAASKGHEECVKVLLKHACNMHIKDMNGNTAIWDAIASKHYSIFRILFQLSAVSDPNTA  478

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GDLLC AAK N+ +V+ +LLK GL+VDSKD H +TAIQ AM EN  DM+ LLVMNGA++ 
Sbjct  479   GDLLCTAAKRNELTVLTDLLKQGLNVDSKDHHDTTAIQIAMAENHVDMVHLLVMNGADVS  538

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVS  363
             D          L E+LQKRE+GH I +   +      K    + + +          RVS
Sbjct  539   DVHNHEFCSSTLDEMLQKREIGHLINVTEVMRSGVVLKGKHQEQELNGGRSNGLKFPRVS  598

Query  362   IYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             IYRGHP  RRE    E G+LI+LP+++ EL +IAGEK GFDA D+ +T+EEGA IDSIDV
Sbjct  599   IYRGHPVVRREKGSVEAGKLIRLPDSLEELKTIAGEKFGFDAKDAMVTNEEGAEIDSIDV  658

Query  182   IRDNDKLFIV  153
             IRDNDKLF V
Sbjct  659   IRDNDKLFFV  668



>ref|XP_010245054.1| PREDICTED: potassium channel AKT2/3-like isoform X3 [Nelumbo 
nucifera]
Length=680

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/675 (68%), Positives = 557/675 (83%), Gaps = 6/675 (1%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+ASTIPFE +  LFTGK  +G+ Y +LG+LRFWRLRRV   FTRLEKDIRFSYFW+RC
Sbjct  1     MDIASTIPFEALGHLFTGKSKVGLTYCLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL +VHCAGC+YY LADRYPHQG+ W+GS+  N RE  L  RY+S++YWS+TTM
Sbjct  61    ARLISVTLFMVHCAGCVYYLLADRYPHQGRTWIGSVIPNFREAKLWTRYVSSIYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVN++EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAAS+
Sbjct  121   TTVGYGDLHAVNSMEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASS  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLKEQILAYMCLRF+AESLNQQ L+EQLPK+ICKSIC HLFLP VEKVYLF
Sbjct  181   FVCRNHLPPRLKEQILAYMCLRFRAESLNQQQLMEQLPKSICKSICQHLFLPTVEKVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSREILLLLVA MKAEYIPPRED+IM NE+PDDVYI+VSGEVE+ID EME E+VV TL
Sbjct  241   KGVSREILLLLVAKMKAEYIPPREDIIMHNEAPDDVYIVVSGEVEIIDYEMEKERVVGTL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GD+FGEVGALC RPQSFT+RTKTLSQLL+LKT +L+EA++ K +DN  ++KNFLQH++
Sbjct  301   RTGDIFGEVGALCLRPQSFTFRTKTLSQLLRLKTCALMEAMRAKGQDNKLILKNFLQHYR  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             +LKDL + D+ IE G+ DG+PNM++NL TV ++GNA FL+ELL+A LDP+IGDS+G+TPL
Sbjct  361   ELKDLNIHDMLIENGEGDGEPNMAVNLLTVASSGNAAFLDELLRARLDPDIGDSRGRTPL  420

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAAS GHEECV+VLLKH C +++KD++GNT LWDAIAA  HSIF ILYH++SISDPY A
Sbjct  421   HIAASNGHEECVLVLLKHACKVNIKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTA  480

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             G+LLC AAK ND S M+ELLKHGL+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D
Sbjct  481   GELLCTAAKRNDLSTMKELLKHGLNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVD  540

Query  539   DAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---I  372
              A +       L E++QKR +GH I +P T++H+  S  + K   +  SS  +      +
Sbjct  541   QANQSGFPAASLNEMVQKRGVGHCITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFL  600

Query  371   RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
             RVSIY+GHP  R+ T   + G+LIKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDS
Sbjct  601   RVSIYKGHPLVRKYTFASDSGKLIKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDS  660

Query  191   IDVIRDNDKLFIVAD  147
             I+ IRDNDKLFIV +
Sbjct  661   IETIRDNDKLFIVEN  675



>ref|XP_009403703.1| PREDICTED: potassium channel AKT2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/792 (60%), Positives = 596/792 (75%), Gaps = 20/792 (3%)
 Frame = -2

Query  2483  KFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             K +LPPLG S  +     S+  +  PMDSRYRCWE +MV LVAYSAWV PFEI+F+ +  
Sbjct  42    KLVLPPLGMSSCSQNPNGSRWRIFLPMDSRYRCWEAFMVALVAYSAWVYPFEIAFMHAAP  101

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L++ DN++D FFA DIVLTFFVAYID  TQ+L+   +KIATRYLSTWF+MD+ ST+P
Sbjct  102   KGGLFLTDNVIDAFFAADIVLTFFVAYIDSRTQVLVCDPRKIATRYLSTWFIMDLTSTLP  161

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             FE + +L TG+   GV YS+LG LR WRLR+V  FFTRLEKDIRFSYF +RC RLLFVT 
Sbjct  162   FEGLGYLITGRVKAGVSYSLLGTLRLWRLRKVKRFFTRLEKDIRFSYFCIRCVRLLFVTF  221

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              LVHCAGCLYY LADRYPHQGK W+G+   N RE +L +RYI+++YWS++TMTTVGYGDL
Sbjct  222   FLVHCAGCLYYLLADRYPHQGKTWIGAAVPNFREANLWMRYIASIYWSISTMTTVGYGDL  281

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HAVNT EMIF IFYML NLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQ ASNFV RNHLP
Sbjct  282   HAVNTREMIFNIFYMLCNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQVASNFVCRNHLP  341

Query  1595  ARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
               LKEQILAYMCLRFKAE+LNQQ L++QLPK +CKSIC HLFLP V++ YLFKGVSRE L
Sbjct  342   PHLKEQILAYMCLRFKAETLNQQHLMDQLPKALCKSICQHLFLPTVKEAYLFKGVSRETL  401

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
             LLLV  MK EYIPPREDVIMQNE+P+DVYI+VSGEVE+I ++ E EQVV   ++GD+FGE
Sbjct  402   LLLVTKMKVEYIPPREDVIMQNEAPEDVYIVVSGEVEIIYSDNEMEQVVGKFSTGDIFGE  461

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
               AL  RPQSF +RT+TLSQLLKLK ++L E L  K++D I ++KNFL+H  + KD+ + 
Sbjct  462   FTALSERPQSFIFRTRTLSQLLKLKQSTLKEVLHAKQKDGIIIMKNFLKHQTEFKDISID  521

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
             +L  E G+ + + N   NL TV ATGN+ FL++LLKAG+DP+IGDSKG+TPLHIAASKG+
Sbjct  522   NLLGENGEFE-ETNKPCNLLTVAATGNSCFLDKLLKAGMDPDIGDSKGRTPLHIAASKGY  580

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             E+CV+VL+ H CNI+++DM+GNT LWDAI  K H+IF+IL+  A +S+PY + DLLC A+
Sbjct  581   EDCVLVLINHACNINIQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTSADLLCLAS  640

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-----DDAV  531
             K ND S M+ELL HGL++DS++  G TA+Q A  EN  +M+  LVMNGA I     + ++
Sbjct  641   KRNDLSTMRELLNHGLNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIVKSNPNGSI  700

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHE-AASKWAKDDHQNSSSMPQQCS---IRVS  363
             +  +    L E++Q+R++G+    P   L    A K  +   +  +S+  + +    R+S
Sbjct  701   ERWMKKEILEEMIQQRDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEANEHRPRIS  756

Query  362   IYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             ++ GHP  R      E G+LI LP T+ EL +I G+K   DA    LT+E+ A +DSIDV
Sbjct  757   VFNGHPLLRNSHS--ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDAAEVDSIDV  814

Query  182   IRDNDKLFIVAD  147
             +RDNDKLFIV +
Sbjct  815   LRDNDKLFIVGE  826



>gb|KHG14137.1| Potassium channel AKT2/3 -like protein [Gossypium arboreum]
Length=676

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/678 (70%), Positives = 556/678 (82%), Gaps = 11/678 (2%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPF+ +A+LFTGK  +G+ YS+LG+LRFWRLRRV   FTRLEKDIRFSYFW+RC
Sbjct  1     MDVASTIPFDALAYLFTGKSKMGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL LVH A CLYY LADRYPHQG  WLGS+N   RE SL IRYISA+YWS+TTM
Sbjct  61    ARLIAVTLFLVHGAACLYYMLADRYPHQGNTWLGSVNPNFRETSLWIRYISALYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR SI++ASN
Sbjct  121   TTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRKSIESASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FVSRN LP RLK+QILAYMCLRFKAESLNQQ LIEQLPK+I  SIC HLFLP+VEKVYLF
Sbjct  181   FVSRNRLPPRLKDQILAYMCLRFKAESLNQQQLIEQLPKSIYTSICQHLFLPIVEKVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ-VVWT  1263
              GVSRE LL LVA MKAEY+PPREDV MQNE P+DVYI+VSGEVE+I+ EME E+ VV T
Sbjct  241   NGVSRETLLHLVAKMKAEYVPPREDVTMQNEPPEDVYIVVSGEVEIIECEMEKEEAVVGT  300

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L  GDMFGE+GALCCRPQ FT+RTK+LSQLL+LKT  L+EA+Q K EDN+ ++KNFL+H+
Sbjct  301   LQCGDMFGEIGALCCRPQRFTFRTKSLSQLLRLKTADLIEAMQAKHEDNVAILKNFLKHN  360

Query  1082  kklkdlklgdLFIEIGDEDGDP-NMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             K+LKDLK+G + +E G+EDGDP NMS+NL  V  TGNA FLNELL+A LDP+IGDSKG+T
Sbjct  361   KRLKDLKVGGIVMEGGEEDGDPKNMSVNLLDVADTGNAAFLNELLRARLDPDIGDSKGRT  420

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
             PLHIAASKGHE+CV+VLLKH CN+HL+D  GNTALWDAI++K HSIF ILYH+ASISDP+
Sbjct  421   PLHIAASKGHEDCVLVLLKHACNVHLRDTNGNTALWDAISSKHHSIFRILYHFASISDPF  480

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
              AGDLLC AAK ND +VMQELLK GL+VD+KDRHGSTA+Q AM+E   +M  LLVMNGA+
Sbjct  481   TAGDLLCTAAKRNDLTVMQELLKQGLNVDAKDRHGSTALQVAMKEKHQEMFNLLVMNGAD  540

Query  545   IDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS---  375
             + D      +P  L E+++KRE+GHRI +     +E   K  + D  +   + + C    
Sbjct  541   VVDPNTYEFSPTTLNEIVKKREIGHRITVMTD--NEPPLKEVEGD-LHVGIVGKSCRGMD  597

Query  374   -IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
               RVSIYRG P  R+E+ C EPG+LI+LP +  +LI+ AGEK G DA ++ +TDE GA I
Sbjct  598   HPRVSIYRGRPLMRKESSCMEPGKLIRLPGSFDQLINFAGEKFGIDARNAIVTDEAGAEI  657

Query  197   DSIDVIRDNDKLFIVADW  144
             DSI+VIRDNDKLFI  ++
Sbjct  658   DSIEVIRDNDKLFIFENF  675



>ref|XP_009403698.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403699.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403700.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403701.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403702.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/819 (58%), Positives = 596/819 (73%), Gaps = 47/819 (6%)
 Frame = -2

Query  2483  KFILPPLGSSQPTHT--SSQGLVISPMDSRYR---------------------------C  2391
             K +LPPLG S  +     S+  +  PMDSRYR                           C
Sbjct  42    KLVLPPLGMSSCSQNPNGSRWRIFLPMDSRYRLELRAELHGDEFSLSLANESSKMLSCRC  101

Query  2390  WETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQ  2211
             WE +MV LVAYSAWV PFEI+F+ +     L++ DN++D FFA DIVLTFFVAYID  TQ
Sbjct  102   WEAFMVALVAYSAWVYPFEIAFMHAAPKGGLFLTDNVIDAFFAADIVLTFFVAYIDSRTQ  161

Query  2210  LLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVS  2031
             +L+   +KIATRYLSTWF+MD+ ST+PFE + +L TG+   GV YS+LG LR WRLR+V 
Sbjct  162   VLVCDPRKIATRYLSTWFIMDLTSTLPFEGLGYLITGRVKAGVSYSLLGTLRLWRLRKVK  221

Query  2030  NFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVR  1857
              FFTRLEKDIRFSYF +RC RLLFVT  LVHCAGCLYY LADRYPHQGK W+G+   N R
Sbjct  222   RFFTRLEKDIRFSYFCIRCVRLLFVTFFLVHCAGCLYYLLADRYPHQGKTWIGAAVPNFR  281

Query  1856  EESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLV  1677
             E +L +RYI+++YWS++TMTTVGYGDLHAVNT EMIF IFYML NLGLTAY+IGNMTNLV
Sbjct  282   EANLWMRYIASIYWSISTMTTVGYGDLHAVNTREMIFNIFYMLCNLGLTAYLIGNMTNLV  341

Query  1676  VEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTI  1497
             VEGTRRTMEFRNSIQ ASNFV RNHLP  LKEQILAYMCLRFKAE+LNQQ L++QLPK +
Sbjct  342   VEGTRRTMEFRNSIQVASNFVCRNHLPPHLKEQILAYMCLRFKAETLNQQHLMDQLPKAL  401

Query  1496  CKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVS  1317
             CKSIC HLFLP V++ YLFKGVSRE LLLLV  MK EYIPPREDVIMQNE+P+DVYI+VS
Sbjct  402   CKSICQHLFLPTVKEAYLFKGVSRETLLLLVTKMKVEYIPPREDVIMQNEAPEDVYIVVS  461

Query  1316  GEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEAL  1137
             GEVE+I ++ E EQVV   ++GD+FGE  AL  RPQSF +RT+TLSQLLKLK ++L E L
Sbjct  462   GEVEIIYSDNEMEQVVGKFSTGDIFGEFTALSERPQSFIFRTRTLSQLLKLKQSTLKEVL  521

Query  1136  QMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNE  957
               K++D I ++KNFL+H  + KD+ + +L  E G+ + + N   NL TV ATGN+ FL++
Sbjct  522   HAKQKDGIIIMKNFLKHQTEFKDISIDNLLGENGEFE-ETNKPCNLLTVAATGNSCFLDK  580

Query  956   LLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKE  777
             LLKAG+DP+IGDSKG+TPLHIAASKG+E+CV+VL+ H CNI+++DM+GNT LWDAI  K 
Sbjct  581   LLKAGMDPDIGDSKGRTPLHIAASKGYEDCVLVLINHACNINIQDMDGNTPLWDAITGKH  640

Query  776   HSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAM  597
             H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HGL++DS++  G TA+Q A 
Sbjct  641   HNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHGLNIDSENHEGLTALQIAS  700

Query  596   EENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHE-A  435
              EN  +M+  LVMNGA I     + +++  +    L E++Q+R++G+    P   L    
Sbjct  701   AENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQRDVGY----PTMALEPYG  756

Query  434   ASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISI  264
             A K  +   +  +S+  + +    R+S++ GHP  R      E G+LI LP T+ EL +I
Sbjct  757   AFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--ETGKLISLPSTMEELRTI  814

Query  263   AGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  815   IGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  853



>gb|ABE99811.1| inwardly rectifying potassium channel AKT2 [Hordeum vulgare]
 dbj|BAJ86010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/803 (59%), Positives = 595/803 (74%), Gaps = 22/803 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27    FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+MD
Sbjct  87    FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRLEKDIRFSYFWVRCAR
Sbjct  147   VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRCAR  206

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL LVHCAGCLYY LADRYP + K W+G++  N R+ESL IRYIS++YWS+TTMTT
Sbjct  207   LIAVTLFLVHCAGCLYYMLADRYPDRDKTWIGAVIPNFRQESLWIRYISSIYWSITTMTT  266

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA N LEMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  267   VGYGDLHAQNNLEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFV  326

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
              RNHLP RL++QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLFLPVV+ VYLFKG
Sbjct  327   CRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFLPVVKDVYLFKG  386

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SR+  LLLV   K EYIPP+EDVI+QNE+ DDVYIIVSGEVE+I    E E+VV  L +
Sbjct  387   ISRDAQLLLVTKTKPEYIPPKEDVIVQNEAADDVYIIVSGEVEVIYFNGEREEVVGKLGT  446

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
              D+FGEV AL  RPQ+FT+RT+TLSQLL+LK  +L E +Q K +D+  +++NFL+H  ++
Sbjct  447   LDIFGEVSALSDRPQTFTFRTRTLSQLLRLKQATLREVMQSKPDDSALIVRNFLKHQIEV  506

Query  1073  kdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
              D+K       IG       +  NL TV ATGN  FL +LLK G+DP++GDSKG+T LHI
Sbjct  507   HDMKDLLGE-SIGAAGSGNIVPCNLLTVAATGNGGFLGDLLKVGMDPDVGDSKGRTALHI  565

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AASKG+++CV  LL HGCN+++KD +GNTALW AIAA+ H +FS LYH A  ++P   GD
Sbjct  566   AASKGYDDCVQALLMHGCNVNIKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGD  625

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
             LLC AA+  D   ++ELLKHGL VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A
Sbjct  626   LLCLAARRGDLDTLRELLKHGLDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKA  685

Query  533   ---------VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQ  381
                       +  L   +L E++++RE+GH I + +     A    + +  Q    +P  
Sbjct  686   GLDDDGSAPQQTTLPAAELRELVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGS  745

Query  380   CSI-------RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL  222
                       RVSIY+GHP  R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ +
Sbjct  746   ARSSDSAHWPRVSIYKGHPFVR--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALV  803

Query  221   TDEEGAIIDSIDVIRDNDKLFIV  153
              + EGA IDS+DVIRDNDKLFIV
Sbjct  804   VNHEGAEIDSVDVIRDNDKLFIV  826



>dbj|BAJ86681.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/803 (59%), Positives = 594/803 (74%), Gaps = 22/803 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27    FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+M 
Sbjct  87    FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMG  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRLEKDIRFSYFWVRCAR
Sbjct  147   VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRCAR  206

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL LVHCAGCLYY LADRYP + K W+G++  N R+ESL IRYIS++YWS+TTMTT
Sbjct  207   LIAVTLFLVHCAGCLYYMLADRYPDRDKTWIGAVIPNFRQESLWIRYISSIYWSITTMTT  266

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA N LEMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  267   VGYGDLHAQNNLEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFV  326

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
              RNHLP RL++QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLFLPVV+ VYLFKG
Sbjct  327   CRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFLPVVKDVYLFKG  386

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SR+  LLLV   K EYIPP+EDVI+QNE+ DDVYIIVSGEVE+I    E E+VV  L +
Sbjct  387   ISRDAQLLLVTKTKPEYIPPKEDVIVQNEAADDVYIIVSGEVEVIYFNGEREEVVGKLGT  446

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
              D+FGEV AL  RPQ+FT+RT+TLSQLL+LK  +L E +Q K +D+  +++NFL+H  ++
Sbjct  447   LDIFGEVSALSDRPQTFTFRTRTLSQLLRLKQATLREVMQSKPDDSALIVRNFLKHQIEV  506

Query  1073  kdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
              D+K       IG       +  NL TV ATGN  FL +LLK G+DP++GDSKG+T LHI
Sbjct  507   HDMKDLLGE-SIGAAGSGNIVPCNLLTVAATGNGGFLGDLLKVGMDPDVGDSKGRTALHI  565

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AASKG+++CV  LL HGCN+++KD +GNTALW AIAA+ H +FS LYH A  ++P   GD
Sbjct  566   AASKGYDDCVQALLMHGCNVNIKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGD  625

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
             LLC AA+  D   ++ELLKHGL VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A
Sbjct  626   LLCLAARRGDLDTLRELLKHGLDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKA  685

Query  533   ---------VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQ  381
                       +  L   +L E++++RE+GH I + +     A    + +  Q    +P  
Sbjct  686   GLDDDGSAPQQTTLPAAELRELVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGS  745

Query  380   CSI-------RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL  222
                       RVSIY+GHP  R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ +
Sbjct  746   ARSSDSAHWPRVSIYKGHPFVR--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALV  803

Query  221   TDEEGAIIDSIDVIRDNDKLFIV  153
              + EGA IDS+DVIRDNDKLFIV
Sbjct  804   VNHEGAEIDSVDVIRDNDKLFIV  826



>dbj|BAJ96949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/803 (59%), Positives = 594/803 (74%), Gaps = 22/803 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27    FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+MD
Sbjct  87    FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRLEKDIRFSYFWVRCAR
Sbjct  147   VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRCAR  206

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL LVHCAGCLYY LADRYP + K W+G++  N R+ESL IRYIS++YWS+TTMTT
Sbjct  207   LIAVTLFLVHCAGCLYYMLADRYPDRDKTWIGAVIPNFRQESLWIRYISSIYWSITTMTT  266

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA N LEMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  267   VGYGDLHAQNNLEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFV  326

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
              RNHLP RL++QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLFLPVV+ VYL KG
Sbjct  327   CRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFLPVVKDVYLSKG  386

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SR+  LLLV   K EYIPP+EDVI+QNE+ DDVYIIVSGEVE+I    E E+VV  L +
Sbjct  387   ISRDAQLLLVTKTKPEYIPPKEDVIVQNEAADDVYIIVSGEVEVIYFNGEREEVVGKLGT  446

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
              D+FGEV AL  RPQ+FT+RT+TLSQLL+LK  +L E +Q K +D+  +++NFL+H  ++
Sbjct  447   LDIFGEVSALSDRPQTFTFRTRTLSQLLRLKQATLREVMQSKPDDSALIVRNFLKHQIEV  506

Query  1073  kdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
              D+K       IG       +  NL TV ATGN  FL +LLK G+DP++GDSKG+T LHI
Sbjct  507   HDMKDLLGE-SIGAAGSGNIVPCNLLTVAATGNGGFLGDLLKVGMDPDVGDSKGRTALHI  565

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AASKG+++CV  LL HGCN+++KD +GNTALW AIAA+ H +FS LYH A  ++P   GD
Sbjct  566   AASKGYDDCVQALLMHGCNVNIKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGD  625

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
             LLC AA+  D   ++ELLKHGL VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A
Sbjct  626   LLCLAARRGDLDTLRELLKHGLDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKA  685

Query  533   ---------VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQ  381
                       +  L   +L E++++RE+GH I + +     A    + +  Q    +P  
Sbjct  686   GLDDDGSAPQQTTLPAAELRELVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGS  745

Query  380   CSI-------RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSL  222
                       RVSIY+GHP  R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ +
Sbjct  746   ARSSDSAHWPRVSIYKGHPFVR--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALV  803

Query  221   TDEEGAIIDSIDVIRDNDKLFIV  153
              + EGA IDS+DVIRDNDKLFIV
Sbjct  804   VNHEGAEIDSVDVIRDNDKLFIV  826



>ref|XP_009403704.1| PREDICTED: potassium channel AKT2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/761 (60%), Positives = 578/761 (76%), Gaps = 18/761 (2%)
 Frame = -2

Query  2396  RCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPT  2217
             RCWE +MV LVAYSAWV PFEI+F+ +     L++ DN++D FFA DIVLTFFVAYID  
Sbjct  17    RCWEAFMVALVAYSAWVYPFEIAFMHAAPKGGLFLTDNVIDAFFAADIVLTFFVAYIDSR  76

Query  2216  TQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRR  2037
             TQ+L+   +KIATRYLSTWF+MD+ ST+PFE + +L TG+   GV YS+LG LR WRLR+
Sbjct  77    TQVLVCDPRKIATRYLSTWFIMDLTSTLPFEGLGYLITGRVKAGVSYSLLGTLRLWRLRK  136

Query  2036  VSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--N  1863
             V  FFTRLEKDIRFSYF +RC RLLFVT  LVHCAGCLYY LADRYPHQGK W+G+   N
Sbjct  137   VKRFFTRLEKDIRFSYFCIRCVRLLFVTFFLVHCAGCLYYLLADRYPHQGKTWIGAAVPN  196

Query  1862  VREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTN  1683
              RE +L +RYI+++YWS++TMTTVGYGDLHAVNT EMIF IFYML NLGLTAY+IGNMTN
Sbjct  197   FREANLWMRYIASIYWSISTMTTVGYGDLHAVNTREMIFNIFYMLCNLGLTAYLIGNMTN  256

Query  1682  LVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPK  1503
             LVVEGTRRTMEFRNSIQ ASNFV RNHLP  LKEQILAYMCLRFKAE+LNQQ L++QLPK
Sbjct  257   LVVEGTRRTMEFRNSIQVASNFVCRNHLPPHLKEQILAYMCLRFKAETLNQQHLMDQLPK  316

Query  1502  TICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYII  1323
              +CKSIC HLFLP V++ YLFKGVSRE LLLLV  MK EYIPPREDVIMQNE+P+DVYI+
Sbjct  317   ALCKSICQHLFLPTVKEAYLFKGVSRETLLLLVTKMKVEYIPPREDVIMQNEAPEDVYIV  376

Query  1322  VSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLE  1143
             VSGEVE+I ++ E EQVV   ++GD+FGE  AL  RPQSF +RT+TLSQLLKLK ++L E
Sbjct  377   VSGEVEIIYSDNEMEQVVGKFSTGDIFGEFTALSERPQSFIFRTRTLSQLLKLKQSTLKE  436

Query  1142  ALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFL  963
              L  K++D I ++KNFL+H  + KD+ + +L  E G+ + + N   NL TV ATGN+ FL
Sbjct  437   VLHAKQKDGIIIMKNFLKHQTEFKDISIDNLLGENGEFE-ETNKPCNLLTVAATGNSCFL  495

Query  962   NELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAA  783
             ++LLKAG+DP+IGDSKG+TPLHIAASKG+E+CV+VL+ H CNI+++DM+GNT LWDAI  
Sbjct  496   DKLLKAGMDPDIGDSKGRTPLHIAASKGYEDCVLVLINHACNINIQDMDGNTPLWDAITG  555

Query  782   KEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQA  603
             K H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HGL++DS++  G TA+Q 
Sbjct  556   KHHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHGLNIDSENHEGLTALQI  615

Query  602   AMEENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHE  438
             A  EN  +M+  LVMNGA I     + +++  +    L E++Q+R++G+    P   L  
Sbjct  616   ASAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQRDVGY----PTMALEP  671

Query  437   -AASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELI  270
               A K  +   +  +S+  + +    R+S++ GHP  R      E G+LI LP T+ EL 
Sbjct  672   YGAFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--ETGKLISLPSTMEELR  729

Query  269   SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
             +I G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  730   TIIGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  770



>ref|XP_003568398.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
 ref|XP_010231341.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
Length=858

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/820 (58%), Positives = 592/820 (72%), Gaps = 38/820 (5%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG  Q  ++ S       V+SP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  23    FNLRNLSKLILPPLGGLQAGYSQSPAGSYKRVVSPLDSRYRCWETFMVVLVAYSAWVYPF  82

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RK+I  RYLST+F
Sbjct  83    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRKRITFRYLSTFF  142

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             ++DVASTIPF+ +A+L TG+   GV YSVLG+ R WRLR+V  FFTRLEKDIRFSYFWVR
Sbjct  143   ILDVASTIPFQGLAYLATGEVKEGVAYSVLGIFRLWRLRKVKQFFTRLEKDIRFSYFWVR  202

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
             CARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  N R+ SL IRYIS++YWS+TT
Sbjct  203   CARLIAVTLFLVHCAGCLYYLIADRYPEREKTWIGAVIPNFRQSSLWIRYISSIYWSITT  262

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHA N +EMIF IFYMLFNLGLT+Y+IGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  263   MTTVGYGDLHAQNNVEMIFNIFYMLFNLGLTSYLIGNMTNLVVEGTRRTMEFRNSIRAAS  322

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFV RNHLP RL++QILAYMCL+F+AESLNQQ L++QLP +ICKSIC HLFLPVV+ VYL
Sbjct  323   NFVCRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPNSICKSICEHLFLPVVKDVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMI--DNEMENEQ-V  1272
             FK VSRE LLLLV   K EYIPP+EDVI+  E+ DDVYI+VSGEV++I  D E + E+ V
Sbjct  383   FKEVSRETLLLLVTKTKPEYIPPKEDVIVLGEAADDVYIVVSGEVDIIRLDGEGKREELV  442

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V TL   D+FGEV AL  RPQSFT+RT+TLSQLL+LK  +L EA+  K ED++ +IKNFL
Sbjct  443   VGTLGPKDIFGEVSALSDRPQSFTFRTRTLSQLLRLKQATLKEAMHSKTEDSVVIIKNFL  502

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              H  ++ D+K+ DL  E   E    N+  NL TV ATGN++FL +LLKAG+DP++GDSKG
Sbjct  503   NHQMEVHDMKVEDLLGENTAELDGGNIPCNLLTVAATGNSSFLEDLLKAGMDPDVGDSKG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +T LHIAA+ G+E+CV VLL+H CN+++KD +GNTALW AIAA+ H +FS+LY  A  + 
Sbjct  563   RTALHIAAANGYEDCVQVLLRHACNVNIKDAQGNTALWQAIAARHHKVFSVLYSVARATC  622

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQ------ADMIK  570
             P+  GDLLC AA+  D   + ELLKHGL VD+    G+TA++ A+  +       AD+ +
Sbjct  623   PHAGGDLLCLAARRGDVDTLAELLKHGLDVDAAGHDGATALRVALSSSSQGGRRAADVAR  682

Query  569   LLVMNGAEIDDA-VKLNLAPLDLTEVL-----QKRELGHRIAMPNTILHEAA--------  432
              LVMNGA +D A V  +      T VL     ++ E    +  P TI    A        
Sbjct  683   FLVMNGASVDKARVHEDDGATRPTTVLPLEELRELEKRREVVHPITIYDSPAADVVARVV  742

Query  431   ---SKWAKDDHQNSSSMPQQCSI----RVSIYRGHPATRRETQCPEPGRLIKLPETIAEL  273
                S  + D  Q   S  +        RVS+YRGHP  R      E G+LI LP T+AEL
Sbjct  743   GGGSNPSGDGRQGRFSSTRSSDSGHWPRVSVYRGHPFVR--NHGSEAGKLINLPSTMAEL  800

Query  272   ISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
              ++  +K   DA  + + ++EGA I+S+DVIRDND+LFIV
Sbjct  801   KAVIEKKFKVDAEKALVVNDEGAEIESVDVIRDNDRLFIV  840



>ref|NP_001147796.1| potassium channel AKT2/3 [Zea mays]
 gb|ACG28726.1| potassium channel AKT2/3 [Zea mays]
 gb|AFW78085.1| potassium channel AKT2/3 [Zea mays]
Length=838

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/806 (57%), Positives = 596/806 (74%), Gaps = 25/806 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             F++  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV PFE
Sbjct  23    FNVRNLSKVILPPLGGPSGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYPFE  82

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F+
Sbjct  83    VAFMNASPKGGLEVADMVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITLRYLSTFFI  142

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV   FTRLEKDIRFSYFW+R 
Sbjct  143   MDVASTIPFQSLAYLITGEVRENAAYSMLGVLRLWRLRRVKQLFTRLEKDIRFSYFWIRS  202

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++N   R+ SL+IRYIS++YWS+TTM
Sbjct  203   ARLIAVTLFLVHCAGCLYYLIADRYPDREKTWIGAVNPNFRQASLRIRYISSVYWSITTM  262

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS++ AS+
Sbjct  263   TTVGYGDLHAQNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSVRTASS  322

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYLF
Sbjct  323   FVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYLF  382

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSRE+LL L   MK EYIPP+EDVI+QNE+PDDVY++VSGEVE++  +  +E+V  TL
Sbjct  383   KGVSREMLLSLATKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVVLFDGVDERVEATL  442

Query  1259  NSGDMFGEVGALCCRPQS-FTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
              + ++FGEV AL  RPQ+ FT+RT+TLSQLL+LK  +L EA+Q   +D++ +IKN+++H 
Sbjct  443   GTRNIFGEVSALSDRPQAPFTFRTRTLSQLLRLKQATLKEAMQSWPDDSVIIIKNYVKHQ  502

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K  D    +GD   + +   N+ TV A GN+  L +LL+AG D ++GD+ G+T 
Sbjct  503   VEMHGMKADD---SLGDNTSEHDDDANVLTVAAMGNSGLLEDLLRAGKDADVGDAMGRTA  559

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN +++D +GNTA+W+AIAA  H IF+ILYH A  S+P+ 
Sbjct  560   LHIAASKGYEDCVLVLLKHACNANIRDAQGNTAMWNAIAAGHHKIFNILYHSARASNPHA  619

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD++C A +  D   ++ELLK GL VDS+D  G+TA++ AM E  AD  + L+ NGA +
Sbjct  620   GGDVMCLATRRGDLDALRELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLITNGASV  679

Query  542   DD-----------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQ  405
             D            A +L ++P +L E+LQKREL H I +   P  +    +S  ++    
Sbjct  680   DKASLDDDGSGSGAARLTMSPTELHELLQKRELVHSITITDSPPVVPDGGSSGHSRPGRL  739

Query  404   NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSS  225
              S+        RVSIYRGHP  R  +   E G+LI LP T+ E I++ GEKL  D   + 
Sbjct  740   QSTGSDNTRWPRVSIYRGHPFLRNRSS--EAGKLINLPATMEEFIAVVGEKLKVDTEKAL  797

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVAD  147
             + ++EGA +DSIDVIRDNDKLF+V +
Sbjct  798   IVNDEGAEVDSIDVIRDNDKLFVVTE  823



>ref|XP_002441145.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
 gb|EES19575.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
Length=837

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/800 (59%), Positives = 593/800 (74%), Gaps = 28/800 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
              SL  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV  FE
Sbjct  30    LSLRYLSKIILPPLGGPPGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYLFE  89

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
             ++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLLI  RKKI  RYLST+F+
Sbjct  90    VAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLIRDRKKITFRYLSTFFI  149

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVAST+PF+ +A+  TG+      YSVLG+LR WRLRRV+ FFTRLEKDIRFSYFW+RC
Sbjct  150   MDVASTVPFQALAYFITGEVRENGAYSVLGLLRLWRLRRVNQFFTRLEKDIRFSYFWIRC  209

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL +VH AGCLYY +ADRYPH  K W+G +  N R+ S+ IRYI+++YWS+TTM
Sbjct  210   ARLVAVTLFVVHSAGCLYYLIADRYPHPEKTWIGDVIPNFRQVSVWIRYITSVYWSITTM  269

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGT RTMEFRNSI+AA++
Sbjct  270   TTVGYGDLHARNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTHRTMEFRNSIRAATS  329

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYLF
Sbjct  330   FVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICDHLFVPVVKDVYLF  389

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVSRE+LL LV  MK EYIPPREDVI+QNE+PDDVY++VSGEVE+I     NE+V  TL
Sbjct  390   NGVSREMLLSLVTKMKPEYIPPREDVIVQNEAPDDVYVVVSGEVEVILFNGINERVEATL  449

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + EDN+ +IKNFL+H  
Sbjct  450   GTRDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPEDNVVVIKNFLKHQV  509

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             ++  +++ DL   +GD  G+ +   N+ T    GN+  L +LL+AG D ++GD+ G+T L
Sbjct  510   EMHGMEVEDL---LGDNTGEHDNDANVLTAAMMGNSGLLEDLLRAGKDADVGDATGRTAL  566

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAA+K +E+CV+VLLKH CN++++D +GNTA+W+AIAA  H IF+ILY ++  S+P+  
Sbjct  567   HIAAAKVYEDCVLVLLKHACNVNIEDAQGNTAMWNAIAAGHHRIFNILYQFSRASNPHAG  626

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GD+LC AA+  D  +++ELLK GL VDS+D  G+TA++ AM E  AD+ + L+MNGA +D
Sbjct  627   GDVLCLAARRGDLGMLRELLKLGLDVDSEDHDGATALRVAMAEGHADVARFLIMNGASVD  686

Query  539   DA-----------VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSS  393
              A            +  ++  +L E+LQKRELGH I    TI+   A      D   S+ 
Sbjct  687   KASLDDDGSGSGTARRTMSSTELRELLQKRELGHSI----TIVDSPA---VIPDRLQSTG  739

Query  392   MPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
               QQ   RVSIY GHP  R  +   E G+LI LP T+ E I+  GEKL  DA    + ++
Sbjct  740   SNQQRWPRVSIYNGHPFLRNRSY--EAGKLINLPGTMEEFIATVGEKLKVDAEKVLIVND  797

Query  212   EGAIIDSIDVIRDNDKLFIV  153
             EGA IDSIDVIRDNDKLF+V
Sbjct  798   EGAEIDSIDVIRDNDKLFVV  817



>ref|XP_010681788.1| PREDICTED: potassium channel AKT2/3 isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=701

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/659 (65%), Positives = 533/659 (81%), Gaps = 4/659 (1%)
 Frame = -2

Query  2501  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40    TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100   FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRLEKDIRFSYFWVRCAR
Sbjct  160   LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRCAR  219

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTT  1794
             LLFVTL LVHCAGCLYY LADRYPH+GK W+G++N   RE SL +RYISA+YWS+TTMTT
Sbjct  220   LLFVTLFLVHCAGCLYYLLADRYPHEGKTWIGAMNPNFRETSLWVRYISAIYWSITTMTT  279

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NTLEMIFIIFYMLFNL LTAY+IGNMTNLVVEGTRRTMEFR+SI+AAS+FV
Sbjct  280   VGYGDLHANNTLEMIFIIFYMLFNLSLTAYLIGNMTNLVVEGTRRTMEFRSSIEAASSFV  339

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             SRN LP RLKEQIL YMCLRFKAE+LNQ  LIE LP +I K+IC HLFLP +EKVYLF+G
Sbjct  340   SRNRLPTRLKEQILGYMCLRFKAENLNQFQLIEHLPNSIYKNICQHLFLPTIEKVYLFRG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             ++R+ LL+LVA+ KAEY+PPRED+IMQNE   D+YIIVSGEVEMID E E E VV TL  
Sbjct  400   ITRKSLLVLVANTKAEYLPPREDIIMQNEVASDIYIIVSGEVEMIDYESEKEIVVGTLQV  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             GDMFGEV A+C  PQSFT RT+TL+QLL+L  ++L+EA++ ++ED++ M+ NFLQH++KL
Sbjct  460   GDMFGEVAAICSTPQSFTIRTRTLAQLLRLNNSTLIEAMKFRQEDHVVMVNNFLQHNRKL  519

Query  1073  kdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
                  GD  IE  D DG+   ++NL  V A GN+ FL++LLKA LDP++ DS+G+TPLH 
Sbjct  520   NVASAGDWRIENADRDGELFKALNLLNVAAAGNSVFLDKLLKAKLDPDVCDSRGRTPLHE  579

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AAS+GHEECV++LL HGCN+ L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGD
Sbjct  580   AASRGHEECVILLLNHGCNVLLRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGD  639

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
             LL  A K ND +V+++LLK GL VDS + HG TA+Q A+  N  ++  LL+  GA+  D
Sbjct  640   LLTTATKRNDIAVIKDLLKCGLDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD  698



>ref|XP_002441143.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
 gb|EES19573.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
Length=845

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/808 (57%), Positives = 599/808 (74%), Gaps = 30/808 (4%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGS----SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             F+L  LSK ILPPLG       P +  S   VISP+DSRYR W+T MV++VAYSAWV  F
Sbjct  28    FNLRNLSKVILPPLGGPSAGQSPNNGGSDKWVISPLDSRYRWWDTLMVVMVAYSAWVYLF  87

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP +QLL+  RKKI  RYLST+F
Sbjct  88    EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRSQLLVCDRKKITFRYLSTFF  147

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             +MDVAS+IPF+  A+  TG+      YSVLG+LR WRLRRV+ FFTRLEKDIRFSYFW+R
Sbjct  148   IMDVASSIPFQAFAYFITGEVREDAVYSVLGLLRLWRLRRVNQFFTRLEKDIRFSYFWIR  207

Query  1976  CARLLFV---TLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWS  1812
              ARL+ V   TL +VHCAGCLYY +ADRYPH  K W+G++  N R+ SL IRYI+A+YWS
Sbjct  208   SARLVAVGRVTLFVVHCAGCLYYLIADRYPHSEKTWIGAVIPNFRQASLGIRYITAIYWS  267

Query  1811  MTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQ  1632
             +TTMTTVGYGDL A NT+EMIF IFYM FNLGLT+Y+IGNMTNLVVEGT RTMEFR+SI+
Sbjct  268   ITTMTTVGYGDLCARNTIEMIFNIFYMFFNLGLTSYLIGNMTNLVVEGTGRTMEFRSSIR  327

Query  1631  AASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             AAS+FV RNHLP RLK+QILA+MCL+F+ E+LNQQ L+++LPK I KSIC HLF+PVV+ 
Sbjct  328   AASSFVGRNHLPPRLKQQILAHMCLKFRVENLNQQQLLDELPKPIYKSICEHLFVPVVKD  387

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF GVSRE+LL LV  M+ EYIPP+E+VI+QNE+PDDVY++VSGEVE+I  +  +E+V
Sbjct  388   VYLFNGVSREMLLSLVTKMRPEYIPPKEEVIVQNEAPDDVYVVVSGEVEVILFDGIDERV  447

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
               TL + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL
Sbjct  448   EATLGTRDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQNRPEDSVVVIKNFL  507

Query  1091  QHHkklkdlklgdLFIE-IGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             +HH ++  + + DL I+ IG+ D D     N+ TV A GN+  L +LL+AG D ++GD+K
Sbjct  508   KHHVEMHGINVEDLLIDNIGEHDDDA----NVLTVAAMGNSGLLEDLLRAGKDADVGDAK  563

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+T LHIAAS G+E+CV+VLLKH CN+++KD +GNTA+W+AIAA  H IF+ILY +A  S
Sbjct  564   GRTALHIAASNGYEDCVLVLLKHACNVNIKDAQGNTAMWNAIAAGHHKIFNILYQFAHAS  623

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
             +P+  GD+LC AA+  D   ++ELLK GL VDS+D  G+TA++ AM     D+ + L+MN
Sbjct  624   NPHAGGDVLCLAARRGDLDALRELLKLGLDVDSEDHDGATALRVAMANGHVDVARFLIMN  683

Query  554   GAEID---------DAVKLNLAPLDLTEVLQKRELGHRIAM----PNTILHEAASKWAKD  414
             GA +D          A +L ++P +L E+LQKRELGH I +    P  +    +S  ++ 
Sbjct  684   GASVDKANLDDDGSSAARLTMSPTELRELLQKRELGHSITIVDSSPAVVPDGGSSGHSRP  743

Query  413   DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE-TIAELISIAGEKLGFDA  237
                 S+S   Q S RVS+Y+GHP+ R  +   E G+LI L E T+ E  +I GEKL  DA
Sbjct  744   GRLQSTSSDNQRSPRVSLYKGHPSLRNRSS--EAGKLINLREATMGEFKAIIGEKLKVDA  801

Query  236   TDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
               + + ++EGA IDSIDVIRDNDKLF+V
Sbjct  802   EKALIVNDEGAEIDSIDVIRDNDKLFVV  829



>ref|XP_010910952.1| PREDICTED: potassium channel AKT2-like isoform X2 [Elaeis guineensis]
Length=678

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/682 (64%), Positives = 534/682 (78%), Gaps = 21/682 (3%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPFE + +L TG+   GV YS+LGMLR WRLR+V  FFTRLEKDIRFSYFW+RC
Sbjct  1     MDVASTIPFEGLGYLITGEIKEGVSYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYFWIRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARLL VTL LVHCAGCLYY LADRYPHQGK W+G++N   RE SL  RYISA+YWS TTM
Sbjct  61    ARLLSVTLFLVHCAGCLYYLLADRYPHQGKTWIGAVNPNFREASLWTRYISALYWSTTTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT EM+F IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQAASN
Sbjct  121   TTVGYGDLHAVNTEEMVFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQAASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCLRF+AESLNQQ L++QLP +ICKSIC HLFLPV+++VYLF
Sbjct  181   FVCRNHLPPRLKQQILAYMCLRFRAESLNQQQLMDQLPNSICKSICEHLFLPVIKEVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KG+S+E+LLLLV  MKAEYIPP+EDVIMQNE+PDDVY++VSGEVE+I  + E EQV+  L
Sbjct  241   KGISKEMLLLLVTKMKAEYIPPKEDVIMQNEAPDDVYVVVSGEVEIIHFDNEREQVLGAL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GD+FGEV ALC RPQ FT+RT+TLSQLL+LK  +L EA+Q K+ED++ +I+NFL+H  
Sbjct  301   RTGDIFGEVSALCDRPQDFTFRTRTLSQLLRLKQRTLREAMQTKQEDSVVIIRNFLKHQI  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             + K++++ DLF E  DE    N+  NL TV ATGN+ FL ELLKAG+DP+IGDSKG+TPL
Sbjct  361   EFKNIRIEDLFGE-SDEYDAANIPCNLLTVAATGNSCFLEELLKAGMDPDIGDSKGRTPL  419

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG+E+CV+VLLKH  NI+++DM+GNT LW AI  K H IF+ILYH+A IS+P++ 
Sbjct  420   HIAASKGYEDCVLVLLKHASNINIQDMDGNTPLWLAITGKHHKIFNILYHYACISNPHIG  479

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             G+LL  AAK ND S ++ELLKHGL ++S++  G T +QAA  EN  DMIKLLVMNGA ++
Sbjct  480   GNLLVLAAKRNDLSTIKELLKHGLDINSENNEGLTPLQAAFAENHTDMIKLLVMNGANVE  539

Query  539   DAVKLNLAPL--------DLTEVLQKRELGHRIAMPNTILHEAASKWA---KDDHQNSSS  393
             +   +NL+ L        D+ E++QKRE+G+ IA+  +  HE   +     +  H     
Sbjct  540   N---INLSSLETRKMTEADIQELVQKREVGYPIAILES--HEELKQIKVSEEKSHMTKWG  594

Query  392   MPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
                    RVSIY+GHP  R  +   E G+LI LP TI +L  IAGEK G  A  + +T+E
Sbjct  595   TRGGIYPRVSIYKGHPFLRNSSS--EAGKLINLPNTIEDLKEIAGEKFGVVANRTVITNE  652

Query  212   EGAIIDSIDVIRDNDKLFIVAD  147
             EGA IDSI+VIRDNDKLFIV +
Sbjct  653   EGAEIDSIEVIRDNDKLFIVEN  674



>ref|XP_010681785.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=737

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/677 (60%), Positives = 510/677 (75%), Gaps = 22/677 (3%)
 Frame = -2

Query  2177  RYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIR  1998
             RYLSTWF+MD+ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRLEKDIR
Sbjct  77    RYLSTWFIMDLASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIR  136

Query  1997  FSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISA  1824
             FSYFWVRCARLLFVTL LVHCAGCLYY LADRYPH+GK W+G++N   RE SL +RYISA
Sbjct  137   FSYFWVRCARLLFVTLFLVHCAGCLYYLLADRYPHEGKTWIGAMNPNFRETSLWVRYISA  196

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHA NTLEMIFIIFYMLFNL LTAY+IGNMTNLVVEGTRRTMEFR
Sbjct  197   IYWSITTMTTVGYGDLHANNTLEMIFIIFYMLFNLSLTAYLIGNMTNLVVEGTRRTMEFR  256

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             +SI+AAS+FVSRN LP RLKEQIL YMCLRFKAE+LNQ  LIE LP +I K+IC HLFLP
Sbjct  257   SSIEAASSFVSRNRLPTRLKEQILGYMCLRFKAENLNQFQLIEHLPNSIYKNICQHLFLP  316

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              +EKVYLF+G++R+ LL+LVA+ KAEY+PPRED+IMQNE   D+YIIVSGEVEMID E E
Sbjct  317   TIEKVYLFRGITRKSLLVLVANTKAEYLPPREDIIMQNEVASDIYIIVSGEVEMIDYESE  376

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              E VV TL  GDMFGEV A+C  PQSFT RT+TL+QLL+L  ++L+EA++ ++ED++ M+
Sbjct  377   KEIVVGTLQVGDMFGEVAAICSTPQSFTIRTRTLAQLLRLNNSTLIEAMKFRQEDHVVMV  436

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
              NFLQH++KL     GD  IE  D DG+   ++NL  V A GN+ FL++LLKA LDP++ 
Sbjct  437   NNFLQHNRKLNVASAGDWRIENADRDGELFKALNLLNVAAAGNSVFLDKLLKAKLDPDVC  496

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DS+G+TPLH AAS+GHEECV++LL HGCN+ L+D+  NTALWDAI+AK ++IF +LY++ 
Sbjct  497   DSRGRTPLHEAASRGHEECVILLLNHGCNVLLRDLNDNTALWDAISAKHYNIFHLLYNYT  556

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +I DP++AGDLL  A K ND +V+++LLK GL VDS + HG TA+Q A+  N  ++  LL
Sbjct  557   TIQDPHIAGDLLTTATKRNDIAVIKDLLKCGLDVDSTNLHGLTALQVALTTNHVEIATLL  616

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQ  384
             +  GA+  D              L    +    A  N    +   K   D     S    
Sbjct  617   IAYGAKTGD--------------LNGNTISSIFAARNQHFVQVNKKRGND-----SKFEP  657

Query  383   QCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGA  204
              C+ R+++++G+P +         GRLI+LP +  EL  IAGEK   +AT+ ++ +EEGA
Sbjct  658   SCA-RINLFKGYPTSSNTFDKNSTGRLIRLPSSFEELQVIAGEKFKVNATNLTIVNEEGA  716

Query  203   IIDSIDVIRDNDKLFIV  153
              +DSI VIRDNDKL++V
Sbjct  717   EVDSIQVIRDNDKLYVV  733



>gb|AEO14874.1| rsmv3 protein [Glycine max]
Length=594

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/590 (69%), Positives = 480/590 (81%), Gaps = 5/590 (1%)
 Frame = -2

Query  1916  FLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFI  1743
              LADRYPHQGK W+G++N   RE SL+IRYISAMYWS+TTMTTVGYGDLHAVNT+EMIFI
Sbjct  1     MLADRYPHQGKTWIGAVNPNFRETSLRIRYISAMYWSITTMTTVGYGDLHAVNTIEMIFI  60

Query  1742  IFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYM  1563
             IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV RN LP RLKEQILAYM
Sbjct  61    IFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVCRNRLPPRLKEQILAYM  120

Query  1562  CLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEY  1383
             CLRFKAESLNQ  LIEQLPK+ICKSIC HLF   VEKVYLFKGVS+EI+L LVA MKAEY
Sbjct  121   CLRFKAESLNQHQLIEQLPKSICKSICQHLFFATVEKVYLFKGVSKEIILSLVAKMKAEY  180

Query  1382  IPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSF  1203
             IPPREDVIMQNE+PDDVYIIVSGE E++D E E E+++ TL++G+MFGE GALCCRPQS 
Sbjct  181   IPPREDVIMQNEAPDDVYIIVSGEAEILDTETEKERILGTLHTGEMFGEFGALCCRPQSL  240

Query  1202  TYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDG  1023
             TYRTKTL+QLL+LKT +LLEA+Q+KREDNI ++KNFLQH K++KDL + DL +E  +E+ 
Sbjct  241   TYRTKTLTQLLRLKTNTLLEAMQIKREDNIQILKNFLQHFKQVKDLSIKDLMVENVEEE-  299

Query  1022  DPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHG  843
             DPNM++NL TV +TGNA FL ELL+AGLDP+IGDSKGKTPLHIAAS GHE CV VLLKH 
Sbjct  300   DPNMAVNLLTVASTGNAAFLEELLRAGLDPDIGDSKGKTPLHIAASNGHEGCVKVLLKHA  359

Query  842   CNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQEL  663
             CN+H+KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +L
Sbjct  360   CNMHIKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDL  419

Query  662   LKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKR  483
             L+ GL+VDSKD   +TAIQ AM EN   M++LLVMNGA++ D          L E+LQKR
Sbjct  420   LRQGLNVDSKDHRDTTAIQIAMAENHVGMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKR  479

Query  482   ELGHRIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  309
             E+GH I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G
Sbjct  480   EIGHLINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAG  539

Query  308   RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
             +LI+LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF
Sbjct  540   KLIRLPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLF  589



>gb|AFW81865.1| potassium channel2 [Zea mays]
Length=769

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/702 (58%), Positives = 526/702 (75%), Gaps = 25/702 (4%)
 Frame = -2

Query  2192  KKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRL  2013
             +K ++ YLST+F+MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRL
Sbjct  58    QKTSSLYLSTFFIMDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRL  117

Query  2012  EKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKI  1839
             EKDIRFSYFW+R ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  N R+ SL+I
Sbjct  118   EKDIRFSYFWIRSARLVAVTLFLVHCAGCLYYLIADRYPDRQKTWIGAVIPNFRQASLRI  177

Query  1838  RYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRR  1659
             RYIS++YWS+TTMTTVGYGDLHA N +EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRR
Sbjct  178   RYISSIYWSITTMTTVGYGDLHAQNNVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRR  237

Query  1658  TMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICH  1479
             TMEFRNSI+AAS+FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC 
Sbjct  238   TMEFRNSIRAASSFVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICE  297

Query  1478  HLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMI  1299
             HLF+PVV+ VYLF+GVSRE+LL LV  MK EYIPP+EDVI+QNE+PDDVY++VSGEVE+I
Sbjct  298   HLFVPVVKDVYLFRGVSREMLLSLVTKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVI  357

Query  1298  DNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKRED  1119
               +   EQV  TL + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED
Sbjct  358   LFDGIYEQVQATLGARDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPED  417

Query  1118  NITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGL  939
             ++ +IKNFL+H  ++  +K+ DL   +GD  G+ +   N+ TV A GN+  L +LL+AG 
Sbjct  418   SVVVIKNFLKHQVEMHGMKVEDL---LGDNTGEHDDDANVLTVAAMGNSGLLEDLLRAGK  474

Query  938   DPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSI  759
             D ++GD+KG+T LHIAASKG+E+CV+VLLKH CN++++D +GNTA+W+AIAA  H  F++
Sbjct  475   DADVGDAKGRTALHIAASKGYEDCVLVLLKHACNVNIRDAQGNTAMWNAIAAGHHKTFNL  534

Query  758   LYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQAD  579
             LY +   S+P   GD++C AA+      +QELLK GL VDS+D  G+TA++ AM E  AD
Sbjct  535   LYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLGLDVDSEDHDGATALRVAMAEGHAD  594

Query  578   MIKLLVMNGAEIDD---------------AVKLNLAPLDLTEVLQKRELGHRIAM---PN  453
               + L++NGA +D                A +L ++P +L E+LQKRELGH I +   P 
Sbjct  595   AARFLILNGASVDKASLDDDGSGSGSGSGAARLAMSPTELRELLQKRELGHSITIHDSPA  654

Query  452   TILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAEL  273
              + +  +S  ++     S+S   Q   RVS+Y+GHP  R  T   E G+LI LP T+ E 
Sbjct  655   VVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHPFLRNRTS--EAGKLINLPGTMEEF  712

Query  272   ISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              +I GEKL  DA  + +  +EGA IDSIDVIRDNDKLF+V +
Sbjct  713   RAIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDKLFMVTE  754



>ref|XP_008655421.1| PREDICTED: potassium channel protein ZMK2 isoform X2 [Zea mays]
Length=699

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/689 (58%), Positives = 515/689 (75%), Gaps = 25/689 (4%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRLEKDIRFSYFW+R 
Sbjct  1     MDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIRS  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++  N R+ SL+IRYIS++YWS+TTM
Sbjct  61    ARLVAVTLFLVHCAGCLYYLIADRYPDRQKTWIGAVIPNFRQASLRIRYISSIYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHA N +EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AAS+
Sbjct  121   TTVGYGDLHAQNNVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASS  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYLF
Sbjct  181   FVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVSRE+LL LV  MK EYIPP+EDVI+QNE+PDDVY++VSGEVE+I  +   EQV  TL
Sbjct  241   RGVSREMLLSLVTKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVILFDGIYEQVQATL  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              + D+FGEV AL  R Q+FT+RT+TLSQLL+LK  +L EA+Q + ED++ +IKNFL+H  
Sbjct  301   GARDIFGEVSALSDRAQAFTFRTRTLSQLLRLKQATLKEAMQSRPEDSVVVIKNFLKHQV  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             ++  +K+ DL   +GD  G+ +   N+ TV A GN+  L +LL+AG D ++GD+KG+T L
Sbjct  361   EMHGMKVEDL---LGDNTGEHDDDANVLTVAAMGNSGLLEDLLRAGKDADVGDAKGRTAL  417

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG+E+CV+VLLKH CN++++D +GNTA+W+AIAA  H  F++LY +   S+P   
Sbjct  418   HIAASKGYEDCVLVLLKHACNVNIRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRAG  477

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             GD++C AA+      +QELLK GL VDS+D  G+TA++ AM E  AD  + L++NGA +D
Sbjct  478   GDVMCLAARRGHLGALQELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLILNGASVD  537

Query  539   D---------------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKD  414
                             A +L ++P +L E+LQKRELGH I +   P  + +  +S  ++ 
Sbjct  538   KASLDDDGSGSGSGSGAARLAMSPTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRP  597

Query  413   DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDAT  234
                 S+S   Q   RVS+Y+GHP  R  T   E G+LI LP T+ E  +I GEKL  DA 
Sbjct  598   GRLQSTSSDSQRWPRVSVYKGHPFLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDAE  655

Query  233   DSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              + +  +EGA IDSIDVIRDNDKLF+V +
Sbjct  656   KALIVSDEGAEIDSIDVIRDNDKLFMVTE  684



>ref|XP_009403705.1| PREDICTED: potassium channel AKT2-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=683

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/680 (60%), Positives = 514/680 (76%), Gaps = 18/680 (3%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MD+ ST+PFE + +L TG+   GV YS+LG LR WRLR+V  FFTRLEKDIRFSYF +RC
Sbjct  1     MDLTSTLPFEGLGYLITGRVKAGVSYSLLGTLRLWRLRKVKRFFTRLEKDIRFSYFCIRC  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
              RLLFVT  LVHCAGCLYY LADRYPHQGK W+G+   N RE +L +RYI+++YWS++TM
Sbjct  61    VRLLFVTFFLVHCAGCLYYLLADRYPHQGKTWIGAAVPNFREANLWMRYIASIYWSISTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHAVNT EMIF IFYML NLGLTAY+IGNMTNLVVEGTRRTMEFRNSIQ ASN
Sbjct  121   TTVGYGDLHAVNTREMIFNIFYMLCNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIQVASN  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP  LKEQILAYMCLRFKAE+LNQQ L++QLPK +CKSIC HLFLP V++ YLF
Sbjct  181   FVCRNHLPPHLKEQILAYMCLRFKAETLNQQHLMDQLPKALCKSICQHLFLPTVKEAYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSRE LLLLV  MK EYIPPREDVIMQNE+P+DVYI+VSGEVE+I ++ E EQVV   
Sbjct  241   KGVSRETLLLLVTKMKVEYIPPREDVIMQNEAPEDVYIVVSGEVEIIYSDNEMEQVVGKF  300

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
             ++GD+FGE  AL  RPQSF +RT+TLSQLLKLK ++L E L  K++D I ++KNFL+H  
Sbjct  301   STGDIFGEFTALSERPQSFIFRTRTLSQLLKLKQSTLKEVLHAKQKDGIIIMKNFLKHQT  360

Query  1079  klkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             + KD+ + +L  E G+ + + N   NL TV ATGN+ FL++LLKAG+DP+IGDSKG+TPL
Sbjct  361   EFKDISIDNLLGENGEFE-ETNKPCNLLTVAATGNSCFLDKLLKAGMDPDIGDSKGRTPL  419

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG+E+CV+VL+ H CNI+++DM+GNT LWDAI  K H+IF+IL+  A +S+PY +
Sbjct  420   HIAASKGYEDCVLVLINHACNINIQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTS  479

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-  543
              DLLC A+K ND S M+ELL HGL++DS++  G TA+Q A  EN  +M+  LVMNGA I 
Sbjct  480   ADLLCLASKRNDLSTMRELLNHGLNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIV  539

Query  542   ----DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHE-AASKWAKDDHQNSSSMPQQC  378
                 + +++  +    L E++Q+R++G+    P   L    A K  +   +  +S+  + 
Sbjct  540   KSNPNGSIERWMKKEILEEMIQQRDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEA  595

Query  377   S---IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEG  207
             +    R+S++ GHP  R      E G+LI LP T+ EL +I G+K   DA    LT+E+ 
Sbjct  596   NEHRPRISVFNGHPLLRNSHS--ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDA  653

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A +DSIDV+RDNDKLFIV +
Sbjct  654   AEVDSIDVLRDNDKLFIVGE  673



>gb|KDO50099.1| hypothetical protein CISIN_1g038432mg, partial [Citrus sinensis]
Length=602

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/591 (69%), Positives = 474/591 (80%), Gaps = 25/591 (4%)
 Frame = -2

Query  1961  FVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTMTTVG  1788
             F  ++LVHCAGCLYY LADRYPH+G+ WLGS+N    E SL IRYISAMYWS+TTMTTVG
Sbjct  13    FCDIILVHCAGCLYYLLADRYPHKGETWLGSVNPNFTETSLWIRYISAMYWSITTMTTVG  72

Query  1787  YGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSR  1608
             YGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV R
Sbjct  73    YGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVGR  132

Query  1607  NHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVS  1428
             N LP RLK+QILAYMCLRFKAESLNQ  LIEQLPK+ICKSIC HLFL  VEKVYLFK VS
Sbjct  133   NRLPPRLKKQILAYMCLRFKAESLNQHQLIEQLPKSICKSICQHLFLHTVEKVYLFKDVS  192

Query  1427  REILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGD  1248
             +EI++LLVA MKAEYIPPREDVIMQNE+PDDVYIIVSGEVEMID EME E  V TL +GD
Sbjct  193   KEIIVLLVAKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEMIDYEMEKEIAVGTLQTGD  252

Query  1247  MFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkd  1068
             MFGEVGALCCRPQ +TYRTKTLSQLL+LKT++L+EA+Q K+EDN++++KNFLQ HKKLKD
Sbjct  253   MFGEVGALCCRPQIYTYRTKTLSQLLRLKTSALIEAMQSKQEDNVSILKNFLQQHKKLKD  312

Query  1067  lklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             L +GDL  E G+EDGDPNMS+NL TV +TGNA FL+ELLKA LDP+IGDSKG+TPLHIAA
Sbjct  313   LNIGDLIAESGEEDGDPNMSVNLLTVASTGNAAFLDELLKARLDPDIGDSKGRTPLHIAA  372

Query  887   SKGHEECVMVLLKHGCNIHLK-----------------DMEGNTALWDAIAAKEHSIFSI  759
             SKGHEECV+VLLKH  N+HL+                 DM GNTALW+AI++K HSIF I
Sbjct  373   SKGHEECVLVLLKHASNVHLRDYIIFMYNLSYDIIILLDMNGNTALWEAISSKHHSIFRI  432

Query  758   LYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQAD  579
             LYH  +ISDPY AGDLLC A K ND SVM+EL+K+GL+VDSKDRHG TAI+ AM EN  +
Sbjct  433   LYHCTAISDPYTAGDLLCTAEKRNDMSVMEELVKYGLNVDSKDRHGRTAIEIAMAENNVE  492

Query  578   MIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAM--PNTILHEAASKWAKD---  414
             M+  LVMNG+++  A K   +  +L ++LQKRE+GHRI +   N+  +E   K  +    
Sbjct  493   MVNFLVMNGSDVVGANKCEFSSTNLNDMLQKREIGHRITVHDDNSTQNEVLLKKLEIIDF  552

Query  413   DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIA  261
             + +   S    C  RVSIYRGHP  R++  C E GRLIKLP ++ EL  IA
Sbjct  553   EAKEGKSKGGNCQ-RVSIYRGHPLVRKQACCMEAGRLIKLPNSLEELKKIA  602



>ref|XP_008781668.1| PREDICTED: potassium channel AKT2-like [Phoenix dactylifera]
Length=734

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/718 (56%), Positives = 523/718 (73%), Gaps = 49/718 (7%)
 Frame = -2

Query  2177  RYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIR  1998
             RYLSTWF+MDVASTIP+E + FL TG+   G+ YS+LG+LR WRLR+V   FTRLEKDIR
Sbjct  14    RYLSTWFVMDVASTIPYEALGFLITGRVKAGISYSLLGLLRLWRLRKVKQLFTRLEKDIR  73

Query  1997  FSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISA  1824
             FSY W+RC RLL VTL L+HCAGCLYY LADRYP+Q K W+G++  N RE SL +RYIS+
Sbjct  74    FSYLWIRCCRLLSVTLFLMHCAGCLYYLLADRYPNQRKTWIGAVIPNFREASLCVRYISS  133

Query  1823  MYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFR  1644
             +YWS+TTMTTVGYGDLHAVN  EMIF I YMLFNLGLTAY+IGNMT LVV+GT+ TMEFR
Sbjct  134   IYWSVTTMTTVGYGDLHAVNAREMIFNILYMLFNLGLTAYLIGNMTILVVDGTQHTMEFR  193

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLP  1464
             NSIQAAS F  RNHLP  L EQILA+MCLRFK ESLNQ  L++QLP++ICKSIC HLFLP
Sbjct  194   NSIQAASTFAYRNHLPPHLGEQILAHMCLRFKTESLNQHQLMDQLPRSICKSICQHLFLP  253

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
              +++VYLF+GVSR++LLLLV  MKAEYIPPREDVIMQNE+PDDVY++VSG++E++  + +
Sbjct  254   TLKEVYLFQGVSRDMLLLLVTKMKAEYIPPREDVIMQNEAPDDVYVVVSGKLEIVYCDNK  313

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              E+VV  L+ GD+FGE+ ALC RPQSFT+RTKTLSQLL++K  +L E LQ K+ED+I +I
Sbjct  314   KEEVVGDLSMGDIFGEISALCNRPQSFTFRTKTLSQLLRMKQCALREVLQTKQEDSIVII  373

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             KNFL+H  + KD+   DL  E G+ D + N+  NL TVVATG+++ +  LLKAG+DP+I 
Sbjct  374   KNFLKHQIEYKDISTEDLLEENGEYD-EANIPCNLLTVVATGSSSLVEGLLKAGMDPDIS  432

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             DS+G+TPLH+AASKG E+CV+VLL H CN++++D++GNT LW AI AK H IF++LY  A
Sbjct  433   DSRGRTPLHVAASKGFEDCVLVLLNHACNVNIQDVDGNTPLWIAITAKHHKIFNLLYPCA  492

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
              IS+P + G+LLC AAK ND S ++ELLKHGL+++S +  G TA+Q A+ EN  ++I+ L
Sbjct  493   CISNPNIGGNLLCLAAKRNDLSTVKELLKHGLNIESGNHEGLTALQVALAENHEEIIRFL  552

Query  563   VMNGAEIDDAVKLNLAPLD---LTEVLQKRELGHRIAMPNTILH-----EAASKWAKDDH  408
             VMNGA ++ A     + +    L E++ +RE+G+    P T+L      E      +  H
Sbjct  553   VMNGANVEKADPRGQSKMKHHLLEEMVHQREVGY----PITVLESPSESEQIKVSGEQGH  608

Query  407   QNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISI------------  264
               +      C  RVS+Y+GHP  R  +   E G+LI LP T+ EL +I            
Sbjct  609   MLNWERIGHCP-RVSVYKGHPLLRIPSS--EAGKLISLPNTMKELKNIIGMHLYLYLYNV  665

Query  263   -------------------AGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
                                 G +LG DA++ ++T+ +GA IDS++V+RDNDKLFIV D
Sbjct  666   VPIYCKIQKFYENQVSYLLTGGRLGIDASNRTVTNADGAEIDSMEVLRDNDKLFIVED  723



>ref|XP_007042251.1| Potassium transport 2/3 isoform 2 [Theobroma cacao]
 gb|EOX98082.1| Potassium transport 2/3 isoform 2 [Theobroma cacao]
Length=557

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/557 (69%), Positives = 456/557 (82%), Gaps = 8/557 (1%)
 Frame = -2

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             MTTVGYGDLHAVNT+EMIFII YMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI+AAS
Sbjct  1     MTTVGYGDLHAVNTVEMIFIILYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIEAAS  60

Query  1622  NFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
             NFVSRN LPARLKEQILAYMCLRFKAE LNQQ LIEQLPK+I   IC HLFLP V+KVYL
Sbjct  61    NFVSRNRLPARLKEQILAYMCLRFKAERLNQQQLIEQLPKSIYTGICQHLFLPTVKKVYL  120

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F G SRE+LL LVA MKAEY+PPREDVIMQNE+PDDVYIIVSGEVE+ID EME E  V T
Sbjct  121   FNGTSREMLLHLVAKMKAEYLPPREDVIMQNEAPDDVYIIVSGEVEIIDYEMEKELAVGT  180

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             L S D+FGE+GALCCRPQ FT+RTKTLSQLL+LKTT L+ A+Q K+EDN+ ++KNFLQ +
Sbjct  181   LRSEDIFGEIGALCCRPQRFTFRTKTLSQLLRLKTTDLIAAMQTKQEDNVAILKNFLQQN  240

Query  1082  kklkdlklgdLFIEIGDEDGDP-NMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             K+LKD K+GDL IE G+EDGDP N++I+L TV   GNA FL+ELLKA LDP++GDS+G+T
Sbjct  241   KRLKDHKIGDLVIEGGEEDGDPKNIAISLLTVADAGNAAFLDELLKARLDPDVGDSEGRT  300

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
             PLHIAASKGHEECV+VLLKH CN+H++DM GNTALWDAI+AK HSIF++LYH+A+ISD +
Sbjct  301   PLHIAASKGHEECVLVLLKHACNVHVRDMNGNTALWDAISAKHHSIFTVLYHFAAISDSF  360

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
              AGDLLC AAK ND +VMQELLKHGL VD+KDRHG TA+Q AM E   DM+ LLVMNGA+
Sbjct  361   TAGDLLCTAAKRNDLTVMQELLKHGLSVDAKDRHGLTALQIAMREKHEDMVNLLVMNGAD  420

Query  545   IDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCS---  375
             + +A     +   L E+L+KRE+GHRI + +T    +  +  K   +    +  +C    
Sbjct  421   VINANTYEFSSTALNEMLKKREIGHRITVTDTT---SGEELLKKLEREDVCILGKCRGLD  477

Query  374   -IRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
              +RVSIYRGHP  R E+ C EPG+LI+LP+++ EL + AGEK G D  ++ +TDE GA I
Sbjct  478   PLRVSIYRGHPLMRTESCCMEPGKLIRLPDSLDELKNFAGEKFGIDPRNAIVTDEGGAEI  537

Query  197   DSIDVIRDNDKLFIVAD  147
             DSI+VIRDNDKLFIVA+
Sbjct  538   DSIEVIRDNDKLFIVAE  554



>ref|XP_008647796.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Zea mays]
 ref|XP_008647797.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Zea mays]
Length=696

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/686 (57%), Positives = 508/686 (74%), Gaps = 22/686 (3%)
 Frame = -2

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV   FTRLEKDIRFSYFW+R 
Sbjct  1     MDVASTIPFQSLAYLITGEVRENAAYSMLGVLRLWRLRRVKQLFTRLEKDIRFSYFWIRS  60

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMTTM  1800
             ARL+ VTL LVHCAGCLYY +ADRYP + K W+G++N   R+ SL+IRYIS++YWS+TTM
Sbjct  61    ARLIAVTLFLVHCAGCLYYLIADRYPDREKTWIGAVNPNFRQASLRIRYISSVYWSITTM  120

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLHA NT+EMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNS++ AS+
Sbjct  121   TTVGYGDLHAQNTVEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSVRTASS  180

Query  1619  FVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
             FV RNHLP RLK+QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLF+PVV+ VYLF
Sbjct  181   FVGRNHLPPRLKQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFVPVVKDVYLF  240

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVSRE+LL L   MK EYIPP+EDVI+QNE+PDDVY++VSGEVE++  +  +E+V  TL
Sbjct  241   KGVSREMLLSLATKMKPEYIPPKEDVIVQNEAPDDVYVVVSGEVEVVLFDGVDERVEATL  300

Query  1259  NSGDMFGEVGALCCRPQS-FTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
              + ++FGEV AL  RPQ+ FT+RT+TLSQLL+LK  +L EA+Q   +D++ +IKN+++H 
Sbjct  301   GTRNIFGEVSALSDRPQAPFTFRTRTLSQLLRLKQATLKEAMQSWPDDSVIIIKNYVKHQ  360

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              ++  +K  D    +GD   + +   N+ TV A GN+  L +LL+AG D ++GD+ G+T 
Sbjct  361   VEMHGMKADD---SLGDNTSEHDDDANVLTVAAMGNSGLLEDLLRAGKDADVGDAMGRTA  417

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIAASKG+E+CV+VLLKH CN +++D +GNTA+W+AIAA  H IF+ILYH A  S+P+ 
Sbjct  418   LHIAASKGYEDCVLVLLKHACNANIRDAQGNTAMWNAIAAGHHKIFNILYHSARASNPHA  477

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              GD++C A +  D   ++ELLK GL VDS+D  G+TA++ AM E  AD  + L+ NGA +
Sbjct  478   GGDVMCLATRRGDLDALRELLKLGLDVDSEDHDGATALRVAMAEGHADAARFLITNGASV  537

Query  542   DD-----------AVKLNLAPLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQ  405
             D            A +L ++P +L E+LQKREL H I +   P  +    +S  ++    
Sbjct  538   DKASLDDDGSGSGAARLTMSPTELHELLQKRELVHSITITDSPPVVPDGGSSGHSRPGRL  597

Query  404   NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSS  225
              S+        RVSIYRGHP  R  +   E G+LI LP T+ E I++ GEKL  D   + 
Sbjct  598   QSTGSDNTRWPRVSIYRGHPFLRNRSS--EAGKLINLPATMEEFIAVVGEKLKVDTEKAL  655

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVAD  147
             + ++EGA +DSIDVIRDNDKLF+V +
Sbjct  656   IVNDEGAEVDSIDVIRDNDKLFVVTE  681



>ref|XP_008456068.1| PREDICTED: potassium channel AKT2/3 [Cucumis melo]
Length=634

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 405/477 (85%), Gaps = 5/477 (1%)
 Frame = -2

Query  2498  LGKLSKFILPPLGSSQPTHTS---SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             L +LSK ILPPLG S  T  S   S   +ISPM SRYR W+++MV+LVAYS WV P E++
Sbjct  47    LRELSKVILPPLGVSSFTDGSKVKSNRWIISPMSSRYRWWQSFMVVLVAYSVWVYPLEVA  106

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             FL++    KL +VD+IVD+FFA+DIV TFFVAYID  TQLL+   KKIA RYLSTWFLMD
Sbjct  107   FLDAIPRRKLLIVDSIVDIFFAIDIVFTFFVAYIDHRTQLLVRDSKKIAIRYLSTWFLMD  166

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             +ASTIPF+ +A+L TGK+ L + +++LG+LRFWRLRRV  FFTRLEKDIRFSYFWVRCAR
Sbjct  167   LASTIPFDTLAYLSTGKYDLCLPFALLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRCAR  226

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             LL VTL  VHCAGC+YY LADRYPHQGK W+G+L  N +E S  +RY SAMYWS+TTMTT
Sbjct  227   LLSVTLFYVHCAGCVYYLLADRYPHQGKTWIGTLFPNFKEISFGVRYTSAMYWSITTMTT  286

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+ ASNFV
Sbjct  287   VGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEMASNFV  346

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             +RN LP+RLKE ILAYMCLRFKAESLNQQ LIEQLPK+ICKSIC  LFLP VEKVYLFKG
Sbjct  347   NRNRLPSRLKEHILAYMCLRFKAESLNQQHLIEQLPKSICKSICQQLFLPTVEKVYLFKG  406

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             VS+E L++LVA MKAEYIPP+EDVI+QN++PD+VYIIVSGE+E+ID EM+ E++V  L+ 
Sbjct  407   VSKETLVVLVAKMKAEYIPPKEDVIIQNDTPDEVYIIVSGEIEIIDCEMDVERIVGALHC  466

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             G MFGEVGALCC+ Q+FTYRT+TLSQLLKLKT+ L EA+  K+ED++ ++KNFLQ  
Sbjct  467   GSMFGEVGALCCKNQNFTYRTRTLSQLLKLKTSVLQEAMNFKQEDSMVIVKNFLQER  523


 Score =   108 bits (269),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -2

Query  494  LQKRELGHRIAMPNTILHEAASKWA-KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  318
            LQ+REL H+I +  +   E  +    KD   N     +    RV+IY+GHP  R++  C 
Sbjct  520  LQERELSHKITIEGSPEKEVPTLIEEKDQSFNWKHSIELDFARVNIYKGHPVARKQASCD  579

Query  317  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
            +PG+LI+LP ++ EL  +AGEK GFDA ++ LT+EEG+ IDSIDVIRDNDK++
Sbjct  580  DPGKLIRLPHSMEELKKLAGEKFGFDARNAVLTNEEGSEIDSIDVIRDNDKIY  632



>ref|XP_004146262.1| PREDICTED: potassium channel AKT2/3-like [Cucumis sativus]
 gb|KGN57590.1| hypothetical protein Csa_3G221730 [Cucumis sativus]
Length=636

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/478 (72%), Positives = 405/478 (85%), Gaps = 6/478 (1%)
 Frame = -2

Query  2498  LGKLSKFILPPLGSSQPTHTS----SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             L +LSK ILPPLG S  T  S    S   +ISPM SRYR W+++MV+LV+YS WV P E+
Sbjct  48    LRELSKVILPPLGVSSFTDGSNRVKSNRWIISPMSSRYRWWQSFMVVLVSYSVWVYPLEV  107

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
             +FL++    KL +VD +VDLFFA+DIV TFFV+YID  TQLL+   KKIA RYLSTWFLM
Sbjct  108   AFLDAIPRRKLLIVDTVVDLFFAIDIVFTFFVSYIDHRTQLLVRDSKKIAIRYLSTWFLM  167

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ASTIPF+ +A+L TGK+ L + +++LG+LRFWRLRRV  FFTRLEKDIRFSYFWVRCA
Sbjct  168   DLASTIPFDTLAYLSTGKYDLCLPFALLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRCA  227

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             RLL VTL  VHCAGC+YY LADRYPH+GK W+G+L  N +E S  +RY SAMYWS+TTMT
Sbjct  228   RLLSVTLFYVHCAGCVYYLLADRYPHEGKTWIGTLFPNFKEISFGVRYTSAMYWSITTMT  287

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+ ASNF
Sbjct  288   TVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEMASNF  347

Query  1616  VSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFK  1437
             V+RN LP+RLKE ILAYMCLRFKAESLNQQ LIEQLPK+ICKSIC  LFLP VEKVYLFK
Sbjct  348   VNRNRLPSRLKEHILAYMCLRFKAESLNQQHLIEQLPKSICKSICQQLFLPTVEKVYLFK  407

Query  1436  GVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN  1257
             GVS+E L++LVA MKAEYIPP+EDVI+QN++PD+VYIIVSGE+E+ID EM+ E++V TL+
Sbjct  408   GVSKETLVVLVAKMKAEYIPPKEDVIIQNDTPDEVYIIVSGEIEIIDCEMDVERIVGTLH  467

Query  1256  SGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
              G MFGEVGALCC+ QSFTYRT+TLSQLLKLKT+ L EA+  K+ED++ ++KNFLQ  
Sbjct  468   CGSMFGEVGALCCKNQSFTYRTRTLSQLLKLKTSVLQEAMNFKQEDSMVIVKNFLQER  525


 Score =   108 bits (269),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -2

Query  494  LQKRELGHRIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCP  318
            LQ+REL H+I +  +   E  +   + D   N     +    RV+IY+GHP  R++  C 
Sbjct  522  LQERELSHKITIEGSPEKEVPTLIEEKDQSFNWKHSIELDFARVNIYKGHPVARKQASCD  581

Query  317  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
            +PG+LI+LP ++ EL  +AGEK GFDA ++ LT+EEG+ IDSIDVIRDNDK++
Sbjct  582  DPGKLIRLPHSMEELKKLAGEKFGFDARNAVLTNEEGSEIDSIDVIRDNDKIY  634



>gb|EMS50502.1| Potassium channel AKT2/3 [Triticum urartu]
Length=770

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/564 (64%), Positives = 444/564 (79%), Gaps = 19/564 (3%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             F+L  LSK +LPPLGSS    TS S   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  34    FNLRNLSKLMLPPLGSSLTQSTSDSDKRVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  93

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+E++    L V D +VD+FFAVDIVLTFFVAYID  TQLL+  R++I  RYLST+F+MD
Sbjct  94    FMEARPKGGLEVADMVVDIFFAVDIVLTFFVAYIDSRTQLLVRDRRRITFRYLSTFFIMD  153

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRLEKDIRFSYFWVRCAR
Sbjct  154   VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRCAR  213

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL LV CAGCLYY LADRYP + K W+G++  N R+ESL IRYIS++YWS+TTMTT
Sbjct  214   LIAVTLFLVPCAGCLYYLLADRYPDRDKTWIGAVIPNFRQESLWIRYISSIYWSITTMTT  273

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA N LEMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  274   VGYGDLHAQNNLEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFV  333

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
              RNHLP RL++QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLFLPVV++VYLF+G
Sbjct  334   CRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFLPVVKEVYLFRG  393

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SRE  LLLV   K EYIPP+EDVI+QNE+ DDVYI+VSGEVE+I    E E+V+  L +
Sbjct  394   ISREAQLLLVTKTKPEYIPPKEDVIVQNEAADDVYIVVSGEVEIIYFNGEREEVMGKLGT  453

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
              D+FGEV AL  RPQ+FT+RT+TLSQLL+LK  +L E +Q K +D+  +++NFL+H  ++
Sbjct  454   MDIFGEVSALSDRPQTFTFRTRTLSQLLRLKQATLREVMQSKPDDSALIVRNFLKHQIEV  513

Query  1073  kdlklgdLFIEIGDEDGDPNM-SINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
              D+K      E     G  N+   NL TV ATGNA FL +LLK G+DP++GDSKG+T L 
Sbjct  514   HDMKELLG--ESTGAGGSGNIVPCNLLTVAATGNAGFLEDLLKVGMDPDVGDSKGRTAL-  570

Query  896   IAASKGHEECVMVLLKHGCNIHLK  825
                          LL HGCNI++K
Sbjct  571   ------------ALLMHGCNINIK  582



>ref|XP_004159885.1| PREDICTED: potassium channel AKT2/3-like [Cucumis sativus]
Length=552

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/440 (73%), Positives = 382/440 (87%), Gaps = 2/440 (0%)
 Frame = -2

Query  2396  RCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPT  2217
             R W+++MV+LV+YS WV P E++FL++    KL +VD +VDLFFA+DIV TFFV+YID  
Sbjct  2     RWWQSFMVVLVSYSVWVYPLEVAFLDAIPRRKLLIVDTVVDLFFAIDIVFTFFVSYIDHR  61

Query  2216  TQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRR  2037
             TQLL+   KKIA RYLSTWFLMD+ASTIPF+ +A+L TGK+ L + +++LG+LRFWRLRR
Sbjct  62    TQLLVRDSKKIAIRYLSTWFLMDLASTIPFDTLAYLSTGKYDLCLPFALLGLLRFWRLRR  121

Query  2036  VSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--N  1863
             V  FFTRLEKDIRFSYFWVRCARLL VTL  VHCAGC+YY LADRYPH+GK W+G+L  N
Sbjct  122   VKQFFTRLEKDIRFSYFWVRCARLLSVTLFYVHCAGCVYYLLADRYPHEGKTWIGTLFPN  181

Query  1862  VREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTN  1683
              +E S  +RY SAMYWS+TTMTTVGYGDLHAVNT+EMIFIIFYMLFNLGLTAY+IGNMTN
Sbjct  182   FKEISFGVRYTSAMYWSITTMTTVGYGDLHAVNTVEMIFIIFYMLFNLGLTAYLIGNMTN  241

Query  1682  LVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPK  1503
             LVVEGTRRTMEFRNSI+ ASNFV+RN LP+RLKE ILAYMCLRFKAESLNQQ LIEQLPK
Sbjct  242   LVVEGTRRTMEFRNSIEMASNFVNRNRLPSRLKEHILAYMCLRFKAESLNQQHLIEQLPK  301

Query  1502  TICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYII  1323
             +ICKSIC  LFLP VEKVYLFKGVS+E L++LVA MKAEYIPP+EDVI+QN++PD+VYII
Sbjct  302   SICKSICQQLFLPTVEKVYLFKGVSKETLVVLVAKMKAEYIPPKEDVIIQNDTPDEVYII  361

Query  1322  VSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLE  1143
             VSGE+E+ID EM+ E++V TL+ G MFGEVGALCC+ QSFTYRT+TLSQLLKLKT+ L E
Sbjct  362   VSGEIEIIDCEMDVERIVGTLHCGSMFGEVGALCCKNQSFTYRTRTLSQLLKLKTSVLQE  421

Query  1142  ALQMKREDNITMIKNFLQHH  1083
             A+  K+ED++ ++KNFLQ  
Sbjct  422   AMNFKQEDSMVIVKNFLQER  441


 Score =   108 bits (270),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -2

Query  494  LQKRELGHRIAMPNTILHEAASKWA-KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  318
            LQ+REL H+I +  +   E  +    KD   N     +    RV+IY+GHP  R++  C 
Sbjct  438  LQERELSHKITIEGSPEKEVPTLIEEKDQSFNWKHSIELDFARVNIYKGHPVARKQASCD  497

Query  317  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
            +PG+LI+LP ++ EL  +AGEK GFDA ++ LT+EEG+ IDSIDVIRDNDK++
Sbjct  498  DPGKLIRLPHSMEELKKLAGEKFGFDARNAVLTNEEGSEIDSIDVIRDNDKIY  550



>emb|CAA70947.1| putative inward rectifying potassium channel [Solanum tuberosum]
Length=468

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/467 (71%), Positives = 397/467 (85%), Gaps = 2/467 (0%)
 Frame = -2

Query  1538  LNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVI  1359
             LNQQ LIEQLPKTICKSI HHLFLP VEKVYLFKGV+RE+LLLLVADMKAEYIPPREDVI
Sbjct  1     LNQQELIEQLPKTICKSIRHHLFLPTVEKVYLFKGVTRELLLLLVADMKAEYIPPREDVI  60

Query  1358  MQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktls  1179
             MQNESPD++YIIVSGEVEMI++EMENE  VWT  SGDM GEVGA CCRPQS+TYRTKTLS
Sbjct  61    MQNESPDELYIIVSGEVEMIESEMENEPTVWTFKSGDMIGEVGAFCCRPQSYTYRTKTLS  120

Query  1178  qllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINL  999
             QLLK++T++L+EA++ ++EDNI MIKNFLQHHKKLK L+LGDL   +G + GDPNM +NL
Sbjct  121   QLLKIRTSNLIEAMKTRQEDNIIMIKNFLQHHKKLKGLRLGDLLHGVGGDYGDPNMYVNL  180

Query  998   FTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDM  819
              TV +TGNATFL ELLKA LDP+IGD++G+TPLHIAASKGHEECVMVLL+HGCNI+L+D+
Sbjct  181   LTVASTGNATFLEELLKAKLDPDIGDAQGRTPLHIAASKGHEECVMVLLRHGCNINLRDV  240

Query  818   EGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVD  639
              G+TALW+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHGL VD
Sbjct  241   NGHTALWEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHGLQVD  300

Query  638   SKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAM  459
             SKDR GSTAI  A+E+N  DM+KLL+MNGAEI+D +K  L+ ++L+++LQKRE+GHR+ +
Sbjct  301   SKDRDGSTAIHVALEQNLEDMVKLLLMNGAEINDKLKYKLSSMNLSDMLQKREVGHRVMV  360

Query  458   PNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETI  282
              +T + E A KW + + Q N+ S   Q   RVSIYRGHP TRR T C EPG+LIKLP ++
Sbjct  361   SDT-MDEVAQKWREQEKQHNTESTRDQYYFRVSIYRGHPVTRRRTHCSEPGKLIKLPNSL  419

Query  281   AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  141
             A L  IAG K GFDAT++S+TD+EG+ IDSI+VIRDNDKLFIV   N
Sbjct  420   AVLKIIAGAKFGFDATNASVTDQEGSEIDSIEVIRDNDKLFIVEGPN  466



>ref|XP_010047779.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
Length=885

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/850 (43%), Positives = 505/850 (59%), Gaps = 70/850 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28    RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL       L ++DN+V+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88    GFLRDPA-IALSIIDNVVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  147   DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  203

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY    + W+G++  N  E+SL IRY++++YWS+TT+T
Sbjct  204   KLICVTLFAVHCAGCFYYLLAARYRDPKRTWIGAIMENFLEQSLWIRYVTSIYWSITTLT  263

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F
Sbjct  264   TVGYGDLHPVNTREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSF  323

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ ++E LPK I  SI H+LF  +V+KVYL
Sbjct  324   SLRNQLPPRLQDQMLAHLCLKYRTNSEGLQQQEILESLPKAIRSSISHYLFYSLVDKVYL  383

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV+  
Sbjct  384   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVMKNGTEQVIGE  443

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  444   AKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  503

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGK  909
             K LKD  +  + +E  +      M + L    AT  G+   LN+LLK GLDPN  D+ G+
Sbjct  504   KDLKDPTMEGVLLETENMLARGRMDLPLSLCFATMRGDDLLLNQLLKRGLDPNESDNSGR  563

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISD  732
             T LHIAASKG E CV++LL    + + +D EG+  LW+A+      +  +L  + A+IS 
Sbjct  564   TSLHIAASKGSENCVLLLLDFEADPNRRDSEGSVPLWEAMLGGHDPVVKLLAENGANISS  623

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
               V G   C AA+ N+  +++E++ +G  V     HG+TA+  A+ E+  +++K L+  G
Sbjct  624   GDV-GQFACTAAEQNNLYLLKEIVHYGGDVTLPSSHGNTALHIAVSEDNLEIVKFLLEQG  682

Query  551   AEIDDAVKLNLAPLDLTEVLQKREL-----GHRIAMPNTIL------HEAAS--------  429
             A++D        P DL +     E+         A P +++      HEA S        
Sbjct  683   ADMDKPDTYGWTPRDLADQQGHEEIKLLFQSSEDAKPQSVIAIPEKHHEARSLGRFTSEP  742

Query  428   -------------KWAKDDHQNSSS--------------------MPQQCSIRVSIYRGH  348
                           W +   +  S+                    MP       S+  G 
Sbjct  743   MIRPASRESNVEGSWGQSRPRRRSNNFHNSLFGVMSAAHKGKKREMPFPVDQVHSVKSGI  802

Query  347   PATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
                R    CPE     G+L+ LP ++ EL+    +K GF    + +  + GA +D I+VI
Sbjct  803   DPARVTISCPEIGDSAGKLVLLPGSLEELLQTGAKKFGF--MPAKILMKNGAEVDDIEVI  860

Query  179   RDNDKLFIVA  150
             RD D L  V 
Sbjct  861   RDGDHLIFVG  870



>gb|EMT08371.1| hypothetical protein F775_52637 [Aegilops tauschii]
Length=887

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 396/477 (83%), Gaps = 3/477 (1%)
 Frame = -2

Query  2504  FSLGKLSKFILPPLGSSQPTHTSS-QGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             F+L  LSK +LPPLGSS    TS     V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  117   FNLRNLSKLMLPPLGSSLSQSTSDSDKRVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  176

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+E++    L V D +VD+FFAVDIVLTFFVAYID  TQLL+  R++I  RYLST+F+MD
Sbjct  177   FMEARPKGGLEVADMVVDIFFAVDIVLTFFVAYIDSRTQLLVRDRRRITFRYLSTFFIMD  236

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRLEKDIRFSYFWVRCAR
Sbjct  237   VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRCAR  296

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL LVHCAGCLYY LADRYP + K W+G++  N R+ESL IRYIS++YWS+TTMTT
Sbjct  297   LIAVTLFLVHCAGCLYYLLADRYPDRDKTWIGAVIPNFRQESLWIRYISSIYWSITTMTT  356

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA N LEMIF IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV
Sbjct  357   VGYGDLHAQNNLEMIFNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFV  416

Query  1613  SRNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
              RNHLP RL++QILAYMCL+F+AESLNQQ L++QLPK+ICKSIC HLFLPVV++VYLFKG
Sbjct  417   CRNHLPPRLQQQILAYMCLKFRAESLNQQQLMDQLPKSICKSICEHLFLPVVKEVYLFKG  476

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +SRE  LLLV   K EYIPP+EDVI+QNE+ DDVYI+VSGEVE++    E E+V+  L +
Sbjct  477   ISREAQLLLVTKTKPEYIPPKEDVIVQNEAADDVYIVVSGEVEIVYFNGEREEVMGKLGT  536

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
              D+FGEV AL  RPQ+FT+RT+TLSQLL+LK  +L E +Q K +D+  +++NFL+H 
Sbjct  537   MDIFGEVSALSDRPQTFTFRTRTLSQLLRLKQATLREVMQSKPDDSALIVRNFLKHQ  593


 Score = 99.0 bits (245),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  824  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  645
            + +GNTALW AIAA+ H +FS LYH A +S+P  AGDLLC AA+      ++ELLK GL 
Sbjct  702  NAQGNTALWQAIAARHHKVFSNLYHVARVSNPRAAGDLLCLAARRRGLDTLRELLKQGLD  761

Query  644  VDSKDRHGSTAIQAAMEENQAD  579
            VD++D  GSTA++ A+ E QAD
Sbjct  762  VDTEDHDGSTALRVALSEGQAD  783


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = -2

Query  416  DDHQNSSSM----PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKL  249
            +DH  S+++     +  +   SIY+GHP  R  +   E G+LI LP T+ E  +I GEKL
Sbjct  765  EDHDGSTALRVALSEGQADAASIYKGHPFVRNHSS--EAGKLINLPATMEEFKTIIGEKL  822

Query  248  GFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              D   + + + EGA IDS+DVIRDNDKLFIV +
Sbjct  823  KVDTEKALILNGEGAEIDSLDVIRDNDKLFIVTE  856



>ref|XP_010249975.1| PREDICTED: potassium channel AKT1-like [Nelumbo nucifera]
Length=876

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/861 (43%), Positives = 510/861 (59%), Gaps = 73/861 (8%)
 Frame = -2

Query  2519  QEDEDFSLG----KLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  2352
             QE E  SL      L+  ILP LG+        +  +ISP D RYR WE+++V+LV Y+A
Sbjct  17    QEIEQMSLDGSHYSLTSEILPSLGARSNRRVKLRRFIISPYDRRYRIWESFLVILVLYTA  76

Query  2351  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  2172
             WV PFE  FLE +    L + DN+V+ FFA+DIVLTFF+AY+D  T LLI + K+IA RY
Sbjct  77    WVSPFEFGFLE-RPKGALAITDNVVNAFFAIDIVLTFFIAYLDKITYLLIDNPKQIAWRY  135

Query  2171  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFS  1992
              STW   DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+
Sbjct  136   TSTWLAFDVISTIPSELARKMLPSSLQ---SYGFFNMLRLWRLRRVSSMFARLEKDRHFN  192

Query  1991  YFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMY  1818
             YFWVRCA+L+ VTL  VHC+GC YY +A RY    K W+G+   N  E SL IRY++++Y
Sbjct  193   YFWVRCAKLICVTLFAVHCSGCFYYLIAARYHDPSKTWIGASIENFLETSLWIRYVTSLY  252

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+TT+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++
Sbjct  253   WSITTLTTVGYGDLHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDT  312

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLP  1464
             IQAAS+F  R+ LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  
Sbjct  313   IQAASSFAQRHQLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYS  372

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
             +V+KVYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D Y++V+G V+++  +  
Sbjct  373   LVDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYVLVTGAVDLLVLKNG  432

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              EQVV   N+GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++
Sbjct  433   TEQVVGEANAGDICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQANVGDGTIIM  492

Query  1103  KNFLQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPN  930
              N LQH K+LKD  +  +  E  +      M + L    AT  G+   L++LL+ GLDPN
Sbjct  493   NNLLQHLKELKDPLMQGILTETENMLARGRMDLPLTLCFATLRGDDLLLHQLLRRGLDPN  552

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D+ G++ LHIAAS+G + CV++LL +G N + +D EGN  LW+AI  +   +  +L  
Sbjct  553   ESDNNGRSALHIAASRGSDNCVLLLLDYGANPNSRDSEGNVPLWEAIMGRHEPVIKLLKD  612

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
               +       G   C AA+ N   +++++++HG  V     +G+TA+  A+ E   ++++
Sbjct  613   NGANIVSGDVGQFACTAAEQNKLDLLKDIVRHGGDVTLSRSNGTTALHVAVCEGNIEVVE  672

Query  569   LLVMNGAEIDDAVKLNLAPLDL---------------------------TEVLQKRELGH  471
              L+ +GA+ID       +P DL                           +E  + R LG 
Sbjct  673   FLLDHGADIDKPDSHGWSPRDLAEQQGHEEIKTLFQSKKEAKNQSTIIVSEQQRVRYLGR  732

Query  470   RIAMPNT-ILHEAASK------WA------KDDHQNS-------------SSMPQQCSIR  369
               + P+   L+   +       W        D+  NS               +P    + 
Sbjct  733   FTSEPSLYALYPGGAAIHPEMPWRDRRRRRTDNFHNSLFGIMSAAQTGDKGLVPLTAHVN  792

Query  368   VSIYRGHPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
              S   G+   R    CPE G    +L+ LP++I EL++I  +K GF  + S +  +EGA 
Sbjct  793   CSKSCGNYPARVTITCPEKGLVTGKLLLLPQSIEELLAICSQKFGF--SPSKVLSKEGAE  850

Query  200   IDSIDVIRDNDKLFIVADWNS  138
             ID I +IRD D L I +D+ +
Sbjct  851   IDDIQLIRDGDHLIIASDYGT  871



>ref|XP_010047932.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW79958.1| hypothetical protein EUGRSUZ_C01286 [Eucalyptus grandis]
Length=885

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/850 (43%), Positives = 503/850 (59%), Gaps = 70/850 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28    RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL       L ++DNIV+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88    GFLRDPA-IALSIIDNIVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  147   DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  203

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY    + W+G++  N  E+SL IRY++++YWS+TT+T
Sbjct  204   KLICVTLFAVHCAGCFYYLLAARYRDPKRTWIGAIMENFLEQSLWIRYVTSIYWSITTLT  263

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F
Sbjct  264   TVGYGDLHPVNTREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSF  323

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ ++E LPK I  SI H+LF  +V+KVYL
Sbjct  324   SLRNQLPPRLQDQMLAHLCLKYRTNSEGLQQQEILESLPKAIRSSISHYLFYSLVDKVYL  383

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV+  
Sbjct  384   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVMKNGTEQVIGE  443

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  444   AKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  503

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGK  909
             K LKD  +  + +E  +      M + L    AT  G+   LN+LLK GLDPN  D+ G+
Sbjct  504   KDLKDPTMEGVLLETENMLARGRMDLPLSLCFATMRGDDLLLNQLLKRGLDPNESDNSGR  563

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISD  732
             T LHIAASKG E CV++LL    + + +D EG+  LW+A+      +  +L  + A+IS 
Sbjct  564   TSLHIAASKGSENCVLLLLDFEADPNRRDSEGSVPLWEAMLGGHDPVVKLLAENGANISS  623

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
               V G   C AA+ N+  +++E++ +G  V      G+TA+  A+ E+  +++K L+  G
Sbjct  624   GDV-GQFACTAAEQNNLYLLKEIMHYGGDVTLPSSRGNTALHIAVSEDNLEIVKFLLEQG  682

Query  551   AEIDDAVKLNLAPLDLTEVLQKREL-----GHRIAMPNTIL------HEAAS--------  429
             A++D        P DL +     E+         A P +++      HEA S        
Sbjct  683   ADMDKPDTYGWTPRDLADQQGHEEIKLLFQSSEDAKPQSVIAIPEKHHEARSLGRFTSEP  742

Query  428   -------------KWAKDDHQNSSS--------------------MPQQCSIRVSIYRGH  348
                           W     +  S+                    MP       S+  G 
Sbjct  743   MIRPASRENNLEGSWGHSRPRRRSNNFHNSLFGVMSAAHNGKKREMPFPVDQVHSVKSGV  802

Query  347   PATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
                R    CPE     G+L+ LP ++ EL+    +K GF    + +  + GA +D I+VI
Sbjct  803   DPARVTVSCPEIGDSAGKLVLLPGSLEELLETGAKKFGF--MPAKILMKNGAEVDDIEVI  860

Query  179   RDNDKLFIVA  150
             RD D L  V 
Sbjct  861   RDGDHLIFVG  870



>ref|XP_007013335.1| K+ transporter 1 [Theobroma cacao]
 gb|EOY30954.1| K+ transporter 1 [Theobroma cacao]
Length=885

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/844 (43%), Positives = 509/844 (60%), Gaps = 71/844 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE  FL+ K 
Sbjct  32    LSTGILPSLGARSNRRVKLRRFIVSPYDRRYRVWETFLVILVVYTAWVSPFEFGFLK-KP  90

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             ++ L V DN+V+ FFA+DI+LTFFVAY+D TT LLI   KKIA +Y S+W   D+ STIP
Sbjct  91    ESPLSVTDNVVNGFFALDIILTFFVAYLDKTTYLLIDDPKKIAWKYGSSWLAFDIISTIP  150

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA+L+ VTL
Sbjct  151   SELAQKISPKPLR---SYGLFNMLRLWRLRRVSALFSRLEKDKNYNYFWVRCAKLICVTL  207

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
               VHCAGC YY +A RY   G+ W+GS    N  E+SL IRY+++MYWS+TT+TTVGYGD
Sbjct  208   FAVHCAGCFYYLIAARYHDPGRTWIGSSLGDNFLEQSLSIRYVTSMYWSITTLTTVGYGD  267

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+F  RN L
Sbjct  268   LHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASSFAQRNQL  327

Query  1598  PARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             PARL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +++KVYLF GVS 
Sbjct  328   PARLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFHGVSN  387

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV    +GD+
Sbjct  388   DLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGAEQVVGEAKTGDL  447

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
              GE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N LQH K + D 
Sbjct  448   LGEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIIQANVGDGTIIMNNLLQHLKDMNDP  507

Query  1064  klgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              +  + +E  +    G  ++ +NL      G+   L++LLK GLDPN  D+ G+T LHIA
Sbjct  508   IMEGVLMETENMLARGRMDLPVNLCFATLRGDDLLLHQLLKRGLDPNESDNNGRTALHIA  567

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             A KG E CV++LL +G + + KD EG   LW+A++A  +    +L    +  +    G  
Sbjct  568   AMKGSENCVLLLLDYGADPNCKDSEGIVPLWEAMSAGHNKATKLLKENGANINTGDVGHY  627

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
              C AA+ N+  +++E+L++G  V     +G TA+  A+ E   +++K L+ +GA+ID   
Sbjct  628   ACTAAEQNNIVLLKEILRYGGDVTRPRHNGYTALHVAVCEGNTEIVKFLLEHGADIDKPD  687

Query  530   KLNLAPLDLTE------------------------VLQKRE---LGHRIAMPNTILHEAA  432
                  P DL E                        + +K+E   LG   + P  ++  AA
Sbjct  688   IHGWTPRDLAEQQGHDEIKMIFESTKEMNTQSIMSIPEKQETRYLGRFTSEP--VIRPAA  745

Query  431   SK-----WAKDDHQN-------------SSSMPQQCSIRVSIYRGHP-------ATRRET  327
              +     W++   +              S++   +  + +SI++ +        + R   
Sbjct  746   QEGTDGSWSQSRPRRKTSNFHNSLFGIMSAAQNGEKDLLLSIHQPNGVKGSVVNSARVVI  805

Query  326   QCPEP----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
              CPE     G+L+ LP +  EL+ I  +K G  A  + +  + GA ID I+V+RD D L 
Sbjct  806   SCPEKGETTGKLVVLPGSFQELLDIGAKKFGISA--AKVLSKGGAEIDDIEVVRDGDHLV  863

Query  158   IVAD  147
              V+D
Sbjct  864   FVSD  867



>ref|XP_009396647.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=888

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/853 (42%), Positives = 511/853 (60%), Gaps = 77/853 (9%)
 Frame = -2

Query  2501  SLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL  2322
             +L  LS  ILP LG+        +  ++SP   RY+ WET++++LV Y+AW  PFE  FL
Sbjct  32    NLYNLSSGILPSLGARSTRRVKLRRFIVSPYARRYKAWETYLIVLVVYTAWASPFEFGFL  91

Query  2321  ESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVA  2142
             E +    L +VDN+VD FFAVDIVLTFFVAY+D T+ LLI  RKKIA RYLSTWF++D+A
Sbjct  92    E-RSRGALALVDNVVDAFFAVDIVLTFFVAYVDKTSYLLIDSRKKIAWRYLSTWFVLDLA  150

Query  2141  STIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLL  1962
             ST+P E    +   K  LG  Y    MLR WRLRRVS+ F RLEKD +F+YFWVRCA+L 
Sbjct  151   STVPLEIARRILPRK--LG-SYGFFTMLRLWRLRRVSSLFARLEKDRKFNYFWVRCAKLT  207

Query  1961  FVTLLLVHCAGCLYYFLADRYPHQGKNWLGS----LNVREESLKIRYISAMYWSMTTMTT  1794
              VTL  VH AGC +Y +A RY    + W+G+     +VR  SL +RY++++YWS+TT++T
Sbjct  208   CVTLFAVHSAGCFFYLVAARYHDPSRTWIGASIPDFHVR--SLWVRYVTSLYWSITTLST  265

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH  NT EM F I YMLFNLGLT+Y+IGNMTNLVV GTRRT  +R+SIQAA+ F 
Sbjct  266   VGYGDLHVQNTWEMAFAIVYMLFNLGLTSYLIGNMTNLVVHGTRRTRNYRDSIQAATGFA  325

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL +Q+++++ L+F+  +E L+QQ  ++ LPK I  SI HHLF P+V KVYLF
Sbjct  326   QRNQLPDRLHDQMISHLSLKFRIDSEGLHQQETLDTLPKAIRSSISHHLFYPLVAKVYLF  385

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVS  +L  LV++MKAEY PPREDVI+QNE+P D+YI+V+G +++ID+    EQV    
Sbjct  386   RGVSHNMLFQLVSEMKAEYFPPREDVILQNEAPTDLYIVVTGIMDLIDHRSGAEQVCGVA  445

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GD+ GE+G LCCRPQ+FT RT++L QLL+L  T+ L  +Q    D  T++ N LQ  K
Sbjct  446   KTGDVAGEIGVLCCRPQAFTARTRSLCQLLRLNRTTFLSIVQSNFGDGTTIVNNLLQCLK  505

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
               +D  +  +  EI +    G  ++ + L   V  G+   L++LL+ GLDPN  DS G+T
Sbjct  506   AQEDPVMMRVLREIENMLARGRLDLPLTLCFAVTRGDDLLLHQLLRRGLDPNESDSNGQT  565

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIAASKG+E CV +LL +G + + +D EG+  LW+A+A K  ++  +L    +     
Sbjct  566   ALHIAASKGNENCVHLLLDYGADPNSQDSEGSVPLWEAMAGKHGNVVKLLIENGANLSSG  625

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
               G     AA+ N   +++++++ G  V   +R GSTA+  A+ +  A+++  L+  GA+
Sbjct  626   DMGLFASTAAEQNSLELLEDIIRCGGDVTVPERDGSTALHLAVCQGNAEVVNFLLEQGAD  685

Query  545   IDDAVKLNLAPLDL------------------------------TEVLQKRELGHRIAMP  456
             +D        P +L                              ++++ +R     + +P
Sbjct  686   MDKPDCHGWTPRNLADQKGHAMIKALFEAKRAQNITCMSVSTPVSDLVGRRSGDPAVPLP  745

Query  455   N----------------TILHEA---------ASKWAKDDHQNSSSMPQQCSIRVSIYRG  351
                              T  H +         A++ +     +S ++P+  ++ +    G
Sbjct  746   QLTVGNSTREGSDPTRKTNFHNSLFGVVSAARANRKSDSGFLSSVALPRSAAV-LGGSNG  804

Query  350   HPATRRET-QCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
             H    R T  CPE      +LI LP ++AEL+ +   K GF  T   + +E GA ID + 
Sbjct  805   HNGLLRVTISCPEKANSARKLIPLPGSLAELLDLGRNKFGFLPT--KVLNEGGAEIDDVK  862

Query  185   VIRDNDKLFIVAD  147
             VIRD D L +V+D
Sbjct  863   VIRDGDHLVLVSD  875



>ref|NP_180233.1| potassium channel AKT1 [Arabidopsis thaliana]
 sp|Q38998.2|AKT1_ARATH RecName: Full=Potassium channel AKT1 [Arabidopsis thaliana]
 gb|AAA96810.1| AKT1 [Arabidopsis thaliana]
 emb|CAA44693.1| Potassium tranporter [Arabidopsis thaliana]
 gb|AAB95299.1| K+ transporter, AKT1 [Arabidopsis thaliana]
 dbj|BAH20386.1| AT2G26650 [Arabidopsis thaliana]
 gb|AEC07870.1| potassium channel AKT1 [Arabidopsis thaliana]
Length=857

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/848 (42%), Positives = 497/848 (59%), Gaps = 68/848 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP D +YR WE ++V+LV Y+AWV P
Sbjct  20    RESSHFSL---STGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVVLVVYTAWVSP  76

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T L++  RK+IA +YL +W
Sbjct  77    FEFGFLR-KPRPPLSITDNIVNAFFAIDIIMTFFVGYLDKSTYLIVDDRKQIAFKYLRSW  135

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E  A   + +      Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  136   FLLDLVSTIPSE-AAMRISSQ-----SYGLFNMLRLWRLRRVGALFARLEKDRNFNYFWV  189

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R  +  K W+G+   N  EESL +RY+++MYWS+T
Sbjct  190   RCAKLVCVTLFAVHCAACFYYLIAARNSNPAKTWIGANVANFLEESLWMRYVTSMYWSIT  249

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  250   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  309

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  310   SNFAHRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  369

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++D +   E +
Sbjct  370   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVDVDTGTESI  429

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  430   VREVKAGDIIGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  489

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K++ D  + ++ +EI +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  490   QHLKEMNDPVMTNVLLEIENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDN  549

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL++  + + +D EG+  LW+A+      +  +L    S 
Sbjct  550   NGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVLLEHGST  609

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+  +  +++E++ HG  V      G++A+  A+ E   +M+K L+ 
Sbjct  610   IDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLE  669

Query  557   NGAEIDDAVKLNLAPLDLTE-----------------------------VLQK--RELGH  471
              GA+++        P DL E                             +L+   R LG 
Sbjct  670   QGADVNKQDMHGWTPRDLAEQQGHEDIKALFREKLHERRVHIETSSSVPILKTGIRFLGR  729

Query  470   RIAMPNT---------ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSIYRGHPAT  339
               + PN           + E  ++   ++  NS        S+P+     V   R     
Sbjct  730   FTSEPNIRPASREVSFRIRETRARRKTNNFDNSLFGILANQSVPKNGLATVDEGRTGNPV  789

Query  338   RRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDN  171
             R    C E     G+L+ LP +  EL+ +   K G  AT   +  +  A ID +DVIRD 
Sbjct  790   RVTISCAEKDDIAGKLVLLPGSFKELLELGSNKFGIVAT-KVMNKDNNAEIDDVDVIRDG  848

Query  170   DKLFIVAD  147
             D L    D
Sbjct  849   DHLIFATD  856



>ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus communis]
 gb|EEF33040.1| Potassium channel AKT1, putative [Ricinus communis]
Length=901

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/861 (42%), Positives = 507/861 (59%), Gaps = 77/861 (9%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   L+  +LP LG+        +  +ISP D RYR W+T++VLLV Y+AWV P
Sbjct  22    QLSRDGSQYSLTNAVLPSLGARSNRRVKLRTFIISPYDRRYRIWQTYLVLLVVYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FLE K +  L + DN+V+ FFAVDI+LTFFVAY+D +T LL+   K+IA +Y S+W
Sbjct  82    FEFGFLE-KPEGPLSITDNVVNGFFAVDILLTFFVAYLDHSTYLLVDDPKRIAWKYTSSW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV STIP E    +          Y    MLR WRLRRVS  F+RLEKD  ++YFWV
Sbjct  141   LAFDVISTIPSELARKISPKPFQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSM  1809
             RCA+L+ VTL  VH AGC YY +A RY + G+ W+G     N  E+SL IRY++++YWS+
Sbjct  198   RCAKLICVTLFAVHSAGCFYYLIAARYHNPGRTWIGQSLGDNFLEQSLWIRYVTSIYWSI  257

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQA
Sbjct  258   TTLTTVGYGDLHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQA  317

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +++
Sbjct  318   ASSFAQRNQLPLRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLLD  377

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             KVYLF GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQ
Sbjct  378   KVYLFSGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVYKNGAEQ  437

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N 
Sbjct  438   VVGQAKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANIGDGTIIMNNL  497

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             LQH K+ KD  +  + +E  +    G  ++ ++L      G+ + L++LLK GLDPN  D
Sbjct  498   LQHLKEQKDPIMEGVLVETENTLARGRLDLPLSLCFAALRGDDSLLHQLLKRGLDPNESD  557

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
             + G++ LHIAASKG E CV+VLL +G + + KD EGN  LW+A+      +  +L    +
Sbjct  558   NTGRSALHIAASKGSENCVLVLLDYGADPNSKDSEGNVPLWEAMVGGHEGVTKLLMENGA  617

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
                    G   C AA+ N+ ++++E+ + G  V    ++G+TA+  A+ E+  ++++ L+
Sbjct  618   NIQSGDVGHFACTAAEQNNLNLLKEIARLGGDVTCPRKNGTTALHVAVCEDNTEIVRYLL  677

Query  560   MNGAEIDDAVKLNLAPLDLTE------------------------VLQK------RELGH  471
               GA+ID        P DL +                        + +K      R LG 
Sbjct  678   DQGAKIDKPDIHGWTPRDLADQQGHEEIKFIFETCKEPKTETVVSIPEKPQPPGIRFLGR  737

Query  470   RIAMPNT-ILHEAASKWAKDDHQNSSSMPQQ----------------------------C  378
               + PN   L    S    DD   S + P++                             
Sbjct  738   FTSEPNIRPLSRDGSFTGTDDRSWSQNRPRRRTNNFHNSLFGMMSAAHKGEKELPFPVTP  797

Query  377   SIRVSIYRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEE  210
             SI V  Y  +PA R    CPE     G+L+ LP  + EL+ I  +K G   + + + +++
Sbjct  798   SIGVDNYGTNPA-RVVISCPEKVEIAGKLVLLPRNLQELVEIGSKKFGL--SHAKVLNKD  854

Query  209   GAIIDSIDVIRDNDKLFIVAD  147
              A ID I+VIRD D +  V+D
Sbjct  855   RAEIDDIEVIRDGDHILFVSD  875



>ref|XP_008464998.1| PREDICTED: potassium channel AKT1 isoform X1 [Cucumis melo]
Length=873

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/856 (43%), Positives = 503/856 (59%), Gaps = 73/856 (9%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   L+  ILP LG+        +  +ISP D RYR WET++V+LV Y+AWV P
Sbjct  22    QLSRDGSQYSLTTGILPSLGARSNRRVKLRRFIISPYDRRYRIWETFLVVLVVYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K  + L V DN+V+ FFAVDIVLTFFVAY+D TT LL+   KKIA +Y  TW
Sbjct  82    FEFGFLK-KPQSPLSVTDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDEPKKIALKYARTW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV STIP E    +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWV
Sbjct  141   LIFDVISTIPSELAQKISPPPLR---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY LA RY      W+G+   N  ++SL IRY++++YWS+T
Sbjct  198   RCAKLICVTLFAVHCAACFYYLLAARYHDPKNTWIGASMENFLDQSLWIRYVTSIYWSIT  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAA
Sbjct  258   TLTTVGYGDLHPVNTREMVFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+K
Sbjct  318   SSFAHRNQLPLRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV
Sbjct  378   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQV  437

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N L
Sbjct  438   VGEAKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQSNVGDGTIIMNNLL  497

Query  1091  QHHkklkdlklgdLFIEIGDED----GDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             QH K LKD       + +  E+    G  ++ ++L      G+   L++LLK GLDPN  
Sbjct  498   QHLKDLKDKDPIMEGVLLETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNES  557

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D+ G+T LHIAAS G+E CV++LL +G + + +D +G   LW+AI     ++  +L    
Sbjct  558   DNSGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWEAILGGHEAVAQLLMDNG  617

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +       G   C AA+ N+  +++E+ ++G  V S   +G+TA+  A+ E+  +++K L
Sbjct  618   ANLRSGDVGHFACTAAEQNNLQLLKEIHRYGGDVTSARNNGTTALHVAVCEDNIEIVKFL  677

Query  563   VMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ-------  405
             +  GA+ID        P DL +  Q+   G +     T   ++ S  A  + Q       
Sbjct  678   LKQGADIDKPDVHGWTPRDLAD--QQGHEGIKNLFQTTKESKSQSVVAIPEKQTGIRFLG  735

Query  404   --NSSSM--PQQCSIRVSIYRGHPATRRETQ-----------------------------  324
                S  M  PQ        + GH   RR T                              
Sbjct  736   RFTSEPMIRPQPQEANDGSWPGHSRPRRRTNNFHNSLFGIMSAAQSGEKGIPFPDNQTSL  795

Query  323   -------------CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
                          CPE     G+L+ LPE+  EL+ I  +K G  AT   + +++GA I+
Sbjct  796   ENSGTNPARVIVSCPEIGEVGGKLVLLPESYNELLEIGLKKYGIMAT--KVLNKDGAAIE  853

Query  194   SIDVIRDNDKLFIVAD  147
              I+VIRD D L  V+D
Sbjct  854   DIEVIRDGDHLVFVSD  869



>ref|XP_004149890.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus]
 gb|KGN65294.1| hypothetical protein Csa_1G303700 [Cucumis sativus]
Length=873

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/857 (42%), Positives = 499/857 (58%), Gaps = 75/857 (9%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   L+  ILP LG+        +  +ISP D RYR WET++V+LV Y+AWV P
Sbjct  22    QLSRDGSQYSLTTGILPSLGARSNRRVKLRRFIISPYDRRYRIWETFLVVLVVYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K  + L V DN+V+ FFAVDIVLTFFVAY+D TT LL+   KKIA +Y  TW
Sbjct  82    FEFGFLK-KPQSPLSVTDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDEPKKIALKYARTW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV STIP E    +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWV
Sbjct  141   LIFDVISTIPSELAQKISPSPLR---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY LA RY      W+G+   N  EESL IRY++++YWS+T
Sbjct  198   RCAKLICVTLFAVHCAACFYYLLAARYRDPKNTWIGASMENFLEESLWIRYVTSIYWSIT  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAA
Sbjct  258   TLTTVGYGDLHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+K
Sbjct  318   SSFAHRNQLPLRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQ 
Sbjct  378   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQP  437

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N L
Sbjct  438   VGEAKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQSNVGDGTIIMNNLL  497

Query  1091  QHHkklkdlklgdLFIEIGDED----GDPNMSINLFTVVATGNATFLNELLKAGLDPNIG  924
             QH K LKD       + +  E+    G  ++ ++L      G+   L++LLK GLDPN  
Sbjct  498   QHLKDLKDKDPIMEGVLLETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNES  557

Query  923   DSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWA  744
             D+ G+T LHIAAS G+E CV++LL +G + + +D +G   LWDAI     ++  +L    
Sbjct  558   DNTGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWDAILGGHEAVAQLLIDNG  617

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             +       G   C AA+ N   +++E+ ++G  V S   +G+TA+  A+ E+  +++K L
Sbjct  618   ANLRSGDVGHFACTAAEQNKLQLLKEIHRYGGDVTSARNNGTTALHVAVCEDNIEIVKFL  677

Query  563   VMNGAEIDDAVKLNLAPLDLT------------EVLQKRELGHRIAMPNTILHEAASKWA  420
             +  GA+ID        P DL             + +++ +    +A+P     +   ++ 
Sbjct  678   LKQGADIDKPDVHGWTPRDLADQQGHEEIKNLFQTIKESKTQSVVAIPE---KQTGIRFL  734

Query  419   KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ----------------------------  324
                       PQ        + GH   RR T                             
Sbjct  735   GRFTSEPMIRPQPQEANDGSWPGHSRPRRRTNNFHNSLFGIMSAAQSGENGNPFPDSQTS  794

Query  323   --------------CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
                           CPE     G+L+ LPE+  EL+ I  +K G  AT   + +++GA I
Sbjct  795   LENSGTNPARVIVSCPEIGEVGGKLVLLPESYNELLEIGLKKYGIMAT--KVLNKDGAAI  852

Query  197   DSIDVIRDNDKLFIVAD  147
             + I+VIRD D L  V+D
Sbjct  853   EDIEVIRDGDHLVFVSD  869



>ref|XP_004969311.1| PREDICTED: potassium channel AKT1-like [Setaria italica]
Length=885

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/858 (42%), Positives = 508/858 (59%), Gaps = 81/858 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE 
Sbjct  25    RDGSHYSISSGILPSLGARSNRSIKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEF  84

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L +VDN+V+  FAVDI+LTFFVAY+D  T LL    KKIA RY +TWF++
Sbjct  85    GFIR-KPTGGLAIVDNVVNAIFAVDIILTFFVAYLDRLTYLLEDDPKKIAWRYATTWFVL  143

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  144   DVASTIPTELARKILPPNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  200

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHC+ C YY LADRYP     W+G+   +    SL IRY+++MYWS+TT+T
Sbjct  201   KLICVTLFAVHCSACFYYLLADRYPDPSDTWIGNSMPDFHHRSLWIRYVTSMYWSITTLT  260

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  261   TVGYGDLHAENTREMVFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  320

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP+RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYL
Sbjct  321   ALRNQLPSRLQDQMISHLSLKFRTDSEGLQQQETLDTLPKAIRSSISQYLFFNLVQKVYL  380

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V+G  E+I+ +   EQV   
Sbjct  381   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVTGSAELIELQNGAEQVAGV  440

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--  1089
               SGD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N +Q  
Sbjct  441   AKSGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLNIVQSNVGDGTIIMNNLIQLL  500

Query  1088  -HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                K    +      IE     G  ++ I L   V  G+   L++LLK G DPN  D+ G
Sbjct  501   KEQKDNSVMVGVLKEIENMLARGHLDLPITLCFAVTRGDDLLLHQLLKRGFDPNESDNNG  560

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASIS  735
              T LHIAASKG+E+CV +LL HG + + +D +G   LW+A+  K  ++  +L  + A +S
Sbjct  561   HTALHIAASKGNEQCVKLLLDHGADPNARDDQGKVPLWEALCEKHAAVVELLVENGADLS  620

Query  734   DPYVAGD---LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
                 +GD     C A + N + ++++++++G  ++   R G+T +  A+ +    M++LL
Sbjct  621   ----SGDTALYACVAVEDNKTELLKDIIRYGGDINRSTRDGTTPLHRAVCDGNVQMVELL  676

Query  563   VMNGAEIDDAVKLNLAPLDLT--------EVLQKREL----GHRI---------------  465
             + +GA+ID       +P DL         +VL K +      HR+               
Sbjct  677   LEHGADIDKQDSNGWSPRDLAVQQGHDDIQVLFKNKSRVAPSHRVSNSRVAPMLIGRFNS  736

Query  464   --AMPNTILHEAASKWAKDDHQN----------------SSSMPQQCSIRV----SIYRG  351
               AMPN + HE A   +K   Q                 SS+   Q + R+        G
Sbjct  737   EPAMPN-VDHEDAELCSKVVPQRLLRKRVTFQNSLFGVISSTHAHQDTGRMLSRDLAATG  795

Query  350   HPATRRET------QCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
              P+ R  +       CPE G    +L+ LP ++ EL+ +  +K GF  T   +   EGA 
Sbjct  796   GPSCRHNSLVRVTLSCPEKGDTARKLVLLPRSMKELLELGAKKFGFMPT--KVQTVEGAE  853

Query  200   IDSIDVIRDNDKLFIVAD  147
             ID +++IRD D + +V+D
Sbjct  854   IDEVELIRDGDHIVLVSD  871



>gb|AIB06354.1| potassium channel [Saccharum hybrid cultivar]
Length=885

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/852 (41%), Positives = 503/852 (59%), Gaps = 71/852 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSISSGILPSLGARSNRRVKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++
Sbjct  87    GFIR-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  146   DVASTIPSEFARKILPPNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHC+ C YY LADRYP     W+G+   +  +  L IRY+ ++YWS+TT+T
Sbjct  203   KLICVTLFAVHCSACFYYLLADRYPVPTDTWIGNSMPDFHQRGLWIRYVVSVYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  263   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYL
Sbjct  323   ALRNQLPGRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISQYLFFNLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+++G  E+I+     EQ+   
Sbjct  383   FEGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILITGSAELIELRNGGEQIAGV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--  1089
               +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N +Q  
Sbjct  443   AKAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLMQLL  502

Query  1088  -HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                K    +      IE     G  ++ + L   V  G+   L++LLK GLDPN  D+ G
Sbjct  503   KEQKDNSVMVGVLKEIENMLARGHLDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG E+CV +LL +G + + +D EG   LW+A+  K +++  +L    +   
Sbjct  563   HTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELLVESGAELS  622

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                     C A + ND+ +++ ++++G +++S  + G+T +  A+ +    M++LL+ +G
Sbjct  623   SGDTALYACIAVEENDAELLENIIRYGGNINSSTKDGTTPLHRAVCDGNVQMVELLLEHG  682

Query  551   AEIDDAVKLNLAPLDLT--------EVLQKRELGHR-------------------IAMPN  453
             A+ID     + +  DL         +VL K    HR                    +MPN
Sbjct  683   ADIDKQDNNSWSARDLADQQGHDDIQVLFKSRKAHRQHASSGRVAPMLIGRFNSEPSMPN  742

Query  452   TILHEAASKWAKDDHQN----------------SSSMPQQCSIRVS----IYRGHPATRR  333
              + HE A   +K   Q                 SSS  +Q + R+        G P+ R 
Sbjct  743   -MNHEDAEVRSKVVPQKLLRKRVSFQNSLFGVISSSQARQDTGRLVSKGLAGTGGPSCRH  801

Query  332   ET------QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             ++       CPE     G+L++LP ++ EL+ +  +K GF    + +    GA ID +++
Sbjct  802   DSLIRVTISCPEKGNAAGKLVRLPRSMTELLELGAKKFGFKP--AKVLTIGGAEIDEVEL  859

Query  182   IRDNDKLFIVAD  147
             IRD D + +V+D
Sbjct  860   IRDGDHILLVSD  871



>ref|XP_006293431.1| hypothetical protein CARUB_v10025578mg [Capsella rubella]
 gb|EOA26329.1| hypothetical protein CARUB_v10025578mg [Capsella rubella]
Length=862

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/848 (41%), Positives = 495/848 (58%), Gaps = 68/848 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   +  ILP LG+        +  V+SP D +YR WE ++V+LV Y+AWV P
Sbjct  22    RESSHFSL---TTGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAYLVVLVVYTAWVSP  78

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T L++  RK IA +YL +W
Sbjct  79    FEFGFLR-KPRPPLSITDNIVNAFFAMDIIMTFFVGYLDKSTYLIVDDRKLIAFKYLRSW  137

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E VA   + +      Y +  MLR WRLRRVS+ F RLEKD  F+YFWV
Sbjct  138   FLLDLVSTIPSE-VAMRISSQ-----SYGLFNMLRLWRLRRVSSLFARLEKDRNFNYFWV  191

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R     + W+G+ N    EES+ +RY+++MYWS+T
Sbjct  192   RCAKLVCVTLFAVHCAACFYYLIAARNHDPLQTWIGASNKNFLEESIWMRYVTSMYWSIT  251

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  252   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  311

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  312   SNFAHRNHLPVRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  371

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++D +   E V
Sbjct  372   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLMDVDSSTETV  431

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  432   VKEVKAGDIIGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  491

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K + D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  492   QHLKDMNDPVMLNVLMETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDN  551

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL+   + + +D EG+  LW+A+      +  +L    S 
Sbjct  552   NGRTPLHIAASKGSLNCVLLLLEFNADPNCRDAEGSVPLWEAMVEGHEKVVKLLLEHGST  611

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+  +  +++E++ HG  V      G++A+  A+ E   +M+K L+ 
Sbjct  612   IDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLE  671

Query  557   NGAEIDDAVKLNLAPLDLTE-----------------------------VLQ--KRELGH  471
              GA+++          DL E                             +L+   R LG 
Sbjct  672   QGADVNKQDMHGWTARDLAEQQGHEDIKALFRERLHERRVYIETSSSVPILKNGNRRLGR  731

Query  470   RIAMPNT---------ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSIYRGHPAT  339
               + PN           + E  ++   ++  NS        S+ +     V   R     
Sbjct  732   FTSEPNIRPASREVSFRIRETRARRKNNNFDNSLFGVLANQSVAKNGLATVHESRTGNPV  791

Query  338   RRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDN  171
             R    C E     G+L+ LP +  EL+ +   K G  AT   ++ +  A ID +DVIRD 
Sbjct  792   RVTISCAEKDEVAGKLVLLPTSFQELLELGSNKFGIVAT-KVMSKDNKAEIDDVDVIRDG  850

Query  170   DKLFIVAD  147
             D L   +D
Sbjct  851   DHLIFASD  858



>emb|CBI20997.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/855 (42%), Positives = 499/855 (58%), Gaps = 74/855 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             +D S   ++  ILP LG+      + +  ++SP D+RYR WET++V LV Y+AWV PFE 
Sbjct  31    DDASHFSVTSAILPSLGARSNRRINLRRFIVSPFDARYRLWETYLVFLVFYTAWVSPFEF  90

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FLE      L + DN+V+ FFA+DI+LTFFVAY+D +T LL+ + K IA RY  TW   
Sbjct  91    GFLEEP-KGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRYTKTWLAF  149

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  150   DVISTIPSELARKILPKPLK---EYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWVRCA  206

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY L  ++    K WLG +  ++   SL  RY+++MYWS+TT+T
Sbjct  207   KLICVTLFAVHCAGCFYYLLGSQHGDPKKTWLGLVMGDLNTHSLWQRYVTSMYWSITTLT  266

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             T GYGDLHAVNT EM+F IFYMLFNLGLT+Y+IGNMTNLVV GT RT +FR+SIQAAS+F
Sbjct  267   TTGYGDLHAVNTREMVFDIFYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDSIQAASSF  326

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++ LR +  +E L QQ  +E LPK I  SI H+LF  +V+KVYL
Sbjct  327   ALRNQLPVRLQDQMLAHLSLRHRTNSEGLQQQETLEVLPKAIRSSISHYLFYSLVDKVYL  386

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MK EY PP+ED+I+QNE+P D+Y++V+G VE+I+     EQVV  
Sbjct  387   FRGVSNDLLFQLVSEMKPEYFPPKEDIILQNEAPTDLYVLVTGVVELIERRNAIEQVVGE  446

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             + +GD+ GE+G LC RPQ FT RTK L QLL+L  T+LL  +Q    D   +I N LQH 
Sbjct  447   IRTGDVCGEIGVLCYRPQLFTARTKRLCQLLRLNRTALLNLVQANVGDGAIIINNLLQHL  506

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K+ K+  +  +  +I      G   + ++L   V  G+   L++LLK GLDPN  DS G+
Sbjct  507   KEHKNPVMEGVLADIESMLAQGRMELPLSLCFAVLRGDDLLLHQLLKRGLDPNELDSNGR  566

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             TPLHIAASKG E+C  +LL++G N + KD EG   LWDAI  ++ S+  +L    +    
Sbjct  567   TPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLLMDNGAKIPL  626

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                G   C A + ND  ++++L++ G  V      G+TA+ AA  E   +++K L+  GA
Sbjct  627   SNVGQYACTAVERNDLDLLKDLVRFGGDVTHPSSSGTTALHAATSEANIEIVKFLLDQGA  686

Query  548   EIDDAVKLNLAPLDLTE--------VL--QKRELGHRIAMPNT-----------------  450
             ++D        P  L +        VL   KRE      +P T                 
Sbjct  687   DVDKLDNDGWTPRTLADQQGHEEIKVLFQTKRETKKLTPVPATKKPGVPFLGKFKSDSYL  746

Query  449   --ILHEAAS-----KWAKDDHQ-------NSSSMPQQCSIRVSIYRG-------------  351
                 H+  S      W  D+         N+S      S+     +G             
Sbjct  747   QPFQHDRESTGLEVSWIDDNRPRRRVNNFNNSLFGIMSSVNTRERKGFIRSAASFATSPR  806

Query  350   ---HPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                 PA R    CPE     G+L+ LP+++ EL+ I  +K  F  T   +  +EGA ++ 
Sbjct  807   QRDFPA-RVTLSCPEKGEVAGKLVPLPQSLQELLDIGAKKFKFSPT--KVVTKEGAEVED  863

Query  191   IDVIRDNDKLFIVAD  147
             I++IRD D L +V++
Sbjct  864   IELIRDGDHLILVSE  878



>gb|AFW83425.1| potassium channel [Zea mays]
Length=887

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/857 (41%), Positives = 505/857 (59%), Gaps = 81/857 (9%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE  
Sbjct  28    DGSHYSISSGILPSLGARSNRRVKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEFG  87

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++ K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++D
Sbjct  88    FIQ-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVLD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+
Sbjct  147   VASTIPSEFARKILPPDLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCAK  203

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHC+ C YY LAD YP     W+G+   +  +  L IRY+ ++YWS+TT+TT
Sbjct  204   LICVTLFAVHCSACFYYLLADMYPTPTDTWIGNSMPDFHQRGLWIRYVVSVYWSITTLTT  263

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F 
Sbjct  264   VGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSFA  323

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP+RL++Q+++++CL+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYLF
Sbjct  324   LRNQLPSRLQDQMISHLCLKFRTDSEGLQQQETLDVLPKAIRSSISQYLFFNLVQKVYLF  383

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V+G  E+I+ +   EQ+V   
Sbjct  384   EGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVTGSAELIELQNGGEQMVGVA  443

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF---LQ  1089
              +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N    L+
Sbjct  444   KAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLIRLLK  503

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
                    +      IE     G  ++ + L   V  G+   L++LLK GLDPN  D+ G 
Sbjct  504   QQNDNSVMMGVLKEIENMLARGRLDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNGH  563

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH-WASISD  732
             T LHIAASKG E+CV +LL+HG + + +D EG   LW+A+  K++ +  +L    A +S 
Sbjct  564   TALHIAASKGDEQCVKLLLEHGADPNARDSEGKVPLWEALCEKQNPVVELLVQSGAGLSS  623

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
               VA    C A + ND  +++ ++++G +V+S  + G+T +  A+ +    M++LL+ +G
Sbjct  624   GDVA-LYACVAVEENDPELLENIIRYGGNVNSSMKDGTTPLHRAVCDGNVQMVELLLEHG  682

Query  551   AEIDD----------------------------------AVKLNLAPLDL----------  504
             A+ID                                   A K  +AP+ +          
Sbjct  683   ADIDKQDNNGWSARALADQQGHDDIQSLFRSRKAHRQQHASKGRVAPVPIWRFNSEPTMP  742

Query  503   -----------TEVLQKRELGHRIAMPNTILHEAASKWAKDDHQN--SSSMPQQCSIRVS  363
                         +V+ ++ L  R++  N++    +S  A+ D     S  +    S   S
Sbjct  743   KMKHEEDAELRGKVVPQKLLRKRVSFQNSLFGVISSSHARQDTGRLLSKGLAGTGSPGCS  802

Query  362   IYRGHPATRRET-QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
                 H +  R T  CPE     G+L+ LP ++ EL+ +   K GF  T    T   GA I
Sbjct  803   ----HGSLVRVTIGCPEKGNAAGKLVLLPRSMTELLELGARKFGFKPTKVLTTG--GAEI  856

Query  197   DSIDVIRDNDKLFIVAD  147
             D +++IRD D + +V+D
Sbjct  857   DEVELIRDGDHVVLVSD  873



>emb|CDP04802.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/840 (43%), Positives = 493/840 (59%), Gaps = 73/840 (9%)
 Frame = -2

Query  2474  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  2295
             LP LG+        +  +ISP D RYR W+T++V LV Y+AWV PFE  FL+      L 
Sbjct  50    LPSLGAHSNKRPKLRRCIISPFDPRYRVWDTFLVFLVFYTAWVSPFEFGFLDEP-SIALS  108

Query  2294  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  2115
             + DN+V+ FFA+DI+LTFFVAY+D  T LL+ + K+IA RY  TW L DV STIP E   
Sbjct  109   ITDNVVNGFFAIDIILTFFVAYLDKATYLLVDNPKQIAWRYTRTWLLFDVISTIPSELAR  168

Query  2114  FLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHC  1935
              +          Y    MLR WRLRRVS  F RLEKD  FSYFWVRCA+L+ VTL  VHC
Sbjct  169   KVLPKPLKQ---YGYFNMLRLWRLRRVSKMFARLEKDRNFSYFWVRCAKLICVTLFAVHC  225

Query  1934  AGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTL  1758
             AGC Y+ LA  Y      W+G + N  E+SL + YI++MYWS+TT+TT GYGDLHAVN+ 
Sbjct  226   AGCFYFLLAAHYHDPKNTWIGLMENFDEQSLWVHYITSMYWSITTLTTTGYGDLHAVNSR  285

Query  1757  EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQ  1578
             E +F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP RL++Q
Sbjct  286   EKLFDIFYMLFNLGLTAYLIGNMTNLVVHGTGRTRKFRDTIQAASSFAQRNQLPPRLQDQ  345

Query  1577  ILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             +LA++CLR++  +E L QQ  ++ LPK I  SI H+LF  +V+KVYLF GVS ++L  LV
Sbjct  346   MLAHLCLRYRTDSEGLQQQETLDVLPKAIRSSISHYLFYSLVDKVYLFHGVSNDLLFQLV  405

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             ++MKAEY  PREDVI+QNE+P D+YI+V+G VE+I      EQVV  L +GD+ GE+G L
Sbjct  406   SEMKAEYFAPREDVILQNEAPTDLYILVTGAVELIVLRNGIEQVVGQLKTGDVCGEIGVL  465

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             C RPQ FT RTK LSQLL+L  T  L  +Q    D   ++ N LQH K   D     +  
Sbjct  466   CYRPQVFTVRTKRLSQLLRLNRTDFLNIVQASVGDGTIIMNNLLQHLKDQMDPFTDSILA  525

Query  1043  EIGDEDGDPNMSI--NLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEE  870
             E     G   M +  +L    A G+   L++LL+ G DPN  DS G+T LHI ASKG  E
Sbjct  526   ETEHMLGQGRMEVPLSLCFAAARGDDLLLHQLLRRGTDPNELDSSGRTALHIGASKGSLE  585

Query  869   CVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAK  693
             CV++LL +G + + KD +GN  LWDAI  K  ++  +L  + A+IS   V G   C A +
Sbjct  586   CVLLLLDYGADPNRKDSDGNVPLWDAILNKHEAVIKLLIDNGANISSGDVGG-FACFAVE  644

Query  692   MNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAP  513
              N+  ++++++K+G  V   +  G+TA+  A+ E+ A+M+K L+  GA++D        P
Sbjct  645   QNNLELLKDIIKYGGDVTLLNSLGTTALHTAISEDNAEMVKFLIEQGADVDKPDVHGWTP  704

Query  512   LDLTE---------VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMP---------  387
               L +         +LQ ++   R  + ++   +A S   K  +Q+  ++P         
Sbjct  705   RALADYQANEGIKLLLQNQKKSTRQPVASSPQMQAVSYLKK--YQSEPTLPPLTPEVAVS  762

Query  386   -------------QQCSIRVSIYRGHPATRRETQ-----------------------CPE  315
                          +  + R S++    A  R  +                       C E
Sbjct  763   VTEADTSRNRLKRRASNFRNSLFGIMSAANRPNEGGKSIAASPINVNTLNHARVTISCRE  822

Query  314   PG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              G    RL+ LPE+I EL+ I  +K GF  T   +  ++GA+++ I V+RD D L +  D
Sbjct  823   RGCDICRLVLLPESIQELLDIGAKKFGFCPT--RVFTKDGALVEDIAVVRDGDHLILAGD  880



>ref|XP_006646148.1| PREDICTED: potassium channel AKT1-like [Oryza brachyantha]
Length=890

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/861 (40%), Positives = 511/861 (59%), Gaps = 76/861 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  29    RDGSHYSISSAILPSLGARSNRRIKLRRFIISPYDRRYRFWETYLIVLVVYSAWVSPFEF  88

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L   DN+V+ FFAVDIVLTFFVAY+D  + +L    KKIA RY +TW ++
Sbjct  89    GFIR-KPTGALATADNVVNAFFAVDIVLTFFVAYLDKMSYMLEDDPKKIAWRYCTTWLVL  147

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA
Sbjct  148   DVASTIPSEFARRILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCA  204

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+T
Sbjct  205   KLICVTLFAVHCAACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLT  264

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  265   TVGYGDLHAENTREMVFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  324

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYL
Sbjct  325   GVRNQLPPRLQDQMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYL  384

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++++  +EQV+  
Sbjct  385   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEHQNGSEQVIQV  444

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FL  1092
               SGD+ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL
Sbjct  445   SKSGDVVGEIGVLCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFL  504

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +  K    +      IE     G  ++ I L   V  G+   L++LLK GLDPN  D+ G
Sbjct  505   KEQKDNNVMAGVVKEIESMLARGHLDLPITLCFAVTRGDDFLLHQLLKRGLDPNESDNDG  564

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +   
Sbjct  565   HTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLS  624

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + +++ ++ +++ +G  V+   R G+TA+  A+ +    M++LL+ +G
Sbjct  625   SGDTGLYACIAVEESNAELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMVELLLEHG  684

Query  551   AEIDDAVKLNLAPLDLTE---------VLQKRELG--HRIAMPNTILHEAASKWAKDD--  411
             A++D        P  L +         + + R+    H +  P +    A     + +  
Sbjct  685   ADVDKRDGNGWTPRALADQQGHDDIQLLFRSRKAPSHHHVVPPGSTAKAAPPLIGRFNSE  744

Query  410   -------HQNSSSMP----------QQCSIRVSIY----------------------RGH  348
                    H++++ +P          ++ + + S++                       G 
Sbjct  745   PAMKNMIHEDAADLPSRVLPEKLRRKRVTFQNSLFGVISSSQAQRETDHPIPTGLPTAGS  804

Query  347   PATRRET------QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
             P+  R +       CPE     G+L+ LP+T+  L+ +  +K  FD   + +   EGA +
Sbjct  805   PSGSRNSVIRVTISCPEKGNTAGKLVLLPQTLDMLLELGAKK--FDFAPTKVLTVEGAEV  862

Query  197   DSIDVIRDNDKLFIVA-DWNS  138
             D +++IRD D L +V+ DW++
Sbjct  863   DEVELIRDGDHLVLVSDDWDA  883



>gb|KFK41169.1| hypothetical protein AALP_AA2G094700 [Arabis alpina]
Length=857

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/847 (41%), Positives = 491/847 (58%), Gaps = 66/847 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  +ISP D +YR WE ++V+LV Y+AW  P
Sbjct  17    RESSHFSL---STGILPSLGARSNRRVKLKRFIISPYDHKYRIWEAFLVVLVVYTAWASP  73

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL SK    L + DNIV+  FA+DI++TFFV Y+D +T LL+  R  IA +YL +W
Sbjct  74    FEFGFL-SKPRPPLSITDNIVNAIFAIDIIMTFFVGYLDKSTYLLVDDRNMIAYKYLRSW  132

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+DV STIP E    + T        Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  133   FLLDVISTIPSEVAMKISTQS------YGLFNMLRLWRLRRVGALFARLEKDRNFNYFWV  186

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLN--VREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R+    K W+G+ N    EESL +RY+++MYWS+T
Sbjct  187   RCAKLVCVTLFAVHCAACFYYLIAARHHDPVKTWIGASNHNFLEESLWMRYVTSMYWSIT  246

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  247   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  306

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  307   SNFARRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYALMDK  366

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++ ++   E V
Sbjct  367   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLMVHDNGTETV  426

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +G++ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  427   VQEVKAGNIIGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGAIIMNNLL  486

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K++ D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  487   QHLKEMNDPVMENVLLETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNDSDN  546

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL++  + + +D EGN  LW+A+      +  +L    + 
Sbjct  547   NGRTPLHIAASKGSVNCVLLLLEYHADPNCRDAEGNVPLWEAMVEGHEKVVKVLMESGAT  606

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+ N+  +++E+++ G  +      G++A+  A+ E   +M+K L+ 
Sbjct  607   IDAGDVGHFACTAAEQNNMKLLKEIVRLGGDITRPRATGTSALHTAVCEENIEMVKYLLE  666

Query  557   NGAEIDDAVKLNLAPLDLTE----------------------------VLQK--RELGHR  468
              GA+++        P DL E                            +L+   R LG  
Sbjct  667   QGADVNKQDMHGWTPRDLAEQQGHEDIKALFREKRHERAHIESSASVPILKTGIRFLGRF  726

Query  467   IAMPNT---------ILHEAASKWAKDDHQNS-----SSMPQQCSIRVSIYRGHPAT--R  336
              + PN           + E   +   ++  NS     +S     +   ++  G      R
Sbjct  727   TSEPNIRPPSREVSFRIPETRPRRKTNNFDNSLFGILASQSVNKNRLATVDEGGTGNPVR  786

Query  335   RETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDND  168
                 CPE      +L+ LP +  EL+ +   K G  AT     D   A ID +DVIRD D
Sbjct  787   VTISCPEKDEVTEKLVLLPGSFKELLELGSNKFGIVATKVMSKDNNNAEIDGVDVIRDGD  846

Query  167   KLFIVAD  147
              L    D
Sbjct  847   HLIFATD  853



>ref|XP_010417806.1| PREDICTED: potassium channel AKT1 [Camelina sativa]
Length=864

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/849 (41%), Positives = 493/849 (58%), Gaps = 69/849 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP D +YR WE ++V+LV Y++WV P
Sbjct  23    RESSHFSL---STGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVVLVVYTSWVSP  79

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T L++  RK IA +YL +W
Sbjct  80    FEFGFLR-KPRPPLSITDNIVNAFFAMDIIMTFFVGYLDKSTYLIVDDRKLIAFKYLRSW  138

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E  A   + +      Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  139   FLLDLVSTIPSE-AAMKISSQ-----SYGLFNMLRLWRLRRVGALFARLEKDRNFNYFWV  192

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R     K W+G+ N    EESL +RY+++MYWS+T
Sbjct  193   RCAKLVCVTLFAVHCAACFYYLIAARNHDPAKTWIGASNKNFLEESLWMRYVTSMYWSIT  252

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  253   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  312

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  313   SNFAHRNHLPVRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  372

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
              YLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  ++ID +   E +
Sbjct  373   AYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLIDVDSGTETI  432

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  433   VKEVKAGDIVGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  492

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             Q+ K + D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  493   QYLKDMNDPVMTNVLLETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDN  552

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL++  + + +D EG+  LW+A+      +  +L    S 
Sbjct  553   NGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVLLENGSS  612

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+  +  +++E++ HG  V      G++A+  A+ E   +M+K L+ 
Sbjct  613   IDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLD  672

Query  557   NGAEIDDAVKLNLAPLDLTE-----------------------------VLQK--RELGH  471
              GA+++          DL E                             +L+   R LG 
Sbjct  673   QGADVNKQDMHGWTARDLAEQQGHEDIKALFREKLHQRRVHIETSSSVPILKSGIRFLGR  732

Query  470   RIAMPNT----------ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSIYRGHPA  342
               + PN            + E  ++   ++  NS        S+P+     V   R    
Sbjct  733   FTSEPNIRPAASREVSFRVRETRARRKTNNFDNSLFGILANQSVPKNGLATVDEGRTGNP  792

Query  341   TRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
              R    C E    PG+L+ LP +  EL+ +   K G  A    ++ +  A ID +DVIRD
Sbjct  793   VRVTISCAEKDDVPGKLVLLPGSFKELLELGSNKFGIVAA-KVISKDNNAEIDDVDVIRD  851

Query  173   NDKLFIVAD  147
              D L   +D
Sbjct  852   GDHLIFASD  860



>ref|XP_010925257.1| PREDICTED: potassium channel AKT1-like isoform X2 [Elaeis guineensis]
Length=884

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/860 (42%), Positives = 508/860 (59%), Gaps = 81/860 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGS-SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
              D S   +S  ILPPLG+ S       +  ++SP D RYR WE ++V+LVAY+AWV PFE
Sbjct  30    RDESHYSISSNILPPLGARSHHRRAKLRWFIVSPYDRRYRSWEVFLVVLVAYTAWVSPFE  89

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+ K    L   DN+V+ FFA+DIVLTFFVA++D  + LLI + K+IA RY+++WF+
Sbjct  90    FGFLD-KASGALATADNVVNGFFAIDIVLTFFVAFLDRASYLLIDNPKQIAWRYITSWFI  148

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
             +DV STIP E V  +     H    Y +  MLR WRLRRVS  F +LEKD  F+Y  VRC
Sbjct  149   LDVISTIPSELVWKILPSSLH---SYGLFNMLRLWRLRRVSALFAQLEKDRNFNYLMVRC  205

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
             A+L  VT+  VHCAGC +Y +A RYP     W+G+   +  E+S+  RY+ +MYWSMTT+
Sbjct  206   AKLACVTVFAVHCAGCFFYLIAARYPDPSMTWIGASLPDFHEKSVWTRYMISMYWSMTTL  265

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLH  NT EM+F   YM FNLGLT+Y++GNMTNL+V GT RT +FR+++QAAS 
Sbjct  266   TTVGYGDLHPQNTREMLFDTLYMFFNLGLTSYLVGNMTNLIVHGTSRTRKFRDTLQAASG  325

Query  1619  FVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  S+ H LF  +V+ VY
Sbjct  326   FAQRNQLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDALPKAIRSSVAHFLFYSLVQNVY  385

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LF+GVS ++L  LV++MKAEY PPREDVI+QNE+P D YI+V+G V++ID +   EQ+V 
Sbjct  386   LFRGVSSDLLFQLVSEMKAEYFPPREDVILQNEAPTDFYILVNGNVDLIDYKNGMEQIVR  445

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
                +GD+ GE+G LC RPQ FT RTK L QLL+L   + L  +Q    D   ++ N +Q+
Sbjct  446   EAKTGDVVGELGVLCYRPQIFTVRTKKLCQLLRLNRATFLSIVQSNVGDGTIIMNNLMQY  505

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              K+ KD  +  +  E  +    G  N+ + L   V  G+   LN+LL+ GLDPN   + G
Sbjct  506   MKEQKDPVMEGVLRETENMLARGPSNLPLTLCFAVIRGDDLLLNQLLRRGLDPNEATNNG  565

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASIS  735
             +T LH AASKG+E CV +LL +G + + +D+EGN  LW+AI+ K   +  +L  + A IS
Sbjct  566   RTALHTAASKGNENCVALLLDYGADPNSRDLEGNIPLWEAISGKHEGVIRLLIDNGADIS  625

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                VA    C AA+ N   ++Q+++++G  V      G+TA+  A+ E    M+K L+  
Sbjct  626   TGDVA-HFACMAAEQNSLELLQDIVRYGGDVTLAKSDGTTALHHAVCEGNLQMVKFLIEQ  684

Query  554   GAEIDDAVKLNLAPLDLT------------EVLQKRELG--------HRIAMPNTILHEA  435
             G  ID        P DL             +  ++R+ G         +I+ P  I+H  
Sbjct  685   GTNIDKPDIRGWTPRDLADQQGHEDITALFQATKERDSGTSKTPAVATKISSP--IVHLN  742

Query  434   A--------------SKWAKDDH---------------------QNSSSMPQQCSIR-VS  363
             A               + + DDH                     ++S S+P   + R V 
Sbjct  743   AKFRSDPSMPVPKLIQESSGDDHRQRNSNFHNSLFGIISAAHAGRSSCSLPVAPAARYVG  802

Query  362   IYRG---HPATRRET-QCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEG  207
               RG   H AT R T  CPE G    +L+ LP ++ EL+ +  +K GF    + +  ++G
Sbjct  803   GSRGPQHHHATPRVTISCPEKGSTAPKLVLLPRSLDELLDVGAKKFGF--LPAKVLTKDG  860

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A ID++++IRD D L +V D
Sbjct  861   AEIDNVNLIRDGDHLVLVGD  880



>emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera]
Length=898

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/855 (42%), Positives = 497/855 (58%), Gaps = 74/855 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             +D S   ++  ILP LG+      + +  ++SP D+RYR WET++V LV Y+AWV PFE 
Sbjct  31    DDASHFSVTSAILPSLGARSNRRINLRRFIVSPFDARYRLWETYLVFLVFYTAWVSPFEF  90

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL       L + DN+V+ FFA+DI+LTFFVAY+D +T LL+ + K IA RY  TW   
Sbjct  91    GFLXEP-KGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRYTKTWLAF  149

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  150   DVISTIPSELARKILPKPLK---EYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWVRCA  206

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY L  ++    K WLG +  ++   SL  RY+++MYWS+TT+T
Sbjct  207   KLICVTLFAVHCAGCFYYLLGSQHGDPKKTWLGLVMGDLNTHSLWQRYVTSMYWSITTLT  266

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             T GYGDLHAVNT EM+F IFYMLFNLGLT+Y+IGNMTNLVV GT RT +FR+SIQAAS+F
Sbjct  267   TTGYGDLHAVNTREMVFDIFYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDSIQAASSF  326

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++ LR +  +E L QQ  +E LPK I  SI H+LF  +V+KVYL
Sbjct  327   ALRNQLPVRLQDQMLAHLSLRHRTNSEGLQQQETLEVLPKAIRSSISHYLFYSLVDKVYL  386

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MK EY PP+ED+I+QNE+P D+Y++V+G VE+I+     EQVV  
Sbjct  387   FRGVSNDLLFQLVSEMKPEYFPPKEDIILQNEAPTDLYVLVTGVVELIERRNAIEQVVGE  446

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             + +GD+ GE+G LC RPQ FT RTK L QLL+L  T+LL  +Q    D   +I N LQH 
Sbjct  447   IRTGDVCGEIGVLCYRPQLFTARTKRLCQLLRLNRTALLNLVQANVGDGAIIINNLLQHL  506

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K+ K+  +  +  +I      G   + ++L   V  G+   L++LLK GLDPN  DS G+
Sbjct  507   KEHKNPVMEGVLADIESMLXQGRMELPLSLCFAVLRGDDLLLHQLLKRGLDPNELDSNGR  566

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             TPLHIAASKG E+C  +LL++G N + KD EG   LWDAI  ++ S+  +L    +    
Sbjct  567   TPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLLMDNGAKIPL  626

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                G   C A + N+  ++++L++ G  V      G+TA+ AA  E   +++K L+  GA
Sbjct  627   SNVGQYACTAVERNNLDLLKDLVRFGGDVTHPSSSGTTALHAATSEANIEIVKFLLDQGA  686

Query  548   EIDDAVKLNLAPLDLTE--------VL--QKRELGHRIAMPNT-----------------  450
             ++D        P  L +        VL   KRE      +P T                 
Sbjct  687   DVDKLDNDGWTPRTLADQQGHEEIKVLFQTKRETKKLTPVPATKKPGVPFLGKFKSDSYL  746

Query  449   --ILHEAAS-----KWAKDDHQ-------NSSSMPQQCSIRVSIYRG-------------  351
                 H+  S      W  D+         N+S      S+     +G             
Sbjct  747   QPFQHDRESTGLEVSWIDDNRPRRRVNNFNNSLFGIMSSVNTRERKGFIRSAASFATSPR  806

Query  350   ---HPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                 PA R    CP+     G+L+ LP+++ EL+ I  +K  F  T   +  +EGA ++ 
Sbjct  807   QRDFPA-RVTLSCPQKGEVAGKLVPLPQSLQELLDIGAKKFKFSPT--KVVTKEGAEVED  863

Query  191   IDVIRDNDKLFIVAD  147
             I++IRD D L +V +
Sbjct  864   IELIRDGDHLILVGE  878



>emb|CAI77627.1| potassium uptake channel [Zea mays]
Length=885

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/851 (41%), Positives = 502/851 (59%), Gaps = 70/851 (8%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE  
Sbjct  28    DGSHYSISSGILPSLGARSNRRVKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEFG  87

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++ K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++D
Sbjct  88    FIQ-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVLD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+
Sbjct  147   VASTIPSEFARKILPPDLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCAK  203

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHC+ C YY LAD YP     W+G+   +  E  L I Y+ ++YWS+TT+TT
Sbjct  204   LICVTLFAVHCSACFYYLLADMYPTPTDTWIGNSMPDFHERGLWICYVVSVYWSITTLTT  263

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F 
Sbjct  264   VGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSFA  323

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP+RL++Q+++++CL+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYLF
Sbjct  324   LRNQLPSRLQDQMISHLCLKFRTDSEGLQQQETLDVLPKAIRSSISQYLFFNLVQKVYLF  383

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V+G  E+I+ +   EQ+V   
Sbjct  384   EGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVTGSAELIELQNGGEQMVGVA  443

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FLQ  1089
              +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N    L+
Sbjct  444   KAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLIRLLK  503

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
                    +      IE     G  ++ + L   V  G+   L++LLK GLDPN  D+ G 
Sbjct  504   QQNDNSVMMGVLKEIENMLARGRLDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNGH  563

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAASKG E+CV +LL +G + + +D EG   LW+A+  K +++  +L    +    
Sbjct  564   TALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVVELLVESGAELSS  623

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                    C A + ND+ +++ ++++G ++++  + G+T +  A+ +    M++LL+ +GA
Sbjct  624   GDTALYACIAVEENDAELLENVIRYGGNINNPTKDGTTPLHRAVCDGNVQMVELLLEHGA  683

Query  548   EIDDAVKLNLAPLDLT--------EVLQKRELGHRIAMPN-----TILHEAASKWAKDD-  411
             ++D       +P DL         + L K    HR    N      ++    S+ +  D 
Sbjct  684   DVDKQDSNGWSPRDLADQQGHDDIQALFKSRKAHRKHASNGRVAPMLIGRFNSEPSMPDM  743

Query  410   -HQN----SSSMPQ---------QCSIRVSIYRGH------------------PATRRET  327
              H+N    S  +PQ         Q S+   I   H                  P+ R ++
Sbjct  744   SHENARVRSEVVPQKLLRKRVSFQNSLFGVISSSHAHQDTGRLLSKGLAGTEGPSCRHDS  803

Query  326   ------QCPE-----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
                    CPE      G+L++LP ++AEL+ +  +K G       +    GA ID +++I
Sbjct  804   LIRVTISCPEKGGNAAGKLVRLPRSMAELLELGAKKFGIKP--GKVLTVGGAEIDEVELI  861

Query  179   RDNDKLFIVAD  147
             RD D + +V+D
Sbjct  862   RDGDHILLVSD  872



>gb|AHZ30618.1| potassium channel AKT1 [Gossypium hirsutum]
Length=875

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/846 (42%), Positives = 491/846 (58%), Gaps = 73/846 (9%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             L+  I+P LG+        +  +ISP D RY+ WET++VLLV Y+AWV PFE  FL  + 
Sbjct  25    LTTGIIPSLGARSIRRVKLRSYIISPHDRRYKVWETFLVLLVIYTAWVSPFEFGFL-GRP  83

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             DT L V DN+V+ FFA+DI+LTFFVAY+D    LLI   KKIA +Y ++W   DV STIP
Sbjct  84    DTPLAVTDNVVNGFFALDIILTFFVAYLDKAAYLLIDDPKKIAWKYGTSWLAFDVISTIP  143

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRVS  F+RLEKD  F+YFWVRCA+L+ VT+
Sbjct  144   SELARRISPKPLR---SYGLFNMLRLWRLRRVSALFSRLEKDKNFNYFWVRCAKLICVTV  200

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
               VHCAGC YY +A RY   G+ W+G+    N  E+SL IRY+++MYWS+TT+TTVGYGD
Sbjct  201   FAVHCAGCFYYRIAARYRDPGRTWIGASMGDNFHEQSLSIRYVTSMYWSITTLTTVGYGD  260

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH VNT EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN L
Sbjct  261   LHPVNTPEMIFDIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRQFRDTIQAASSFAQRNQL  320

Query  1598  PARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             P RL +Q++A++ L+++  +E L QQ  ++ LPK I  SI H+LF  +V+ VYLF GVS 
Sbjct  321   PPRLLDQMVAHLSLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDNVYLFHGVSN  380

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV   +SGD+
Sbjct  381   DLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVRKNGVEQVVGEASSGDL  440

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
              GE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N LQH K + D 
Sbjct  441   CGEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIIQANVGDGTIIMNNLLQHLKDMDDP  500

Query  1064  klgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              +  + IE  +    G  ++ +NL      G+ + LN+LL+ G + N  D  G+TPLHIA
Sbjct  501   IMEGVLIETQNMLARGSMDLPLNLCFAAVKGDDSSLNKLLEKGHNANESDDNGRTPLHIA  560

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             ASKG E CV++LL H  + ++KD EG+  LW+AI     +I  +L    +  +    G  
Sbjct  561   ASKGSENCVLILLDHNADPNIKDSEGSVPLWEAILGGHDNIAKLLKDNGANINVGDVGHF  620

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
              C AA+ ND ++++E++++G +V     +G TA+  A+ E   +++K L+  G++ID   
Sbjct  621   ACIAAEQNDLNLLKEIVRYGGNVTCPRYNGYTALHVAVCEGNFEIVKYLLEQGSDIDKRD  680

Query  530   KLNLAPLDLT----------------------------EVLQKRELGHRIAMPNTILHEA  435
                  P DL                             E  + R LG   + P  ++  A
Sbjct  681   IHGWTPRDLAAQQGHEDIEMIFKSLTEKKKTQPIMTIPEKHEARFLGRFTSEP--VISTA  738

Query  434   ASKWAKDDHQNSSS-----------------MPQQCSIRVSIYRGHP---------ATRR  333
              S    D      S                 M Q     + +    P         ++R 
Sbjct  739   TSGDGLDGSSRGKSRRPRRKSSNFNNSLFGIMSQNVEKDLLLSVHQPKGMKDPLVKSSRV  798

Query  332   ETQCPEP----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  165
                CPE     G+L+ +P ++ EL+ I   K G       + ++ G  ID I+VIRD D 
Sbjct  799   IISCPEKGDTIGKLVLVPGSMEELVEIGANKFGIFG--GKVMNKGGGEIDDIEVIRDGDH  856

Query  164   LFIVAD  147
             L  V+D
Sbjct  857   LVFVSD  862



>gb|ABO15470.1| AKT1-like K+ channel LilKT1 [Lilium longiflorum]
Length=862

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/850 (42%), Positives = 494/850 (58%), Gaps = 71/850 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D RYR WET++VLLV Y+AWV PFE 
Sbjct  13    RDGSHYSLSSGILPSLGARSHRKAKLRWFIISPYDQRYRIWETFLVLLVIYTAWVSPFEF  72

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+E  +   L + DNIV+  F +DIVLTFFVAY+D TT LLI   K+IA +Y ++WF++
Sbjct  73    GFMEHAIGA-LAIADNIVNGLFFIDIVLTFFVAYLDKTTYLLIDSPKEIAWKYTTSWFIL  131

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ STIP E    L   K      Y  L MLR WRLRRVS  F RLEKD  F+YFWVRCA
Sbjct  132   DIVSTIPSELARQLLPPKLR---SYGFLNMLRLWRLRRVSCLFARLEKDRNFNYFWVRCA  188

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+FVTL  VHCAGC YY +A RY    K W+G+   +  E+SL +RY+++MYWS+TT+T
Sbjct  189   KLIFVTLFAVHCAGCFYYLIAARYHDPTKTWIGASMPDFHEQSLWVRYVTSMYWSITTLT  248

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF I YMLF+LGLTAY+IGNMTNLVV  T RT +FR++IQAAS+F
Sbjct  249   TVGYGDLHAQNTGEMIFDIAYMLFDLGLTAYLIGNMTNLVVHCTSRTRKFRDTIQAASSF  308

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q++A++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V KVYL
Sbjct  309   ALRNQLPVRLQDQMVAHLCLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYTLVNKVYL  368

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++ KAEY PPREDVI+QNE+P D YI+V+G V+++D++   EQ+V  
Sbjct  369   FRGVSHDLLFQLVSEKKAEYFPPREDVILQNEAPTDFYILVTGSVDLVDHKNGIEQIVRE  428

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
              N G++ GE+G LC RPQ FT RTK L QLL+L   S L  +Q    D    + N LQ+ 
Sbjct  429   ANPGELVGEIGVLCYRPQLFTIRTKKLCQLLRLNRNSFLSIVQSNVGDGTVTMNNLLQYL  488

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K+ KD  +  +  E G+    G  ++ + L      G+   L++LL+ GLDPN  D+ G 
Sbjct  489   KEQKDHVMQGVLRETGNMLARGRLDLPLTLCFAATRGDDLLLHQLLRRGLDPNESDNNGW  548

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISD  732
             + LHIAASKG+E CV++LL  G + + +D EG   L +AI  K  S+  +L  H A +S 
Sbjct  549   SALHIAASKGNESCVVLLLDFGADPNCRDSEGRVPLLEAILGKHDSVVRVLVDHGADLSS  608

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                A    C AA+ N+  ++Q ++++G  + +    G+TA+  A+ E    ++K L+ +G
Sbjct  609   G-DAAQYACIAAEQNNLELLQSIVQYGGDISAPKLDGNTALHIAVTEGNVPIVKFLLEHG  667

Query  551   AEIDDAVKLNLAPLDLTEVLQKRE-----------------------LGHRIAMPNTILH  441
             AEID        P  L +     E                       LG   + P     
Sbjct  668   AEIDKPDSHGWTPRGLADQQSHEEIKALFEAKRDIPKVSDTTPTSHLLGRYSSEPMIQRL  727

Query  440   EAASKWAKDDHQN----------------------------SSSMPQQCSIRVSIYRGHP  345
              +      DD++                             S S P +       +R  P
Sbjct  728   SSDGILVADDNKQRRRANNFRNSLFGIMSAAKVDREYGPLPSPSGPSRFMAVAPHHRTPP  787

Query  344   ATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
               R   +CPE    P +L+ LP ++ EL+ + G+K G       +   +GA ID + ++R
Sbjct  788   --RVTIRCPEKGNAPAKLVLLPGSLKELLDLGGKKFGLVLV--KVLTRDGAEIDDVKLVR  843

Query  176   DNDKLFIVAD  147
             D D L +V+D
Sbjct  844   DGDCLLLVSD  853



>gb|AIY55349.1| potassium channel AKT1-like protein [Glycine max]
Length=875

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/865 (41%), Positives = 501/865 (58%), Gaps = 85/865 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  13    RDGSHYSLSTGILPSLGAKSNRRLKLKPFIVSPYDRRYRIWETFLVILVVYTAWVSPFEF  72

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L + DNIV+ FF VDIVLTFFVAYID ++ L++  RK+IA +Y  TW   
Sbjct  73    GFLK-KPQAPLSITDNIVNGFFFVDIVLTFFVAYIDKSSYLIVDDRKQIAWKYARTWLSF  131

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV S IP E V  +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  132   DVISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDKNYNYFWVRCA  188

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +A RY    K W+G+   N  E SL  RY++++YWS+TT+T
Sbjct  189   KLIAVTLFAVHCAACFYYLIAARYHDPKKTWIGATMDNFLEHSLWSRYVTSIYWSITTLT  248

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN+ EMIF +FYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF
Sbjct  249   TVGYGDLHPVNSREMIFDVFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNF  308

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF  +++KVYL
Sbjct  309   AQRNQLPHRLQDQMLAHLCLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLIDKVYL  368

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G VE++  +   EQVV  
Sbjct  369   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVELLVLKNGAEQVVGE  428

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  429   AKTGDLCGEIGVLCYKPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  488

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K++ D  +  + ++I +    G  ++ +++    A G+   L++LLK G+DPN  D+  +
Sbjct  489   KEINDPIMEGVLVDIENMLARGRMDLPVSVCFAAARGDDLLLHQLLKRGMDPNESDNNRR  548

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAAS+G + CV++LL +G + +++D+EGN  LW+AI     S+  +L    +    
Sbjct  549   TALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLLSENGANLQC  608

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHG--LHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                G   C AA+ N  ++++E++++G  + + +    G+TA+  A+ E   + +K L+ +
Sbjct  609   GDVGQFACTAAEQNSLNLLKEIMRYGGDITLPNSSNTGTTALHVAVSEGNVETVKFLLDH  668

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRE----------------------------LGHRIAM  459
             GA ID   K    P DL +     E                            LG   + 
Sbjct  669   GASIDMPDKHGWTPRDLADQQAHTEIKALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSE  728

Query  458   PNTIL------HEAASKWAKDDHQNSSSMPQQCS---------IRVSIYRGHP-------  345
             P   L      H     W+++  QN S  P++ S         I  + + G         
Sbjct  729   PTMTLPLDGSFHGTDGSWSQNQSQNQSR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVD  787

Query  344   ----------------ATRRETQCPEP----GRLIKLPETIAELISIAGEKLGFDATDSS  225
                              TR    CPE     G+L+ LP +  EL+ I  +K GF    + 
Sbjct  788   MNNNARNGMKSSSAVGPTRVIISCPEKGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNK  845

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVA  150
             +  ++G  I+ I++IRD D L  + 
Sbjct  846   VVCKDGGEIEDIEIIRDGDHLVFLG  870



>ref|XP_008675279.1| PREDICTED: potassium channel AKT1-like [Zea mays]
Length=883

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/852 (41%), Positives = 499/852 (59%), Gaps = 70/852 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSISSGILPSLGARSNRRAKLRPFIVSPYDRRYRCWETFLIILVIYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++
Sbjct  87    GFIR-KPAGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFIL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  146   DVASTIPSEFARKILPPNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHC+ C YY LADRYP     W+G+   +  +  L IRY+ ++YWS+TT+T
Sbjct  203   KLICVTLFAVHCSACFYYLLADRYPDPTDTWIGNSMPDFHQRGLWIRYVVSVYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  263   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP+RL++Q+++++ L+F+  +E L QQ  ++ LPK I   I  +LF  +V+KVYL
Sbjct  323   ALRNQLPSRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSGISQYLFFNLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V+G  E+I+     EQ+   
Sbjct  383   FEGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVTGSAELIELRNGGEQMAGV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--  1089
               +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N +Q  
Sbjct  443   AKAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLMQLL  502

Query  1088  -HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                K    +      IE     G  ++ I L   V  G+   L++LLK GLDPN  D+ G
Sbjct  503   KQQKDNSVMVGVLKEIENMLARGRLDLPITLCFAVNKGDDLMLHQLLKRGLDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG E+CV +LL +G + + +D EG   LW+A+  K +++  +L    +   
Sbjct  563   HTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELLVESGAELS  622

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                     C A + ND+ +++ ++++G ++++  + G+T +  A+ +    M++LL+ +G
Sbjct  623   SGDTALYACIAVEENDAELLENVIRYGGNINNPTKDGTTPLHRAVCDGNVQMVELLLEHG  682

Query  551   AEIDDAVKLNLAPLDLT--------EVLQKRELGHRIAMPNT-----ILHEAASKWAKDD  411
             A++D       +P DL         + L K    HR    N      ++    S+ +  D
Sbjct  683   ADVDKQDSNGWSPRDLADQQGHDDIQALFKSRKAHRKHASNGRVAPMLIGRFNSEPSMPD  742

Query  410   --HQN----SSSMPQ---------QCSIRVSIYRGH------------------PATRRE  330
               H+N    S  +PQ         Q S+   I   H                  P  R +
Sbjct  743   MSHENARVRSEVVPQKLLRKRVSFQNSLFGVISSSHAHQDTGRLLSKGLAGTEGPNCRHD  802

Query  329   T------QCPE-----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
             +       CPE      G+L++LP ++AEL+ +  +K G       +    GA ID +++
Sbjct  803   SLIRVTISCPEKGGNAAGKLVRLPRSMAELLELGAKKFGIKP--GKVLTVGGAEIDEVEL  860

Query  182   IRDNDKLFIVAD  147
             IRD D + +V+D
Sbjct  861   IRDGDHILLVSD  872



>ref|XP_006841929.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda]
 gb|ERN03604.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda]
Length=852

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/829 (43%), Positives = 499/829 (60%), Gaps = 56/829 (7%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS   LP LG+        +  ++SP D RYR WET++++LV YSAWV PFE+ F+ +K 
Sbjct  25    LSSGFLPSLGARSNRMVKLRKFIVSPYDRRYRAWETFLIVLVVYSAWVSPFELGFM-TKA  83

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L V DN+V+ FFA+DI+LTFFVA++D  T LL+   K IA RY+STWF  DVASTIP
Sbjct  84    EGGLLVADNVVNGFFAIDILLTFFVAFLDRRTYLLVDEPKMIAFRYISTWFAFDVASTIP  143

Query  2129  FE-FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVT  1953
             FE F + LF       +   +L MLR WRLRRVS  F RLEKDIRF+YFW RCA+L+ VT
Sbjct  144   FELFASRLFRISP---LASGILNMLRLWRLRRVSALFARLEKDIRFNYFWTRCAKLVCVT  200

Query  1952  LLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
             L  VHCAGC YY LA RY    + W+G+   N +E+SL IRY+++MYWS+TT+TTVGYGD
Sbjct  201   LFAVHCAGCFYYLLAARYYDWRRTWIGASIPNFKEKSLWIRYVTSMYWSITTLTTVGYGD  260

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH  NT EM+F  FYMLFNLGLTAY+IGNMTNLVV GT RT +FR+++QAAS+F  RN L
Sbjct  261   LHPENTREMVFDTFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTVQAASSFAQRNQL  320

Query  1598  PARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREI  1419
             P RL++Q+L+++CL+F+ E L QQ  +E LPK I   I ++LF  +V+KVYLF+GVS + 
Sbjct  321   PLRLEDQMLSHLCLKFRTEGLQQQETLESLPKAIRSGISNYLFYALVDKVYLFQGVSNDF  380

Query  1418  LLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFG  1239
             L  LV++MKAEY PPREDVI+ NE+P D YI+V+G V++++ +  + +VV     GD+FG
Sbjct  381   LFQLVSEMKAEYFPPREDVILHNEAPTDFYILVTGAVDLMEYKDGSLRVVGEAQMGDVFG  440

Query  1238  EVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlkl  1059
             E+G LC RPQ+FT RTK L QLL+L  TSL+  +Q   ED   +++N LQH + +KD   
Sbjct  441   EIGVLCYRPQTFTVRTKRLCQLLRLNRTSLMNIVQSNVEDGTIIMRNLLQHMRDMKDPST  500

Query  1058  gdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAAS  885
              D+ IE       G  ++   + +V + G+   L +LL+ GLD N  D  G+T LH+AA+
Sbjct  501   EDVMIETESMLARGRTDLPFGVCSVASAGDDKLLEQLLQQGLDANETDHCGRTALHLAAA  560

Query  884   KGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLC  705
             KG +ECV +LL  G + ++KD EG   LW+A+      + ++++   +  +   AG   C
Sbjct  561   KGFKECVRLLLDQGADPNIKDFEGRVPLWEAMLGGHEEVKTLMFEKGARLNQSDAGLYAC  620

Query  704   KAAKMNDSSVMQELLKHGLH-VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
              A + N    +  ++ HG +        GSTA+  A+ E   + +K L+  GA+ D    
Sbjct  621   MAVEKNCLDTLDAIIHHGGNPALPAPLTGSTALHTAVSEGNVEAVKALLNLGADFDKPDL  680

Query  527   LNLAPLDLTEVLQKREL-------GHRIAMPNTILHEAASKWAKDDHQN-----------  402
             +   P  L +     E+          + + + I      +  K  H             
Sbjct  681   IGWTPRALADQQGHDEIKVLFQNVSENVDLASAIRPNVNFENVKKIHSEPFIRKYMPENG  740

Query  401   -SSSMPQ-------QCSIRVSIYRGH--------PAT-----RRET-----QCPEPGRLI  300
               SSMP+       Q S+   +Y G         P       RR T     +    G+LI
Sbjct  741   VGSSMPRRRRTNNYQNSLFGVMYGGDRMIGFWDTPGNVERLRRRVTIHGVEKERGSGKLI  800

Query  299   KLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
              LP++IAEL+ I GEK GF  T   + + E A ++ I+ +RD D LF+V
Sbjct  801   LLPDSIAELLRIGGEKFGFSPT--KVVNSEDAEVEDIEAVRDGDHLFLV  847



>emb|CDY35373.1| BnaA04g14740D [Brassica napus]
Length=860

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/847 (41%), Positives = 491/847 (58%), Gaps = 66/847 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP + +YR WE ++V+LV Y+AWV P
Sbjct  20    RESSHFSL---STGILPSLGARSNRRIKLKRFVVSPYNHKYRIWEAFLVVLVVYTAWVSP  76

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T LL+  RK IA +YL +W
Sbjct  77    FEFGFLR-KPRPPLSITDNIVNGFFAIDIIMTFFVGYLDKSTYLLVDDRKMIAFKYLRSW  135

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F++D+ STIP E VA   + +      Y +  MLR WR+RRV   F RLEKD  F+YFWV
Sbjct  136   FVLDLISTIPSE-VAMKISSQ-----SYGLFNMLRLWRVRRVGALFARLEKDRNFNYFWV  189

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY +A R+    K W+G+   N  +ESL +RY+++MYWS+T
Sbjct  190   RCAKLVCVTIFAVHCAACFYYLIAARHHDPAKTWIGASNANFHDESLWMRYVTSMYWSIT  249

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  250   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  309

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  310   SNFARRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  369

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++  +   E  
Sbjct  370   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVVQDGGTENA  429

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC +PQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  430   VKEVKAGDIIGEIGVLCYKPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  489

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K++ D  +  + +E  +    G  ++ INLF      +   L++LLK G DPN  D+
Sbjct  490   QHLKEMNDPVMASVLLETENMLAKGKLDLPINLFFAAMREDDLLLHQLLKRGQDPNESDN  549

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV+ LL++  + + +D EGN  LW+A+      I  +L    + 
Sbjct  550   NGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVLLEHGAT  609

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              +    G   C AA+  +  +++E+++HG  V      G++A+ AA+ E   +M+K L+ 
Sbjct  610   IEAGDVGHFACTAAEQGNLKLLKEIVRHGGDVTRPRATGTSALHAAVCEGNIEMVKYLLE  669

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPN---TILHEAAS----KWAKDDHQNS  399
              GA+++     N    DL +     E+       N   T +  +AS    K A+      
Sbjct  670   QGADVNKQDMHNWTAKDLADQQGHEEIKALFREKNNERTHIESSASVPILKTARRFLGRG  729

Query  398   SSMP------QQCSIRVSIYRGHPAT---------------------------------R  336
             +S P      ++ S R++  R    T                                 R
Sbjct  730   TSEPNIRPPSREVSFRITETRPRRKTNNFDNSLFGILASQNVQKNGLATVDESRVVNQVR  789

Query  335   RETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDND  168
                 C E      +L+ LP +  EL+ +   K G  A      D+  A ID +DVIRD D
Sbjct  790   VTISCKEKDEVAVKLVLLPGSFKELLELGSSKFGIVAARVMSKDQNMAEIDDVDVIRDGD  849

Query  167   KLFIVAD  147
              L    D
Sbjct  850   HLIFATD  856



>gb|AAF81249.1|AF267753_1 putative potassium channel protein Mkt1p [Mesembryanthemum crystallinum]
Length=870

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/839 (41%), Positives = 502/839 (60%), Gaps = 68/839 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  +LP LG+        +  +ISP DSRYR WET+++LLV Y+AWV PFE  FL+  +
Sbjct  32    LSNGLLPSLGARSNRRVILRRFIISPFDSRYRWWETFLILLVFYTAWVSPFEFGFLKKPI  91

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DNIV+ FFAVDI+LTFFVA++DP T LL+ ++KKI+ RY+ TWFL DV ST+P
Sbjct  92    KV-LAITDNIVNGFFAVDIILTFFVAFLDPQTYLLVDNQKKISWRYIRTWFLFDVISTVP  150

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E V  +F         Y +  MLR WRLRRVS  FTRLEKD   SYF VRC++L+FVTL
Sbjct  151   SELVEKMFPSMQ----VYGLFNMLRLWRLRRVSKMFTRLEKDRNISYFLVRCSKLIFVTL  206

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLG--SLNVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VH A C YY++A  YP   K W+G    +   E++ +RY++++YWS+TT+TT GYGDL
Sbjct  207   FAVHLAACFYYYIAAHYPDPRKTWIGIGMEDFHLEAVSLRYVTSIYWSITTLTTTGYGDL  266

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H VN  EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+F  RN LP
Sbjct  267   HPVNIREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASSFGLRNRLP  326

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL++Q+LA++CL+++  +E L QQ +++ LPK I  SI H+LF  +++KVYLF GVS +
Sbjct  327   VRLQDQMLAHLCLKYRTDSEGLQQQEVLDSLPKAIKSSISHYLFYSLLDKVYLFHGVSND  386

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D+Y++VSG VE I      EQVV    SG++ 
Sbjct  387   LLFQLVSEMKAEYFPPKEDVILQNEAPTDLYVLVSGAVEFIVLRNGTEQVVREATSGEVC  446

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RT+ L QLL+L  T+ L  +Q    D   ++ N L+H K+  D  
Sbjct  447   GEIGVLCYRPQLFTVRTRRLCQLLRLNRTAFLNLVQANVGDGAIIMNNLLEHLKEQSDPL  506

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  +  ++ +    G  ++ ++L    A G+   L  LL+ G DPN  D  G+T LHI+A
Sbjct  507   MQSVLRDVENMLARGRMDLPLSLCFAAARGDEPLLQHLLRQGSDPNEADMNGRTALHISA  566

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL-  711
             + G++ C +VLL +G + + KD EGN  LW+AI  +  S+  +L    +      +GD+ 
Sbjct  567   ANGNDNCAVVLLAYGADPNAKDSEGNVPLWEAIMGRHESLIKLLIDQGAT---LASGDVP  623

Query  710   --LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
                C A + ++  ++++++++G  V     +G+T + AA+    A ++K L+  GA+++ 
Sbjct  624   QYACYAVEQDNLELLKDIVRYGGDVKLAKTNGTTPLHAAVTSGNAAIVKFLLKQGADMEK  683

Query  536   A-----VKLNLAPL----DLTEVLQKRE---LGHRIAMPNTILHEAASKWAKDDHQNSSS  393
                       LA      D+  + + +E   L   +++P   +  A+ K  + D  + + 
Sbjct  684   GDVHGWTSKGLAEFHGNDDVKALFRSKEETNLQSVVSVPENEVAPASLKKLRTDSMDVTP  743

Query  392   MPQQCSI-------RVSIYRG------HPATRRET---------------------QCPE  315
               ++ +        RV+ +R         ATR ET                     +CP 
Sbjct  744   RVREVTWADKNRRRRVNTFRNSLFGIMSAATRGETAEGSSFTNSPIFGNQSARVILKCPA  803

Query  314   PGRLIKL---PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              G  +KL   PETI EL+ I  +K G   T     D  GA +D ++VIRD D L ++ +
Sbjct  804   KGEAVKLVMVPETIQELLDIGAQKFGCVCTKVVTAD--GAEVDEVEVIRDGDHLSLICE  860



>gb|EEE55080.1| hypothetical protein OsJ_02815 [Oryza sativa Japonica Group]
Length=884

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/847 (41%), Positives = 497/847 (59%), Gaps = 91/847 (11%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   +S  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE  
Sbjct  65    DGSHYSISSAILPSLGARSNRRIKLRRFIISPYDRRYRIWETFLIVLVVYSAWVSPFEFG  124

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F+  K    L   DN+V+ FFAVDI+LTFFVAY+D  + +L    KKIA RY +TW ++D
Sbjct  125   FI-PKPTGALATADNVVNAFFAVDIILTFFVAYLDKMSYMLEDDPKKIAWRYSTTWLVLD  183

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP EF   +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA+
Sbjct  184   VASTIPSEFARRILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCAK  240

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHCA C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+TT
Sbjct  241   LICVTLFAVHCAACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLTT  300

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA++F 
Sbjct  301   VGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNYRDTIQAATSFG  360

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYLF
Sbjct  361   VRNQLPPRLQDQMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYLF  420

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++ +   +QV+   
Sbjct  421   QGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEQQNGADQVIQVA  480

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FLQ  1089
              SG++ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL+
Sbjct  481   TSGEVVGEIGVLCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFLK  540

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
               K+   +      IEI                   G+   L++LLK G+DPN  D+ G 
Sbjct  541   EQKENSVMAGVVKEIEI-----------------TRGDDFLLHQLLKRGMDPNESDNDGH  583

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +    
Sbjct  584   TALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLSS  643

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                G   C A + +D+ ++ +++ +G  V+   R G+TA+  A+ +    M +LL+ +GA
Sbjct  644   GDTGLYACIAVEESDTELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMAELLLEHGA  703

Query  548   EIDDAVKLNLAPLDLTE-------------------------------VLQKRELGHRIA  462
             +ID        P  L E                               VL ++    R+ 
Sbjct  704   DIDKQDGNGWTPRALAEQQGHDDIQLLFRSRKAATGEWPPSDADLPSRVLPEKLRRKRVT  763

Query  461   MPNTILHEAASKWAK--DDH------------QNSSSMPQQCSIRVSIYRGHPATRRETQ  324
               N++    +S  A+   DH             N SS  +   IRV+I            
Sbjct  764   FQNSLFGVISSSQAQRETDHPLSRGGLAATGSPNPSSGSRNAVIRVTI-----------S  812

Query  323   CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  156
             CPE     G+L+ LP+T+  L+ +  +K  FD   + +   EGA +D +++IRD D L +
Sbjct  813   CPEKGNTAGKLVLLPQTLDMLLELGAKK--FDFAPTKVLTVEGAEVDEVELIRDGDHLVL  870

Query  155   VA-DWNS  138
             V+ +W++
Sbjct  871   VSNEWDA  877



>ref|XP_009393618.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=897

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/757 (44%), Positives = 460/757 (61%), Gaps = 57/757 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+      +    ++SP D RYR WET++V LV Y+AWV PFE 
Sbjct  44    RDGSHYSLSSGILPSLGARSNRRVNLPSFIVSPYDRRYRSWETFLVTLVVYTAWVSPFEF  103

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FLE K    L ++DNIV++FFA+DIVLTFFVAY+D TT LLI  RK+IA RYLSTWF++
Sbjct  104   GFLE-KSRGVLALIDNIVNVFFAIDIVLTFFVAYLDRTTYLLIDSRKQIAWRYLSTWFIL  162

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  163   DVASTIPSEIARKILPKNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRCA  219

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YYF+A RYP   + W+G+   +  E+SL IRY+++MYWS+TT+T
Sbjct  220   KLICVTLFAVHCAGCFYYFIAARYPDPSRTWIGASIPDFHEKSLWIRYVTSMYWSITTLT  279

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EM+F I YMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA+ F
Sbjct  280   TVGYGDLHAENTREMVFDIVYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATGF  339

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RNHLP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI H+LF  +V  VYL
Sbjct  340   AQRNHLPVRLQDQMISHLSLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVSNVYL  399

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GV+ ++L  LV++MKAEY PPREDVI+QNE+P D Y++++G +++ID+    EQ+V  
Sbjct  400   FRGVNNDLLFQLVSEMKAEYFPPREDVILQNEAPTDFYVLITGTMDLIDHSSGTEQIVQL  459

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               SGD+ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    +   ++ N LQ+ 
Sbjct  460   AKSGDLVGEIGVLCYRPQLFTARTRSLCQLLRLNRTTFLSIVQSNVGEGTKIVSNLLQY-  518

Query  1082  kklkdlklgdLFIEIGDEDGDP------------------NMSINLFTVVATGNATFLNE  957
                           + D++GDP                  ++ + L   V   +   L++
Sbjct  519   --------------LKDQNGDPVMEGVSRDIEKMLTHGRLDLPLTLSFAVIREDDLLLHQ  564

Query  956   LLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKE  777
             LL+ GLDPN  DS G T LHIAASKG+E CV +LL++G + +  D EG+  LW A+  K 
Sbjct  565   LLRRGLDPNESDSNGHTVLHIAASKGNEHCVCLLLEYGADPNSTDSEGSVPLWQAMVGKH  624

Query  776   HSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAM  597
               + ++L    +       G   C AA+ N+  ++++++++G  V    +  +TA+  A+
Sbjct  625   EDVVNLLIKNGAALSSGDMGSFACTAAEQNNLELLKDIIRYGGDVTLPKKDKTTALHVAV  684

Query  596   EENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAK  417
              E    +++ L+  GA ID        P  L +     E+          L EA   +A 
Sbjct  685   CEGNVQLVEFLLEQGANIDTPDCNGWTPRKLADQQGHEEIKR--------LFEAKKDFA-  735

Query  416   DDHQNSSSMP--QQCSIRVSIYRGHPATRRETQCPEP  312
                  +SS+P     S  V  Y   PA R  +    P
Sbjct  736   -----TSSVPVSTPASHSVGRYSSEPAIRLSSNEDRP  767



>ref|XP_009619489.1| PREDICTED: potassium channel AKT1-like [Nicotiana tomentosiformis]
Length=892

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/680 (48%), Positives = 442/680 (65%), Gaps = 10/680 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+        Q  +ISP D  YR WET++V LV Y+AWV P
Sbjct  26    QLSRDSSHYSLSTGILPSLGARSNRRVKLQRFIISPYDRHYRLWETFLVALVVYTAWVSP  85

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K    L V DN+V+ FFA+DIVLTFFVAY+D TT LL+ + +KIA +Y STW
Sbjct  86    FEFGFLK-KPTGPLAVTDNVVNGFFAIDIVLTFFVAYLDRTTYLLVDNHRKIAWKYASTW  144

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL DV STIP E    +          Y +  MLR WRLRRVS  F RLEKD  F+YFWV
Sbjct  145   FLFDVISTIPSELARKISPKPLRQ---YGLFNMLRLWRLRRVSALFARLEKDRNFNYFWV  201

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCAGC YY +A  YP+  K W+G+   +   +SL IRYI+++YWS+T
Sbjct  202   RCAKLICVTLFAVHCAGCFYYLIAANYPNPSKTWIGASMGDFLNQSLWIRYITSIYWSIT  261

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAA
Sbjct  262   TLTTVGYGDLHPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAA  321

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LPARL++Q+LA++CL+F+  +E L QQ  +E LPK I  S+ H LF  +V+K
Sbjct  322   SSFAQRNQLPARLQDQMLAHLCLKFRTDSEGLQQQETLESLPKAIRSSVSHFLFYSLVDK  381

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV
Sbjct  382   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQV  441

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ FT RT+ L QLL++  T+ L  +Q    D   ++ N L
Sbjct  442   VGEAKTGDLCGEIGVLCYRPQLFTVRTRRLCQLLRMNRTTFLNIVQANVGDGTIIMNNLL  501

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDS  918
             QH K +KD  +  + +E         M + L    AT  G+   L++LLK GLDPN  D+
Sbjct  502   QHLKDIKDPIMEGVLLETERMLARGRMDLPLTLCFATLRGDDLLLHQLLKRGLDPNESDN  561

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G++ LH+AAS G E CV++LL  G +++ +D EGN  LW+AI+ K   +  +L    + 
Sbjct  562   NGRSALHVAASTGIESCVVLLLDFGADVNSRDSEGNVPLWEAISGKHEPVIKLLVDNGAK  621

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                   G   C AA+ N+ +++++++++G  V     +GS+A+  A+ E   +++K L+ 
Sbjct  622   LSAGDVGHFACVAAEQNNLNLLKDIVRYGGDVTRPKVNGSSALHVAVCEGNMEIVKYLLD  681

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA +D   +    P DL E
Sbjct  682   RGANVDQVDEHGWTPRDLAE  701



>ref|XP_002458234.1| hypothetical protein SORBIDRAFT_03g029520 [Sorghum bicolor]
 gb|EES03354.1| hypothetical protein SORBIDRAFT_03g029520 [Sorghum bicolor]
Length=885

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/855 (41%), Positives = 502/855 (59%), Gaps = 74/855 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSISSGILPSLGARSNRRVKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++
Sbjct  87    GFIR-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  146   DVASTIPSEFARRILPPNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHC+ C YY LADRYP     W+G+   +  +  L IRY+ ++YWS+TT+T
Sbjct  203   KLICVTLFAVHCSACFYYLLADRYPVPTDTWIGNSMPDFHQRGLWIRYVISVYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  263   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP+RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYL
Sbjct  323   ALRNQLPSRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISQYLFFNLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V+G  E+++     EQ+   
Sbjct  383   FEGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVTGSAELVELRNGGEQIAGV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--  1089
               +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N +Q  
Sbjct  443   AKAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLMQLL  502

Query  1088  -HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                K    +      IE     G  ++ + L   V  G+   L++LLK GLDPN  D+ G
Sbjct  503   KEQKDNSVMAGVLKEIENMLARGRLDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG E+CV +LL +G + + +D EG   LW+A+  K +++  +L    +   
Sbjct  563   HTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELLVESGAELS  622

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                     C A + ND+ +++ ++++G +++S  + G+T +  A+ +    M++LL+ +G
Sbjct  623   SGDTALYACIAVEENDAELLENIIRYGGNINSSTKDGTTPLHRAVCDGNVQMVELLLEHG  682

Query  551   AEIDDAVKLNLAPLDLT--------EVLQKRELGHR-------------------IAMPN  453
             A+I+       +  DL         +VL K    HR                    +MPN
Sbjct  683   ADINKQDNNGWSARDLADQQGHDDIQVLFKSRKAHRQHASNGRVAPMLIGRFNSEPSMPN  742

Query  452   TILHEAASKWAKDDHQN----------------SSSMPQQCSIRVSIYRGHPAT------  339
              + HE A   +K   Q                 SSS  +Q +  + + +G   T      
Sbjct  743   -MNHEDAEVRSKVVPQKLLRKRVSFQNSLFGVISSSQARQDTGGL-LSKGLAGTGGPSCH  800

Query  338   -----RRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
                  R    CPE     G+L++LP ++ EL+ +  +K  FD   + +    GA ID ++
Sbjct  801   HDSLIRVTISCPEKGNAAGKLVRLPRSMTELLELGAKK--FDFKPTKVLTVGGAEIDEVE  858

Query  185   VIRDNDKLFIV-ADW  144
             +IRD D + +V +DW
Sbjct  859   LIRDGDHIVLVSSDW  873



>ref|XP_009772048.1| PREDICTED: potassium channel AKT1 [Nicotiana sylvestris]
Length=893

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/680 (48%), Positives = 442/680 (65%), Gaps = 10/680 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+        Q  +ISP D  YR WET++V LV Y+AWV P
Sbjct  26    QLSRDSSHYSLSTGILPSLGARSNRRVKLQRFIISPYDRHYRSWETFLVALVVYTAWVSP  85

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FLE K    L V DN+++ FFA+DIVLTFFVAY+D TT LL+ + KKIA +Y STW
Sbjct  86    FEFGFLE-KPTGPLAVTDNVINGFFAIDIVLTFFVAYLDRTTYLLVDNHKKIAWKYASTW  144

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL DV STIP E    +          Y +  MLR WRLRRVS  F RLEKD  F+YFWV
Sbjct  145   FLFDVISTIPSELARKISPKPLRQ---YGLFNMLRLWRLRRVSALFARLEKDRNFNYFWV  201

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCAGC YY +A  YP+  K W+G+   +   +SL IRYI+++YWS+T
Sbjct  202   RCAKLVCVTLFAVHCAGCFYYLIAANYPNPTKTWIGASMGDFLHQSLWIRYITSIYWSIT  261

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAA
Sbjct  262   TLTTVGYGDLHPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAA  321

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LPARL++Q+LA++CL+F+  +E L QQ  +E LPK I  SI H LF  +V+K
Sbjct  322   SSFAQRNQLPARLQDQMLAHLCLKFRTDSEGLQQQETLESLPKAIRSSISHFLFYSLVDK  381

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV
Sbjct  382   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQV  441

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  442   VGEAKTGDLCGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIVQANVGDGTIIMNNLL  501

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDS  918
             QH K +KD  +  + +E         M + L    AT  G+   L++LLK GLDPN  D+
Sbjct  502   QHLKDIKDPIMEGVLLETERMLARGRMDLPLTLCFATLRGDDLLLHQLLKRGLDPNESDN  561

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G++ LH+AA+ G E CV++L+  G +++ +D EGN  LW+AI  K   +  +L    + 
Sbjct  562   NGRSALHVAAATGIESCVVLLIDFGADVNSRDSEGNVPLWEAILGKHEPVIKLLVDNGAK  621

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                   G   C AA+ N+ +++++++++G  V S   +GS+A+  A+ E   +++K L+ 
Sbjct  622   LSAGDVGHFACIAAEQNNLNLLKDIVRYGGDVTSPKINGSSALHVAVCEGNMEIVKYLLD  681

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA +D   +    P DL E
Sbjct  682   RGANVDQVDEHGWTPRDLAE  701



>ref|XP_003549784.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/865 (41%), Positives = 500/865 (58%), Gaps = 85/865 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  13    RDGSHYSLSTGILPSLGAKSNRRLKLKPFIVSPYDRRYRIWETFLVILVVYTAWVSPFEF  72

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L + DNIV+ FF VDIVLTFFVAYID ++ L++  RK+IA +Y  TW   
Sbjct  73    GFLK-KPQAPLSITDNIVNGFFFVDIVLTFFVAYIDKSSYLIVDDRKQIAWKYARTWLSF  131

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV S IP E V  +          Y +  MLR WRLRRV   F+RLEKD  ++YFWVRCA
Sbjct  132   DVISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVGALFSRLEKDKNYNYFWVRCA  188

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +A RY    K W+G+   N  E SL  RY++++YWS+TT+T
Sbjct  189   KLIAVTLFAVHCAACFYYLIAARYHDPKKTWIGATMDNFLEHSLWSRYVTSIYWSITTLT  248

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN+ EMIF +FYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF
Sbjct  249   TVGYGDLHPVNSREMIFDVFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNF  308

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF  +++KVYL
Sbjct  309   AQRNQLPHRLQDQMLAHLCLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLIDKVYL  368

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G VE++  +   EQVV  
Sbjct  369   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVELLVLKNGAEQVVGE  428

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  429   AKTGDLCGEIGVLCYKPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  488

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K++ D  +  + ++I +    G  ++ +++    A G+   L++LLK G+DPN  D+  +
Sbjct  489   KEINDPIMEGVLVDIENMLARGRMDLPVSVCFAAARGDDLLLHQLLKRGMDPNESDNNRR  548

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAAS+G + CV++LL +G + +++D+EGN  LW+AI     S+  +L    +    
Sbjct  549   TALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLLSENGANLQC  608

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHG--LHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                G   C AA+ N  ++++E++++G  + + +    G+TA+  A+ E   + +K L+ +
Sbjct  609   GDVGQFACTAAEQNSLNLLKEIMRYGGDITLPNSSNTGTTALHVAVSEGNVETVKFLLDH  668

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRE----------------------------LGHRIAM  459
             GA ID   K    P DL +     E                            LG   + 
Sbjct  669   GASIDMPDKHGWTPRDLADQQAHTEIKALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSE  728

Query  458   PNTIL------HEAASKWAKDDHQNSSSMPQQCS---------IRVSIYRGHP-------  345
             P   L      H     W+++  QN S  P++ S         I  + + G         
Sbjct  729   PTMTLPLDGSFHGTDGSWSQNQSQNQSR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVD  787

Query  344   ----------------ATRRETQCPEP----GRLIKLPETIAELISIAGEKLGFDATDSS  225
                              TR    CPE     G+L+ LP +  EL+ I  +K GF    + 
Sbjct  788   MNNNARNGMKSSSAVGPTRVIISCPEKGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNK  845

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVA  150
             +  ++G  I+ I++IRD D L  + 
Sbjct  846   VVCKDGGEIEDIEIIRDGDHLVFLG  870



>ref|XP_010510883.1| PREDICTED: potassium channel AKT1-like [Camelina sativa]
Length=864

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/849 (41%), Positives = 491/849 (58%), Gaps = 69/849 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP D +YR WE ++V+LV Y+ WV P
Sbjct  23    RESSHFSL---STGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVVLVVYTCWVSP  79

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T L++  RK IA +YL +W
Sbjct  80    FEFGFLR-KPRPPLSITDNIVNAFFAMDIIMTFFVGYLDKSTYLIVDDRKLIAFKYLRSW  138

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E  A   + +      Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  139   FLLDLVSTIPSE-AAMRISSQ-----SYGLFNMLRLWRLRRVGALFARLEKDRSFNYFWV  192

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R     K W+G+ N    EESL +RY+++MYWS+T
Sbjct  193   RCAKLVCVTLFAVHCAACFYYLIAARNHDPAKTWIGASNKNFLEESLWMRYVTSMYWSIT  252

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  253   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  312

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  313   SNFAHRNHLPVRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  372

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
              YLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  ++ID +   E +
Sbjct  373   AYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLIDVDSGTETI  432

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             +  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  433   IKEVKAGDIVGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  492

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K + D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  493   QHLKDMNDPVMTNVLLETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDN  552

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL++  + + +D EG+  LW+A+      +  +L    S 
Sbjct  553   NGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVLLENGST  612

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+     +++E++ HG  V      G++A+  A+ E   +M+K L+ 
Sbjct  613   IDAGDVGHFACTAAEQGHLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLD  672

Query  557   NGAEIDDAVKLNLAPLDLTE-----------------------------VLQK--RELGH  471
              GA+++          DL E                             +L+   R LG 
Sbjct  673   QGADVNKQDMHGWTARDLAEQQGHEDIKALFREKLHQRRVHIETSSSVPILKNGIRFLGR  732

Query  470   RIAMPNT---------ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSIYR-GHPA  342
               + PN           + E  ++   ++  NS        S+P+     V   R G+  
Sbjct  733   FTSEPNIRPASREVSFRIRETRARRKTNNFDNSLFGILANQSVPKNGLATVDEGRTGNHP  792

Query  341   TRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
              R    C E     G+L+ L  +  EL+ +   K G  A    ++ +  A ID +DVIRD
Sbjct  793   VRVTISCAEKDEVAGKLVLLSGSFKELLELGSNKFGIVAA-KVMSKDNNAEIDDVDVIRD  851

Query  173   NDKLFIVAD  147
              D L   +D
Sbjct  852   GDHLIFASD  860



>ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like isoform X1 [Vitis vinifera]
Length=872

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/680 (48%), Positives = 440/680 (65%), Gaps = 10/680 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+        +  ++SP D RYR WET++VLLV Y+AWV P
Sbjct  22    QLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K +  L + DN+V+ FFAVDIVLTFFVAY+D TT LL+ + K+IA +Y STW
Sbjct  82    FEFGFLK-KPEAPLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWV
Sbjct  141   LAFDVISTIPSELARKITPSPFQ---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY LA RY    K W+G+   N  E+SL IRY++A+YWS+T
Sbjct  198   RCAKLICVTVFAVHCAACFYYLLAARYHDPQKTWIGASMNNFLEQSLWIRYVTAIYWSIT  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  258   TLTTVGYGDLHPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  318   SSFAQRNQLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLLDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+ED+I+QNE+P D YI+VSG ++++  +   EQV
Sbjct  378   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDLILQNEAPTDFYIVVSGALDLLVLKNGTEQV  437

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N L
Sbjct  438   VGEAKTGDLCGEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIVQANVGDGTIIMNNLL  497

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDS  918
             QH K LKD  +  + +E  +      M + L    AT  G+   L++LLK GLDPN  DS
Sbjct  498   QHLKDLKDPIMEGVLVETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNESDS  557

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG E CV++LL +G   + +D EG   LW+A+     S+  +L    + 
Sbjct  558   NGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLLVDNGAN  617

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              +    G   C AA++ + +++++++ +G  V   +  G+TA+ AA+ E   +M+K L+ 
Sbjct  618   INSGDVGHFACTAAELKNLNLLKQIVHYGGDVTQPNNTGNTALHAAVCEENIEMVKFLLD  677

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA+ID        P DL +
Sbjct  678   QGADIDRTNDHGWTPRDLAD  697



>ref|NP_001268010.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
 emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
 emb|CBW30482.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
Length=898

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/855 (42%), Positives = 497/855 (58%), Gaps = 74/855 (9%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             +D S   ++  ILP LG+      + +  ++SP D+RYR WET++V LV Y+AWV PFE 
Sbjct  31    DDASHFSVTSAILPSLGARSNRRINLRRFIVSPFDARYRLWETYLVFLVFYTAWVSPFEF  90

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+      L + DN+V+ FFA+DI+LTFFVAY+D +T LL+ + K IA RY  TW   
Sbjct  91    GFLKEP-KGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRYTKTWLAF  149

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  150   DVISTIPSELARKILPKPLK---EYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWVRCA  206

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY L  ++    K WLG +  ++   SL  RY+++MYWS+TT+T
Sbjct  207   KLICVTLFAVHCAGCFYYLLGSQHGDPKKTWLGLVMGDLNTHSLWQRYVTSMYWSITTLT  266

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             T GYGDLHAVNT EM+F IFYM+FNLGLT+Y+IGNMTNLVV GT RT +FR+SIQAAS+F
Sbjct  267   TTGYGDLHAVNTREMVFDIFYMVFNLGLTSYLIGNMTNLVVHGTSRTRKFRDSIQAASSF  326

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++ LR +  +E L QQ  +E LPK I  SI H+LF  +V+KVYL
Sbjct  327   ALRNQLPVRLQDQMLAHLSLRHRTNSEGLQQQETLEVLPKAIRSSISHYLFYSLVDKVYL  386

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MK EY PP+ED+I+QNE+P D+Y++V+G VE+I+     EQVV  
Sbjct  387   FRGVSNDLLFQLVSEMKPEYFPPKEDIILQNEAPTDLYVLVTGVVELIERRNAIEQVVGE  446

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             + +GD+ GE+G LC RPQ FT RTK L QLL+L  T+LL  +Q    D   +I N LQH 
Sbjct  447   IRTGDVCGEIGVLCYRPQLFTARTKRLCQLLRLNRTALLNLVQANVGDGAIIINNLLQHL  506

Query  1082  kklkdlklgdLFIEIGDEDGDPNMS--INLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K+ K+  +  +  +I    G   M   ++L   V  G+   L++LLK GLDPN  DS G+
Sbjct  507   KEHKNPVMEGVLADIESMLGQGRMELPLSLCFAVLRGDDLLLHQLLKRGLDPNELDSNGR  566

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             TPLHIAASKG E+C  +LL++G N + KD EG   LWDAI  ++ S+  +L    +    
Sbjct  567   TPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLLMDNGAKIPL  626

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                G   C A + N+  ++++L++ G  V      G+TA+ AA  E   +++K L+  GA
Sbjct  627   SNVGQYACTAVERNNLDLLKDLVRFGGDVTHPSSSGTTALHAATSEANIEIVKFLLDQGA  686

Query  548   EIDDAVKLNLAPLDLTE--------VL--QKRELGHRIAMPNT-----------------  450
             ++D        P  L +        VL   KRE      +P T                 
Sbjct  687   DVDKLDNDGWTPRTLADQQGHEEIKVLFQTKRETKKLTPVPATKKPGVPFLGKFKSDSYL  746

Query  449   --ILHEAAS-----KWAKDDHQ-------NSSSMPQQCSIRVSIYRG-------------  351
                 H+  S      W  D+         N+S      S+     +G             
Sbjct  747   QPFQHDRESTGLEVSWIDDNRPRRRVNNFNNSLFGIMSSVNTRERKGFIRSAASFATSPR  806

Query  350   ---HPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                 PA R    CP+     G+L+ LP+++ EL+ I  +K  F  T   +  +E A ++ 
Sbjct  807   QRDFPA-RVTLSCPQKGEVAGKLVPLPQSLQELLDIGAKKFKFSPT--KVVTKERAEVED  863

Query  191   IDVIRDNDKLFIVAD  147
             I++IRD D L +V +
Sbjct  864   IELIRDGDHLILVGE  878



>ref|XP_009140622.1| PREDICTED: potassium channel AKT1 [Brassica rapa]
Length=860

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/847 (41%), Positives = 490/847 (58%), Gaps = 66/847 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP + +YR WE ++ +LV Y+AWV P
Sbjct  20    RESSHFSL---STGILPSLGARSNRRIKLKRFVVSPYNHKYRIWEAFLEVLVVYTAWVSP  76

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T LL+  RK IA +YL +W
Sbjct  77    FEFGFLR-KPRPPLSITDNIVNGFFAIDIIMTFFVGYLDKSTYLLVDDRKMIAFKYLRSW  135

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F++D+ STIP E VA   + +      Y +  MLR WR+RRV   F RLEKD  F+YFWV
Sbjct  136   FVLDLISTIPSE-VAMKISSQ-----SYGLFNMLRLWRVRRVGALFARLEKDRNFNYFWV  189

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY +A R+    K W+G+   N  +ESL +RY+++MYWS+T
Sbjct  190   RCAKLVCVTIFAVHCAACFYYLIAARHHDPAKTWIGASNANFHDESLWMRYVTSMYWSIT  249

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  250   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  309

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  310   SNFARRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  369

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++  +   E  
Sbjct  370   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVVQDGGTENA  429

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC +PQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  430   VKEVKAGDIIGEIGVLCYKPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  489

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K++ D  +  + +E  +    G  ++ INLF      +   L++LLK G DPN  D+
Sbjct  490   QHLKEMNDPVMASVLLETENMLAKGKLDLPINLFFAAMREDDLLLHQLLKRGQDPNESDN  549

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV+ LL++  + + +D EGN  LW+A+      I  +L    + 
Sbjct  550   NGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVLLEHGAT  609

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              +    G   C AA+  +  +++E+++HG  V      G++A+ AA+ E   +M+K L+ 
Sbjct  610   IEAGDVGHFACTAAEQGNLKLLKEIVRHGGDVTRPRATGTSALHAAVCEGNIEMVKYLLE  669

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPN---TILHEAAS----KWAKDDHQNS  399
              GA+++     N    DL +     E+       N   T +  +AS    K A+      
Sbjct  670   QGADVNKQDMHNWTAKDLADQQGHEEIKALFREKNNERTHIESSASVPILKTARRFLGRG  729

Query  398   SSMP------QQCSIRVSIYRGHPAT---------------------------------R  336
             +S P      ++ S R++  R    T                                 R
Sbjct  730   TSEPNIRPPSREVSFRITETRPRRKTNNFDNSLFGILASQNVQKNGLATVDESRVVNQVR  789

Query  335   RETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDND  168
                 C E      +L+ LP +  EL+ +   K G  A      D+  A ID +DVIRD D
Sbjct  790   VTISCKEKDEVAVKLVLLPGSFKELLELGSSKCGIVAARVMSKDQNMAEIDDVDVIRDGD  849

Query  167   KLFIVAD  147
              L    D
Sbjct  850   HLIFATD  856



>ref|NP_001055614.1| Os05g0428700 [Oryza sativa Japonica Group]
 dbj|BAF17528.1| Os05g0428700, partial [Oryza sativa Japonica Group]
Length=566

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 410/554 (74%), Gaps = 23/554 (4%)
 Frame = -2

Query  1748  FIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILA  1569
             F IFYMLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV RNHLP RLK+QILA
Sbjct  1     FNIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFVGRNHLPPRLKQQILA  60

Query  1568  YMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKA  1389
             YMCL+F+AESLNQQ L++QLPK+ICK IC +LFLPVV+ VYLFKGVSRE+LLL+V  MK 
Sbjct  61    YMCLKFRAESLNQQQLMDQLPKSICKGICEYLFLPVVKDVYLFKGVSREVLLLMVTKMKP  120

Query  1388  EYIPPREDVIMQNESPDDVYIIVSGEVEMI--DNEMENEQVVWTLNSGDMFGEVGALCCR  1215
             EYIPP+EDVI+QNE+PDDVYI+VSGEVE+I  D E E E+VV TL +  +FGEV AL  R
Sbjct  121   EYIPPKEDVIVQNEAPDDVYIVVSGEVEVIYSDGEAE-ERVVATLGTRGVFGEVSALSDR  179

Query  1214  PQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIG  1035
             PQSFT RT+TL QLL+L+  +L EA+Q K ED++ +IKNFL+H  ++ D+K+ DL  E  
Sbjct  180   PQSFTLRTRTLCQLLRLRQAALKEAMQSKPEDSVVIIKNFLKHQIEMHDMKVEDLLGEDA  239

Query  1034  DEDGD-PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMV  858
               + D  N+  NL TV ATGN++FL +LLK G+DP++GDSKG+T LHIAASKG+E+CV+V
Sbjct  240   AGEYDHGNIPCNLLTVAATGNSSFLEDLLKVGMDPDVGDSKGRTALHIAASKGYEDCVLV  299

Query  857   LLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP-YVAGDLLCKAAKMNDS  681
             LLK  CN+++KD +GNTALW+AIAA+ H IF+ILYH+A +S P + AGDLLC AA+  D 
Sbjct  300   LLKQACNVNIKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDL  359

Query  680   SVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------  522
               ++ELLKHGL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       
Sbjct  360   DTLRELLKHGLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAA  419

Query  521   LAPLDLTEVLQKRELGHRI---------AMPNTILHEAASKWAKDDHQNSSSMPQQCSIR  369
             ++  +L E+++ REL H +         A    I    +S  +++  + S+        R
Sbjct  420   VSVDELRELMKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPR  479

Query  368   VSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  189
             VSIYRGHP  R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSI
Sbjct  480   VSIYRGHPFVRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSI  537

Query  188   DVIRDNDKLFIVAD  147
             DVIRDNDKLFIV +
Sbjct  538   DVIRDNDKLFIVTE  551



>emb|CBI28150.3| unnamed protein product [Vitis vinifera]
Length=872

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/680 (48%), Positives = 439/680 (65%), Gaps = 10/680 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+        +  ++SP D RYR WET++VLLV Y+AWV P
Sbjct  22    QLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K +  L + DN+V+ FFAVDIVLTFFVAY+D TT LL+ + K+IA +Y STW
Sbjct  82    FEFGFLK-KPEAPLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWV
Sbjct  141   LAFDVISTIPSELARKITPSPFQ---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY LA RY    K W+G+   N  E+SL IRY++A+YWS+T
Sbjct  198   RCAKLICVTVFAVHCAACFYYLLAARYHDPQKTWIGASMNNFLEQSLWIRYVTAIYWSIT  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  258   TLTTVGYGDLHPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  318   SSFAQRNQLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLLDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+ED+I+QNE+P D YI+VSG ++++  +   EQ 
Sbjct  378   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDLILQNEAPTDFYIVVSGALDLLVLKNGTEQA  437

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             +    +GD+ GE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N L
Sbjct  438   IGEAKTGDLCGEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIVQANVGDGTIIMNNLL  497

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDS  918
             QH K LKD  +  + +E  +      M + L    AT  G+   L++LLK GLDPN  DS
Sbjct  498   QHLKDLKDPIMEGVLVETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNESDS  557

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG E CV++LL +G   + +D EG   LW+A+     S+  +L    + 
Sbjct  558   NGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLLVDNGAN  617

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              +    G   C AA++ + +++++++ +G  V   +  G+TA+ AA+ E   +M+K L+ 
Sbjct  618   INSGDVGHFACTAAELKNLNLLKQIVHYGGDVTQPNNTGNTALHAAVCEENIEMVKFLLD  677

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA+ID        P DL +
Sbjct  678   QGADIDRTNDHGWTPRDLAD  697



>ref|XP_010670702.1| PREDICTED: potassium channel AKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=880

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/841 (41%), Positives = 497/841 (59%), Gaps = 69/841 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  +LP LGS      + +  +ISP  S YR WE ++VLLV Y+AWV P+E  FL++ +
Sbjct  41    LSNGLLPSLGSRSHRRIALRPYIISPFRSEYRIWEGFLVLLVLYTAWVSPYEFGFLQTPI  100

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DNIV+ FFA+DI+LTFFVAY+DP T LL+   KKIA +Y+STWF+ D+ STIP
Sbjct  101   -RGLAIADNIVNGFFAIDILLTFFVAYLDPQTYLLVDDHKKIAWKYVSTWFIFDIVSTIP  159

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E V  +          Y +  MLR WR+RRVS  F+RLEKD   SYFW+RC +L+FVTL
Sbjct  160   SEAVEKILPDAIQ---AYGLFNMLRLWRVRRVSKMFSRLEKDRNISYFWIRCLKLVFVTL  216

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               +HCA C YY++AD YP   K W+G    +  +E L +RY+ ++YW++TT++T GYGDL
Sbjct  217   FALHCASCFYYYIADHYPDPNKTWIGLAIGDFHKEDLSLRYVMSVYWAITTLSTTGYGDL  276

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H VN  EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP
Sbjct  277   HPVNMREMVFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFALRNRLP  336

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL++Q++A++CL+++  +E L QQ +++ LPK I  SI H LF  +++ VYLF+GVS +
Sbjct  337   VRLQDQMVAHLCLKYRTDSEGLQQQEVLDSLPKAIKSSISHFLFYSLLDHVYLFRGVSND  396

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++ KAEY PP+EDVI+QNE+P D+Y++VSG +E I+N+   EQVV  ++SG + 
Sbjct  397   LLFQLVSETKAEYFPPKEDVILQNEAPTDLYVLVSGAMEFINNKNGGEQVVDEVSSGGIC  456

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL+L  T LL  +Q    D   ++ N L+H K   D  
Sbjct  457   GEIGVLCYRPQLFTVRTKRLCQLLRLNRTVLLNLVQANVGDGAIIMNNLLEHLKGQHDPL  516

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  +  +I +    G  ++ ++L    A G+   L  LL+ G DPN  D  G+T LHIAA
Sbjct  517   MQSVLRDIENMLAHGRMDLPLSLCFAAARGDEPLLQHLLRRGSDPNEADMNGRTALHIAA  576

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL-  711
             + G E C +VLL +G + + KD EGN  LWDAI  +  ++  +L    +      +GD+ 
Sbjct  577   ANGSEHCAIVLLAYGADPNTKDSEGNVPLWDAIMGRHEALIKLLVDQGAT---LASGDVP  633

Query  710   --LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
                C A + ++  ++++++++G  V +   +G TA+ AA       ++K L+  GA+ID 
Sbjct  634   QYACHAVEEDNFELLKDVVRYGGDVTAPKSNGFTALHAAASHGNPTIVKFLLKQGADIDK  693

Query  536   AVKLNLAPLDLTEV---------------------------------LQKRELGHRIAMP  456
             +      P  L ++                                 L+K ++      P
Sbjct  694   SDLNGWTPRGLADLHGHEEIKALFRSKEEASVQSVITVHGKESGPTFLKKLKVDSMDVTP  753

Query  455   NTILHEAASKWAK---DDHQNS------------SSMPQQCSIRVSIYRGHPATRRETQC  321
              T     A K  +   +  +NS            SS  ++ S   S + G    R   +C
Sbjct  754   RTREVTWADKQPRRRVNSFRNSLFGFMSAATRVESSQTERGSFSNSPFSGVQPARVILRC  813

Query  320   PEPG---RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
             P  G   +L+ LPETI EL+ I  +K G+  T    +D  GA ID I+++RD D L ++ 
Sbjct  814   PGKGDATKLVILPETIPELLEIGTKKFGWRCTKVVTSD--GAEIDEIELVRDGDLLCLIC  871

Query  149   D  147
             +
Sbjct  872   E  872



>ref|XP_008242715.1| PREDICTED: potassium channel AKT1 [Prunus mume]
Length=889

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/661 (48%), Positives = 439/661 (66%), Gaps = 10/661 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGS-SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             D S   LS  ILP LG+ S          ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  25    DGSQYSLSTGILPSLGARSSNRRVKLSRFIVSPYDRRYRGWETYLVVLVIYTAWVSPFEF  84

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+      L +VDN+V+ FFAVDIVLTFFVAY+D +T LL+   K+I  +Y  +WFL 
Sbjct  85    GFLKGP-GGPLSIVDNVVNGFFAVDIVLTFFVAYLDKSTYLLVDDHKRIGWKYARSWFLF  143

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +F         Y V  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  144   DVISTIPSELATKIFPKSVQ---SYGVFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  200

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTTV  1791
             +L+ VTL  +HCAGC YY LA RY    K W+G + + EE++ IRY++++YWS+TT+TTV
Sbjct  201   KLICVTLFAIHCAGCFYYLLAARYRDPQKTWMG-VEILEENMWIRYVTSVYWSITTLTTV  259

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLH VNT EMIF I YMLFNLGLT+Y+IGNMTNLVV GT RT +FR++IQAAS+F  
Sbjct  260   GYGDLHPVNTREMIFDIVYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQ  319

Query  1610  RNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFK  1437
             RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYLF 
Sbjct  320   RNQLPGRLQDQMLAHLCLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYSLVDKVYLFH  379

Query  1436  GVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN  1257
             GVS ++L  LV++MKAEY PP+ED+I+QNE+P D Y++V+G  +++  +   EQV+  + 
Sbjct  380   GVSNDLLFQLVSEMKAEYFPPKEDIILQNEAPTDFYVLVTGVADLVVLKNGVEQVIGEVK  439

Query  1256  SGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkk  1077
             +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K 
Sbjct  440   AGDLIGEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQANVGDGTVIMNNLLQHLKD  499

Query  1076  lkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTP  903
              KD  +  + +E  +    G  ++ ++L    + G+   L++LL+ GLDPN  D+ G+T 
Sbjct  500   QKDPIMEGVLLETENMLARGRMDLPLSLCFAASRGDDLLLHQLLRRGLDPNESDNNGRTA  559

Query  902   LHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV  723
             LHIA++KG E CV++LL  G + + KD +GN+ LW+AI      I  +L    +  +   
Sbjct  560   LHIASAKGSENCVLLLLDFGADPNSKDTDGNSPLWEAIQNGHEPIAKLLQDNGADFNSGD  619

Query  722   AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  543
              G   C AA+ N   +++E++ HG  V     +G+TA+ AA+ E+  +++K L+  GA+I
Sbjct  620   VGQFACSAAEQNRVDLLKEIVGHGGDVTRPKANGTTALHAAVSEDNVEVVKFLLDQGADI  679

Query  542   D  540
             D
Sbjct  680   D  680



>ref|XP_010049960.1| PREDICTED: potassium channel AKT1 [Eucalyptus grandis]
Length=873

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/827 (42%), Positives = 490/827 (59%), Gaps = 54/827 (7%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             L+  ILP LG+        +  ++S +D RYR WE ++VLLV Y+AW  PFE  FL+ K 
Sbjct  38    LATGILPSLGARSNRAVQLRSFIVSSLDRRYRIWENFLVLLVVYTAWASPFEFGFLK-KP  96

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L ++DN+V+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY ++WF +DV STIP
Sbjct  97    KPPLSIIDNVVNGFFAIDIVLTFFVAYLDKATYLLVDDPKKIAWRYTTSWFALDVISTIP  156

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +    H     Y +  MLR WRLRRVS  F+RLEKD  ++YF +RCA+LL VT+
Sbjct  157   SELAQKI---SHSPLGGYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFVLRCAKLLCVTV  213

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
               VHCAGC YY LA R     + W+G   + ++ L IRY++++YWS+TT+TTVGYGDLH 
Sbjct  214   FAVHCAGCFYYLLAARNHDPAETWMGKA-ILQDGLGIRYVTSLYWSITTLTTVGYGDLHP  272

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN  EM+F IF+MLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP R
Sbjct  273   VNVREMLFDIFFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFGQRNQLPPR  332

Query  1589  LKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
             L++Q+LA++CL+++  +E L Q+  ++ LPK I  SI H+LF  +V++VYLF+G+S ++L
Sbjct  333   LQDQMLAHLCLKYRTDSEGLRQKETLDSLPKAIRSSILHYLFYNIVDRVYLFRGISNDLL  392

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
               LV++MK EY PP EDVI+QNE+P D YI+V+G V+++  +   EQ V    SGD+ GE
Sbjct  393   FQLVSEMKDEYFPPNEDVILQNEAPTDFYILVTGAVDLLVVKNGTEQPVGEAKSGDICGE  452

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             +G LC RPQ FT RTK LSQLL+L  T+    +Q   ED   ++ N LQH K LKD  + 
Sbjct  453   IGILCYRPQLFTVRTKRLSQLLRLNRTTFFNIIQSNVEDGTIIMNNLLQHLKDLKDPTME  512

Query  1055  dLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
              + I+  +    G  ++ ++L      G+   L++LL+ GLDPN  D+ G+TPLHIAASK
Sbjct  513   SILIDAENMLAHGQLDLPLSLCFATLRGDNLMLSQLLRRGLDPNESDNSGRTPLHIAASK  572

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCK  702
             G E C ++LL +G + + +D EGN  LW+AI      +  +L    +       G   C 
Sbjct  573   GSENCALLLLDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLLAENGANLVSGDVGQFSCT  632

Query  701   AAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN  522
             AA+ N+  +++E+ ++G  V     +G+TA+  A+ E+  +++K L+  GA+I+      
Sbjct  633   AAEQNNLDLLKEISRYGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHG  692

Query  521   LAPLDLTEVLQKRELG------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQ----  384
               P DL +     E+G          M   I  E     AS+    D     S P+    
Sbjct  693   WTPRDLADQQGHEEIGILFQSIKETEMLPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTS  752

Query  383   ----------------QCSIRVSI---------YRGHPATRRETQCPE----PGRLIKLP  291
                             +  + +SI         +   PA R    CPE     G+L+ LP
Sbjct  753   NFHNSLFGIMSAARDGEGDVLLSINHNKSANKSFVARPAIRVVVSCPEVGDVEGKLMLLP  812

Query  290   ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
             E   EL+ +A +K G   T   +  + GA ID + VIRD D L  ++
Sbjct  813   ENFQELLEMARKKFGL--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|XP_006408729.1| hypothetical protein EUTSA_v10001904mg [Eutrema salsugineum]
 gb|ESQ50182.1| hypothetical protein EUTSA_v10001904mg [Eutrema salsugineum]
Length=856

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/859 (40%), Positives = 496/859 (58%), Gaps = 89/859 (10%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  ++SP D +YR WE ++V+LV Y+AWV P
Sbjct  20    RESSHFSL---STGILPSLGARSNRRVKLKRFIVSPYDHKYRIWEAFLVVLVVYTAWVSP  76

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T LL+  RK IA +YL +W
Sbjct  77    FEFGFLR-KPRPPLSITDNIVNGFFAIDIIMTFFVGYLDKSTYLLVDDRKMIAIKYLRSW  135

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E    + T        Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  136   FLLDLVSTIPSEVAMRISTQS------YGLFNMLRLWRLRRVGALFARLEKDRNFNYFWV  189

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R     K W+G+ N    EESL +RY+++MYWS+T
Sbjct  190   RCAKLICVTLFAVHCAACFYYLIAARNHDPVKTWIGASNENFLEESLWMRYVTSMYWSIT  249

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF+IFYM FNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  250   TLTTVGYGDLHPVNTKEMIFVIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  309

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  310   SNFARRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  369

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++  +   E  
Sbjct  370   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVIFDTGIETA  429

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC RPQ +T RTK L QLL++  TS L  +Q    D   ++ N L
Sbjct  430   VKEVKAGDIIGEIGVLCYRPQLYTVRTKRLCQLLRMNRTSFLNIIQANVGDGTIIMNNLL  489

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K++ D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  490   QHLKEMNDPVMANVLLETENMLARGKLDLPLNLCFAAIREDDLLLHQLLKKGLDPNDSDN  549

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHI+ASKG   CV++LL +  + + +D EGN  LW+A+      +  +L      
Sbjct  550   NGRTPLHISASKGSLNCVLLLLDYHADPNCRDAEGNVPLWEAMVEGHERVVKVLLENGGT  609

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                   G   C AA+ ++  +++E+++HG  V      G++A+ AA+ E   +M+K L+ 
Sbjct  610   IKAGDVGHFACTAAEQSNLKLLKEIVRHGGDVTRPRATGTSALHAAVCEGNIEMVKYLLE  669

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKRELGHR--IAMPNTILHEAASKWAKDDHQNSSSMP-  387
              GA+++          DL E     + GH    A+    +HE A        ++S+S+P 
Sbjct  670   QGADVNKQDMHGWTARDLAE-----QQGHEDIKALFREKIHERAHI------ESSASVPI  718

Query  386   ---------------------QQCSIRVS-----------------------IYRGHPAT  339
                                  +  S R++                       +++   AT
Sbjct  719   LKSGIRFLGRFTSEPNIRPPSRDVSFRITETRPRRKTNNFDNSLFGILANQNVHKNGLAT  778

Query  338   RRETQCPEP--------------GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAI  201
               E +   P              G+L+ LP +  EL+ +  +K G  A    ++ +  A 
Sbjct  779   VEEGRAENPVRVTISCTGKDEVAGKLVLLPGSFKELLELGSKKFGIVAA-KVMSKDNNAE  837

Query  200   IDSIDVIRDNDKLFIVADW  144
             ID +DVIRD D+L    ++
Sbjct  838   IDDVDVIRDGDQLIFATEF  856



>ref|NP_001105480.1| potassium channel5 [Zea mays]
 emb|CAA68912.1| potassium channel [Zea mays]
Length=887

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/860 (41%), Positives = 503/860 (58%), Gaps = 87/860 (10%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   +S  ILP LG+        +  ++SP   RYRCWET++++LV YSAWV PFE  
Sbjct  28    DGSHYSISSGILPSLGARSNRRVKLRPFIVSPYADRYRCWETFLIILVVYSAWVSPFEFG  87

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++ K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++D
Sbjct  88    FIQ-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVLD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+
Sbjct  147   VASTIPSEFARKILPPDLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCAK  203

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHC+ C YY LAD YP     W+G+   +  +  L IRY+ ++YWS+TT+TT
Sbjct  204   LICVTLFAVHCSACFYYLLADMYPTPTDTWIGNSMPDFHQRGLWIRYVVSVYWSITTLTT  263

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLHA NT EMIF I YMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F 
Sbjct  264   VGYGDLHAENTREMIFNILYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSFA  323

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP+RL++Q+++++CL+F+  +E L QQ  ++ LPK I  SI  +LF  +V+KVYLF
Sbjct  324   LRNQLPSRLQDQMMSHLCLKFRTDSEGLQQQETLDVLPKAIRSSISQYLFFNLVQKVYLF  383

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             +GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+V G  E+I+ +   EQ+V   
Sbjct  384   EGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVIGSAELIELQNGGEQMVGVA  443

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF---LQ  1089
              +GD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ N    L+
Sbjct  444   KAGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLIRLLK  503

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
                    +       E     G  ++ + L   V  G+   L++LLK GLDPN  D+ G 
Sbjct  504   QQNDNSVMMGVLKEYENMLARGRLDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNGH  563

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH-WASISD  732
             T LHIAASKG E+CV +LL+HG + + +D EG   LW+A+  K++ +  +L    A +S 
Sbjct  564   TALHIAASKGDEQCVKLLLEHGADPNARDSEGKVPLWEALCEKQNPVVELLVQSGAGLS-  622

Query  731   PYVAGDLL---CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
                +GD+    C A + ND  +++ ++++G +V+S  + G+T +  A+ +    M++LL+
Sbjct  623   ---SGDVALYSCVAVEENDPELLENIIRYGGNVNSSMKDGTTPLHRAVCDGNVQMVELLL  679

Query  560   MNGAEIDD----------------------------------AVKLNLAPLDL-------  504
              +GA+ID                                   A K  +AP+ +       
Sbjct  680   EHGADIDKQDNNGWSARALADQQGHDDIHSLSRSRKAHRQQHASKGTVAPVPIWRFNSEP  739

Query  503   --------------TEVLQKRELGHRIAMPNTILHEAASKWAKDDHQN--SSSMPQQCSI  372
                            +V+ ++ L  R++  N++    +S  A+ D     S  +    S 
Sbjct  740   TMPNIKHEEDAELRGKVVPQKLLRKRVSFQNSLFGVISSSHARQDTGRLLSKGLAGPGSP  799

Query  371   RVSIYRGHPATRRET-QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEG  207
               S    H +  R T  CPE     G+L+ LP ++ E++ +   K GF  T    T   G
Sbjct  800   GCS----HGSLVRVTIGCPEKGNAAGKLVLLPRSMTEVLELGARKFGFKPTKVLTTG--G  853

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A ID +++IRD D + +V+D
Sbjct  854   AEIDEVELIRDGDHVVLVSD  873



>ref|XP_009348193.1| PREDICTED: potassium channel AKT1 [Pyrus x bretschneideri]
Length=881

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/676 (47%), Positives = 438/676 (65%), Gaps = 10/676 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQG-LVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
              D S   L+  ILP LG+         G  ++SP D RYR WET++V+LV Y+AWV PFE
Sbjct  25    RDGSQYSLTTGILPSLGARSSNRRIKLGRFIVSPYDRRYRIWETFLVVLVIYTAWVSPFE  84

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+      L +VDN+V+ FFA+DI+LTFFVAY+D TT LL+  RKKI  +Y  +W +
Sbjct  85    FGFLKGP-GGPLSIVDNVVNGFFAIDIILTFFVAYLDKTTYLLVDDRKKIGWKYARSWLI  143

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV STIP E    +F         Y    MLR WRLRRVS  F+RLEKD  ++YFWVRC
Sbjct  144   FDVISTIPSELATRIFPKSVQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  200

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTT  1794
             A+L+ VTL  +HCAGC YY +A RY    K W+G + + E+SL IRY++++YWS+TT+TT
Sbjct  201   AKLICVTLFAIHCAGCFYYLIAARYRDPAKTWIG-VKILEQSLWIRYVTSVYWSITTLTT  259

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH VNT EMIF IFYMLFNLGLT+Y+IGNMTNLVV GT RT +FR++IQAAS+F 
Sbjct  260   VGYGDLHPVNTREMIFDIFYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDTIQAASSFA  319

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q++A++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYLF
Sbjct  320   QRNQLPVRLQDQMVAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDKVYLF  379

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV+   
Sbjct  380   HGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLVVLKNGAEQVIGEA  439

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              SGD+ GE+G LC RPQ FT RTK L+QLL+L  T+ L  +Q    D   ++ N LQH K
Sbjct  440   KSGDLIGEIGVLCYRPQLFTVRTKRLTQLLRLNRTTFLNIVQANVGDGTVIMNNLLQHLK  499

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
              LKD  +  +  E       G  ++ ++L      G+   LN+LLK GLDPN  D+ G++
Sbjct  500   DLKDPIMEGVLSETETMLARGRMDLPLSLRFAAIRGDDLLLNQLLKRGLDPNESDNNGRS  559

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIA+ KG E CV++LL  G + + +D +GN  LW AI      I  +L    +  +  
Sbjct  560   ALHIASLKGSENCVLLLLDDGADPNSRDSDGNVPLWAAILNGHEQIAKLLLDNGANLNSG  619

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
               G+  C AA+ N   +++E+++HG  V     +G+TA+  A+ E+  D++K L+  GA+
Sbjct  620   DIGEFACTAAEQNRLDLLKEIVRHGGDVTRPKSNGTTALHVAVSEDNVDIVKYLLDQGAD  679

Query  545   IDDAVKLNLAPLDLTE  498
             +D        P  L E
Sbjct  680   VDKPDLHGWTPRALAE  695



>emb|CDY55714.1| BnaC04g37620D [Brassica napus]
Length=861

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/848 (41%), Positives = 488/848 (58%), Gaps = 67/848 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP + +YR WE ++V+LV Y+AWV P
Sbjct  20    RESSHFSL---STGILPSLGARSNRRIKLKRFVVSPYNHQYRIWEAFLVVLVVYTAWVSP  76

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DI++TFFV Y+D +T LL+  RK IA +YL +W
Sbjct  77    FEFGFLR-KPRPPLSITDNIVNGFFAIDIIMTFFVGYLDKSTYLLVDDRKMIAFKYLRSW  135

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F++D+ STIP E VA   + +      Y +  MLR WR+RRV  FF RLEKD  F+YFWV
Sbjct  136   FVLDLISTIPSE-VAMKISSQ-----SYGLFNMLRLWRVRRVGAFFARLEKDRNFNYFWV  189

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY +A R+    K W+G+   N  +ESL +RY+++MYWS+T
Sbjct  190   RCAKLVCVTIFAVHCAACFYYLIAARHHDPAKTWIGASNANFHDESLWMRYVTSMYWSIT  249

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  250   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  309

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  310   SNFARRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  369

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++M AEY PP+EDVI+QNE+P D YI+V+G  +++  +   E  
Sbjct  370   VYLFRGVSNDLLFQLVSEMNAEYFPPKEDVILQNEAPTDFYILVNGTADLVIQDGGTENA  429

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             +  + +GD+ GE+G LC +PQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  430   LKEVKAGDIIGEIGVLCYKPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  489

Query  1091  QHHkklkdlklgdLFI---EIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             Q H K  +  + +  +   E     G  ++ INLF      +   L++LLK G DPN  D
Sbjct  490   QQHLKEMNDPVMENVLLETENMLARGKLDLPINLFFAAMREDDLLLHQLLKRGQDPNESD  549

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
             + G+TPLHIAASKG   CV+ LL++  + + +D EGN  LW+A+      I  +L    +
Sbjct  550   NNGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVLLEHGA  609

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
               +    G   C AA+  +  +++E+++HG  V      G++A+ AA+ E   +M+K L+
Sbjct  610   TIEAGDVGHFACTAAEQGNLKLLKEIVRHGGDVTRPRATGTSALHAAVCEGNIEMVKYLL  669

Query  560   MNGAEIDDAVKLNLAPLDLTE----------------------------VLQ--KRELGH  471
               GA+++     N    DL +                            +L+  +R LG 
Sbjct  670   EQGADVNKQDMHNWTAKDLADQQGHEEIKALFREKKNQRTHIESSASVPILKTARRFLGR  729

Query  470   RIAMPNT---------ILHEAASKWAKDDHQN-------SSSMPQQCSIRVSIYRGHPAT  339
               + PN           + E   +   ++  N       S ++ +     V   R     
Sbjct  730   GTSEPNIRPPSREVSFRITETRPRRKTNNFDNSLFGILASQNVQKNGLATVDESRVVNQV  789

Query  338   RRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDN  171
             R    C E      +L+ LP +  EL+ +   K G  A      D+  A ID +DVIRD 
Sbjct  790   RVTISCKEKDEVAVKLVLLPGSFKELLELGSSKFGIVAARVMSKDQNMAEIDDVDVIRDG  849

Query  170   DKLFIVAD  147
             D L    D
Sbjct  850   DHLIFATD  857



>emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
Length=872

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/680 (48%), Positives = 438/680 (64%), Gaps = 10/680 (1%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+        +  ++SP D RYR WET++VLLV Y+AWV P
Sbjct  22    QLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAWVSP  81

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K +  L + DN+V+ FFAVDIVLTFFVAY+D TT LL+ + K+IA +Y STW
Sbjct  82    FEFGFLK-KPEAPLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTW  140

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV STIP E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWV
Sbjct  141   LAFDVISTIPSELARKITPSPFQ---SYGSFNMLRLWRLRRVSSLFARLEKDRNFNYFWV  197

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY LA RY    K W+G+   N  E+SL IRY++A+YWS+T
Sbjct  198   RCAKLICVTVFAVHCAACFYYLLAARYHDPQKTWIGASMNNFLEQSLWIRYVTAIYWSIT  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH  NT EMIF IFYM+FNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  258   TLTTVGYGDLHPENTREMIFDIFYMVFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  318   SSFAQRNQLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLLDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF+GVS ++L  LV++MKAEY PP+ED+I+QNE+P D YI+VSG ++++  +   EQV
Sbjct  378   VYLFRGVSNDLLFQLVSEMKAEYFPPKEDLILQNEAPTDFYIVVSGALDLLVLKNGTEQV  437

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+  LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N L
Sbjct  438   VGEAKTGDLCGEIEVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIVQANVGDGTIIMNNLL  497

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDS  918
             QH K LKD  +  + +E  +      M + L    AT  G+   L++LLK GLDPN  DS
Sbjct  498   QHLKDLKDPIMEGVLVETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNESDS  557

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG E CV++LL +G   + +D EG   LW+A+     S+  +L    + 
Sbjct  558   NGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLLVDNGAN  617

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              +    G   C AA++ + +++++++ +G  V   D  G+TA+ AA+ E   +M+K L  
Sbjct  618   INSGDVGHFACTAAELKNLNLLKQIVHYGGDVKQPDNTGNTALHAAVCEENIEMVKFLSD  677

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA+ID        P DL +
Sbjct  678   QGADIDRTNDHGWTPRDLAD  697



>ref|XP_008787403.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Phoenix 
dactylifera]
Length=881

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/863 (41%), Positives = 503/863 (58%), Gaps = 90/863 (10%)
 Frame = -2

Query  2519  QED--EDFSLGKLSKFILPPLGS-SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  2349
             Q+D   D S   +S  ILPPLG+ S       +  +ISP D RYR WE ++V+LVAY+AW
Sbjct  23    QQDLARDESHYSISSSILPPLGARSHHRRAKLRRFIISPYDRRYRAWEYFLVVLVAYTAW  82

Query  2348  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  2169
             V PFE  F+E K    L   DN+V+ FFA+DI+LTFFVAY+D  T LLI + ++IA RY+
Sbjct  83    VSPFEFGFIE-KASGALATADNVVNGFFAIDILLTFFVAYLDRATYLLIDNPEQIAWRYI  141

Query  2168  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSY  1989
             ++WF++DV STIP E V  +     H    Y +  MLR WRLRRVS  F +LEKD  F+Y
Sbjct  142   TSWFILDVISTIPSELVWKILPSNLH---SYGLFNMLRLWRLRRVSALFAQLEKDRNFNY  198

Query  1988  FWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYW  1815
             F VRCA+L  VT+  VHCAGC +Y +A RYP   K W+G+   +  ++S+ +RY+ +MYW
Sbjct  199   FMVRCAKLACVTVFAVHCAGCFFYLIAARYPDPNKTWIGASFPDFHDKSVWMRYVISMYW  258

Query  1814  SMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI  1635
             SMTT+TTVGYGDLH  NT EM+F IFYM FNLGLT+Y++GNMTNLVV GT RT +FR+++
Sbjct  259   SMTTVTTVGYGDLHPQNTREMLFDIFYMFFNLGLTSYLVGNMTNLVVHGTSRTRKFRDTL  318

Query  1634  QAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPV  1461
             QAAS F  RN LP RL++Q++A++CL+F+  +E L QQ  ++ LPK I  SI H LF  +
Sbjct  319   QAASGFAQRNQLPVRLQDQMVAHLCLKFRTDSEGLQQQETLDALPKAIRSSIAHFLFYSL  378

Query  1460  VEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMEN  1281
             V+ VYLF+GVS ++L  LV++MKAEY PPREDVI+QNE+P D YI+++G V         
Sbjct  379   VQNVYLFRGVSSDLLFQLVSEMKAEYFPPREDVILQNEAPTDFYILMNGSV---------  429

Query  1280  EQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
               +V    +GD+ GE+G LC RPQ FT RTK L QLL+L   + L  +Q    D   ++ 
Sbjct  430   --IVREAKTGDVVGEIGVLCYRPQRFTVRTKKLCQLLRLNRATFLSIVQSNVGDGTIIMN  487

Query  1100  NFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNI  927
             N +Q+ K+ KD  +  +  E  +    G  N+ + L   V  G+   L++LL+ GLDPN 
Sbjct  488   NLMQYMKEQKDPVMEGVLRETENMLARGPSNLPLTLCFAVTRGDDFLLSQLLRRGLDPNE  547

Query  926   GDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-H  750
               + G+T LH AA+KG+E CV +LL +G + + +D+EGN  LW+AI  K  ++  +L  +
Sbjct  548   ATNNGRTALHTAAAKGNENCVALLLDYGADPNSRDLEGNVPLWEAILGKHEAVIRLLIDN  607

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
              A IS   VA    C AA+ N   ++Q+++++G  V      G+TA+  A+ E    +++
Sbjct  608   GADISTGDVA-RFACMAAEQNSLELLQDIVRYGGDVTLAKNDGATALHHAVCEGNLQIVR  666

Query  569   LLVMNGAEIDDAVKLNLAPLDLTEVLQKREL--------------------GHRIAMPNT  450
              L+  G  ID       +P DL +     ++                      RI+ P  
Sbjct  667   FLIEQGESIDKPDIHGWSPRDLADQQGHEDIKALFQATKGCDSKTSKTPAAAARISSPTV  726

Query  449   ILHE--------AASKW----AKDDHQNSSS---------------------MPQQCSIR  369
              L+          A K+    + DDH+ SSS                     +P   + R
Sbjct  727   HLNAKFKSDPSMPAPKFMQESSGDDHRQSSSYFHNSLFGIMSAAHAGRSSCPLPAAPATR  786

Query  368   -VSIYRG----HPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTD  216
              V   RG    H   R    CPE G    +L+ LP ++ EL++I   K G     + +  
Sbjct  787   YVGGSRGPQHHHAPPRVTISCPEKGDAARKLVPLPRSLDELLNIGAXKFG--VLPAKVLT  844

Query  215   EEGAIIDSIDVIRDNDKLFIVAD  147
             ++GA ID++++IRD D L +V D
Sbjct  845   KDGAEIDNVNLIRDGDHLVLVGD  867



>ref|XP_003609240.1| Potassium channel [Medicago truncatula]
 gb|AES91437.1| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=888

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/677 (48%), Positives = 447/677 (66%), Gaps = 11/677 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   L+  ILP LG+        + L+ISP D RYR WET++V LV Y+AWV PFE  
Sbjct  18    DGSHYSLTTGILPSLGARSNRRVKLRPLIISPYDRRYRIWETFLVTLVVYTAWVSPFEFG  77

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             FL+ K    L V DNIV+ FFA+DIVLTFFVAYID TT L + + K+IA +Y  TWF++D
Sbjct  78    FLK-KPQKPLSVTDNIVNGFFAIDIVLTFFVAYIDKTTYLFVDNPKQIAWKYAKTWFVLD  136

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             + S IP E VA +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA+
Sbjct  137   LISIIPSELVAHISPAPMQ---TYGLFNMLRLWRLRRVSAMFSRLEKDRNYNYFWVRCAK  193

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHCAGC YY LA RY    K W+G    +  ++SL  RY++ +YWS+TT+TT
Sbjct  194   LICVTLFAVHCAGCFYYLLAARYHDPEKTWIGESMKDFLQQSLWTRYVTTIYWSITTLTT  253

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH VN  EMIF+IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F 
Sbjct  254   VGYGDLHPVNEREMIFVIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFA  313

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q+LA++CL+F+  +E L QQ  +E LPK I  SI H+LF  +++KVYLF
Sbjct  314   HRNQLPPRLQDQMLAHLCLKFRTDSEGLQQQETLESLPKAIRSSISHYLFYSLMDKVYLF  373

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
             KGVS ++L  LV++MK EY PP+EDVI+QNE+P D YI+V+G V+++  +   EQ+V   
Sbjct  374   KGVSNDLLFQLVSEMKPEYFPPKEDVILQNEAPTDFYILVTGAVDLVVLKGGVEQIVGEA  433

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +G++ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K
Sbjct  434   KTGELCGEIGVLCYKPQHFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLK  493

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             +L D  +  + +E  +    G  ++ ++L      G+   L +LLK GL+PN  D+ G+T
Sbjct  494   ELNDPIMEGVLVETENMLARGRMDLPVSLCFAAERGDDLLLQQLLKRGLEPNESDNNGRT  553

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIAA KG E CV++LL +G N +++D +GN ALW+AI     S+  +L    +     
Sbjct  554   ALHIAACKGKENCVLLLLDYGANPNIRDSDGNVALWEAILGGHESVTKLLAENGATLQIG  613

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRH-GSTAIQAAMEENQADMIKLLVMNGA  549
               G   C A + N+ +++Q+++++G  +   + + G+TA+  A+ E+  +++K L+ +GA
Sbjct  614   DVGQYACTAVEQNNFNLLQDIMRYGGDITLPNNNVGTTALHVAVSEDNVEIVKFLLEHGA  673

Query  548   EIDDAVKLNLAPLDLTE  498
              ID   K   +P DL +
Sbjct  674   NIDKQDKYGWSPRDLAD  690



>gb|AAL25649.1|AF197333_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/824 (42%), Positives = 491/824 (60%), Gaps = 56/824 (7%)
 Frame = -2

Query  2477  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             IL  LG+        +  ++S +D RYR WE ++VLLV Y+AW  PFE  FL+ K    L
Sbjct  42    ILLSLGARSNRAVQLRSFIVSSLDRRYRIWENFLVLLVVYTAWASPFEFGFLK-KPKPPL  100

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
              ++DN+V+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY ++WF +DV STIP E  
Sbjct  101   SIIDNVVNGFFAIDIVLTFFVAYLDKATYLLVDDPKKIAWRYTTSWFALDVISTIPSELA  160

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
               +    H     Y +  MLR WRLRRVS  F+RLEKD  ++YF +RCA+LL VT+  VH
Sbjct  161   QKI---SHSPLGGYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFVLRCAKLLCVTVFAVH  217

Query  1937  CAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTL  1758
             CAGC YY LA R     + W+G   +  + L IRY++++YWS+TT+TTVGYGDLH VN  
Sbjct  218   CAGCFYYLLAARNHDPAETWMGKA-ILHDGLGIRYVTSLYWSITTLTTVGYGDLHPVNVR  276

Query  1757  EMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQ  1578
             EM+F IF+MLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP RL++Q
Sbjct  277   EMLFDIFFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPPRLQDQ  336

Query  1577  ILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLV  1404
             +LA++CL+++  +E L Q+  ++ LPK I  SI H+LF  +V++VYLF+G+S ++L  LV
Sbjct  337   MLAHLCLKYRTDSEGLRQKETLDSLPKAIRSSILHYLFYNIVDRVYLFRGISNDLLFQLV  396

Query  1403  ADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGAL  1224
             ++MK EY PP EDVI+QNE+P D YI+V+G V+++  +   EQ V    SGD+ GE+G L
Sbjct  397   SEMKDEYFPPNEDVILQNEAPTDFYILVTGAVDLLVVKNGTEQPVGEAKSGDICGEIGVL  456

Query  1223  CCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFI  1044
             C RPQ FT RTK LSQLL+L  T+L   +Q   ED   ++ N LQH K LKD  +  + I
Sbjct  457   CYRPQLFTVRTKRLSQLLRLNRTTLFNIIQSNVEDGTIIMNNLLQHLKDLKDPTMESILI  516

Query  1043  EIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEE  870
             +  +    G  ++ ++L      G+   L++ L+ GLDPN  D+ G+TPLHIAASKG E 
Sbjct  517   DAENMVAHGQLDLPLSLCFATLRGDNLMLSQPLRRGLDPNESDNSGRTPLHIAASKGSEN  576

Query  869   CVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSIL-YHWASISDPYVAGDLLCKAAK  693
             C ++L+ +G + + +D EGN  LW+AI      +  +L  + A++    V G   C AA+
Sbjct  577   CALLLMDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLLALNGANLVSGDV-GQFSCTAAE  635

Query  692   MNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAP  513
              N+  +++E+ ++G  V     +G+TA+  A+ E+  +++K L+  GA+I+        P
Sbjct  636   QNNLDLLKEISRYGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTP  695

Query  512   LDLTEVLQKRELG------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQ-------  384
              DL +     E+G          MP  I  E     AS+    D     S P+       
Sbjct  696   RDLADQQGHEEIGILFQSIKETEMPPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFH  755

Query  383   -------------QCSIRVSI---------YRGHPATRRETQCPE----PGRLIKLPETI  282
                          +  + +SI         +   PA R    CPE     G+L+ LPE  
Sbjct  756   NSLFGIMSAARDGEGDVLLSINHNKSANKPFVARPAIRVVVSCPEVGDVEGKLMLLPENF  815

Query  281   AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
              EL+ +A +K G   T   +  + GA ID + VIRD D L  ++
Sbjct  816   QELLEMARKKFGL--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|XP_004508539.1| PREDICTED: potassium channel AKT1-like isoform X1 [Cicer arietinum]
Length=891

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/684 (47%), Positives = 442/684 (65%), Gaps = 14/684 (2%)
 Frame = -2

Query  2519  QEDEDFSLG----KLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  2352
             QE+ + SL      LS  ILP LG+        + L+ISP D RYR WET++V+LV Y+A
Sbjct  10    QEELELSLDGSHYSLSTGILPSLGAKSNRRVKLRPLIISPYDRRYRIWETFLVILVVYTA  69

Query  2351  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  2172
             WV PFE  FL  K    L + DNIV+ FF +DIVLTFFVAY+D TT L +   K+IA +Y
Sbjct  70    WVSPFEFGFLR-KPQAPLSITDNIVNGFFFIDIVLTFFVAYVDKTTYLFVDKPKQIAWKY  128

Query  2171  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFS  1992
               TW   DV S IP E V  L          Y +  MLR WRLRRVS  F+RLEKD  ++
Sbjct  129   ARTWLAFDVISIIPSELVVKLSPSPFQ---TYGLFDMLRLWRLRRVSALFSRLEKDRNYN  185

Query  1991  YFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLG--SLNVREESLKIRYISAMY  1818
             YFWVRCA+L+ VTL  VHCAGC YY +A RY    + W+G  S +  + SL  RY++ +Y
Sbjct  186   YFWVRCAKLICVTLFAVHCAGCFYYLIAARYHDPKRTWIGQTSEDFVQLSLWTRYVTTIY  245

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+TT+TTVGYGDLH VN  EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++
Sbjct  246   WSITTLTTVGYGDLHPVNEREMMFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDT  305

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLP  1464
             IQAAS+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  
Sbjct  306   IQAASSFAQRNQLPPRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYS  365

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
             +++ VYLFKGVS ++L  LV++MK EY PP+EDVI+QNE+P D YI+V+G VE++  +  
Sbjct  366   LMDNVYLFKGVSNDLLFQLVSEMKPEYFPPKEDVILQNEAPTDFYILVTGAVELLVLKGG  425

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              EQVV    +G++ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++
Sbjct  426   VEQVVGVAKTGELCGEIGVLCYKPQHFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIM  485

Query  1103  KNFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPN  930
              N L+H K+L D  +  + +E  +    G  ++ ++L    + G+   L++LLK GLDPN
Sbjct  486   NNLLKHLKELNDPIMEGVLVETENMLARGRMDLPVSLCFAASRGDDLLLHQLLKRGLDPN  545

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D+ G+T LHIAASKG E CV++LL +G N ++KD +GN ALW+AI      +  +L  
Sbjct  546   ESDNNGRTALHIAASKGKENCVLLLLDYGANPNIKDSDGNVALWEAILGGHELVGKLLIE  605

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
               +       G   C AA+ N+ ++++++ +HG  +   +  G+TA+  A+ E+  D++K
Sbjct  606   NGATLQNGDVGQYACTAAEQNNLNLLKDIRRHGGDITLTNSLGTTALHVAVSEDNVDIVK  665

Query  569   LLVMNGAEIDDAVKLNLAPLDLTE  498
              L+  GA ID   K    P DL +
Sbjct  666   YLLDQGANIDKPDKHGWTPRDLAD  689



>ref|XP_006371939.1| k transporter family protein [Populus trichocarpa]
 gb|ERP49736.1| k transporter family protein [Populus trichocarpa]
Length=877

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/855 (43%), Positives = 499/855 (58%), Gaps = 71/855 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+           +ISP D RYR WET++VLLV Y+AWV P
Sbjct  23    QLSRDGSHYSLSTGILPSLGARSNRRVKLNRFIISPYDRRYRIWETFLVLLVIYTAWVSP  82

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+    + L + DN+V+ FFAVDIVLTFFVAY+D  T LLI   KKIA +Y S+W
Sbjct  83    FEFGFLKQP-QSPLSICDNVVNGFFAVDIVLTFFVAYLDKATYLLIDDHKKIAWKYASSW  141

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
               +D+ STIP E    +          Y    MLR WRLRRVS  F+RLEKD  ++YF V
Sbjct  142   LALDIISTIPTELARKISPKPLQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFGV  198

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSM  1809
             RCA+LL VTL  VH AGC YY +A RY      W+G+    N  E+ +  RY++++YWS+
Sbjct  199   RCAKLLCVTLFAVHSAGCFYYLIAARYHDPHNTWIGAALGDNFLEQGIWRRYVTSIYWSI  258

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR+++Q+
Sbjct  259   TTLTTVGYGDLHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTVQS  318

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS+F  RN LP RL++Q+LA++CL+FK  +E L QQ  ++ LPK I  SI H+LF  +VE
Sbjct  319   ASSFAQRNKLPPRLQDQMLAHLCLKFKTDSEGLQQQETLDFLPKAIRSSISHYLFYSLVE  378

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             KVYLF+GVS ++L  LV++M+AEY PP EDVI+QNE+P D YI+V+G VE++  + E EQ
Sbjct  379   KVYLFQGVSNDLLFQLVSEMEAEYFPPNEDVILQNEAPTDFYILVTGAVEVLAMKTEGEQ  438

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    +GD+ GE+G LC RPQ FT RTK LSQLL++  TS L  +Q    D   ++ NF
Sbjct  439   VVGGAKTGDICGEIGVLCYRPQLFTVRTKRLSQLLRMNRTSFLNIVQANVGDGTIIMNNF  498

Query  1094  LQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGD  921
             LQ+ K+ KD  +  +F+E         M + L   +A   G+   L++LLK GLDPN  D
Sbjct  499   LQYLKEQKDPVMEGVFVETTTMLAHGRMELPLSLCIAALRGDDLLLHQLLKRGLDPNEAD  558

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWA  744
               G++ LHIAASKG E CV++LL +G + + +D EGN  LW+A+     S+  +L  + A
Sbjct  559   HNGRSALHIAASKGSENCVLLLLDYGVDPNCRDSEGNVPLWEAMLGGHESLTKLLIENGA  618

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             SI    V G   C AA++N+ ++++E++++G  V     +G+TA+  A+ E+  +++  L
Sbjct  619   SIHHGEV-GHFACTAAELNNLNLLEEIVQYGGDVTIPRDNGTTALHVAVSEDNTELVIFL  677

Query  563   VMNGAEIDDAVKLNLAPLDLTE---------VLQKRELGHR---IAMPNTILHEA-----  435
             +  GA+ID        P DL +         + Q R+   +   +A+P    H       
Sbjct  678   LDQGADIDKPDGHGWTPRDLADQQGHEEIKLIFQTRKEAKKQTLVAIPEKQAHGTRFLER  737

Query  434   -ASKWAKDDHQNSSSMP------QQCSIRVSIYRGHPA----------------------  342
               S+ A        S P       Q   R  I   H +                      
Sbjct  738   FTSEPAIRQVSQEGSFPATDGSLSQTRPRRRINNFHNSLFGTMSAAHKGEKDLLSQNSHN  797

Query  341   ------TRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                    R    CPE     G+L+ LP +   L+ +  +K  F  + + +  ++ A ID+
Sbjct  798   NHGTSHARVTISCPEKGEVAGKLVLLPNSFRALLEMGSKK--FRISPAKVMRKDRAEIDA  855

Query  191   IDVIRDNDKLFIVAD  147
             I++IRD D L  VAD
Sbjct  856   IELIRDGDHLMFVAD  870



>gb|ABE99810.1| inwardly rectifying potassium channel AKT1 [Hordeum vulgare]
 dbj|BAJ96585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=898

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/860 (41%), Positives = 499/860 (58%), Gaps = 83/860 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D RYR WET++++LV YSAW+ PFE 
Sbjct  37    RDGSHYSLSSGILPSLGARSNRRVKLRPFIISPYDRRYRLWETFLIVLVVYSAWISPFEF  96

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+       L   DN V+  FA+DI+LTFFVAY+D  T LL    K+IA RY ++W ++
Sbjct  97    GFIRIPTG-GLAATDNAVNAIFAIDIILTFFVAYLDRLTYLLEDDPKRIAWRYATSWLVL  155

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +   K      Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  156   DVASTIPSEIARRMLPSKLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  212

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP+  + W+G+   +   + L IRY++++YWS+TT+T
Sbjct  213   KLICVTLFAVHCAACFYYLLADRYPNPQETWIGNTMPDFHSKGLWIRYVTSVYWSITTLT  272

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGD HA N  EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  273   TVGYGDYHAENIREMIFNIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  332

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LFL +V+ +YL
Sbjct  333   ALRNQLPPRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISQYLFLNLVQNIYL  392

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMID----NEMENEQ  1275
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++     E   EQ
Sbjct  393   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEVPNGAEHGAEQ  452

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    SGD+ GE+G LC RPQ FT RT++L QLL++  T+ L  +Q    D   ++ N 
Sbjct  453   VVGVAKSGDVIGEIGVLCYRPQLFTVRTRSLCQLLRMNRTAFLSIVQSNVGDGTIIMNNL  512

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             +Q  K+ KD  +  +  EI      G  ++ I L   V  G+   L++LLK  LDPN  D
Sbjct  513   IQLLKEQKDGVMVGVLKEIESMLARGRLDLPITLGFAVTRGDDHLLHQLLKRNLDPNESD  572

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
               G+T LHIAASKG+E+CV +LL +G + + +D EG   LW+A+ AK  ++  +L    +
Sbjct  573   QDGRTALHIAASKGNEQCVKLLLDYGADPNARDSEGKVPLWEAVYAKHDTVVQLLIKGGA  632

Query  740   ISDPYVAGD---LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
                   AGD     C A + ND  +++++LKH + V+   + G+  +  A+ +   +M++
Sbjct  633   ---ELSAGDTSLYACTAVEQNDIELLKQILKHVIDVNRPSKDGNIPLHRAVCDGNVEMVE  689

Query  569   LLVMNGAEIDDAVKLNLAPLDLTE-------------VLQKRELGHRIAMPNTILHEAAS  429
             LL+ +GA+ID        P  L E             V+  R+      +   +L   +S
Sbjct  690   LLLRHGADIDKQDSNGWTPRALAEQQGHEEIQNLFRSVVAPRKYTSNGRVTPMLLGRFSS  749

Query  428   -----KWAKDD--HQNSSSMPQQCSIRVS------IYRGHPATRRETQ------------  324
                  K  ++D   Q S  +PQ+  +         I   HP  RRET             
Sbjct  750   DPSMQKVIREDAEQQPSKVLPQRRKVSFHNSLFGVISSSHP--RRETDHLLSRGLAATGG  807

Query  323   -----------------CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEG  207
                              CPE     G+L+ LP ++ EL+ +  +K  FD   + +   EG
Sbjct  808   PSYPQAHHRPLIRVTIGCPEKGNTAGKLVILPGSMKELLQLGAKK--FDMMPTKVLTIEG  865

Query  206   AIIDSIDVIRDNDKLFIVAD  147
             A +D +++IRD D L + +D
Sbjct  866   AEVDEVELIRDGDHLVLASD  885



>ref|XP_007204288.1| hypothetical protein PRUPE_ppa001241mg [Prunus persica]
 gb|EMJ05487.1| hypothetical protein PRUPE_ppa001241mg [Prunus persica]
Length=874

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/662 (47%), Positives = 437/662 (66%), Gaps = 10/662 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGS-SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
              D S   LS  ILP LG+ S          ++SP D RYR WET++V+LV Y+AWV PFE
Sbjct  24    RDGSQYSLSTGILPSLGARSSNRRVKLSRFIVSPYDRRYRGWETYLVVLVIYTAWVSPFE  83

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+      L +VDN+V+ FFAVDIVLTFFVAY+D +T LL+   K+I  +Y  +WFL
Sbjct  84    FGFLKGP-GGPLSIVDNVVNGFFAVDIVLTFFVAYLDKSTYLLVDDHKRIGWKYARSWFL  142

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV STIP E    +F         Y V  MLR WRLRRVS  F+RLEKD  ++YFWVRC
Sbjct  143   FDVISTIPSELATKIFPKSVQ---SYGVFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  199

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTT  1794
             A+L+ VTL  +HCAGC YY LA RY    K W+G + + E+ + IRY++++YWS+TT+TT
Sbjct  200   AKLICVTLFAIHCAGCFYYLLAARYRDPQKTWMG-IEILEQDMWIRYVTSVYWSITTLTT  258

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH VNT EMIF I YMLFNLGLT+Y+IGNMTNLVV GT RT +FR++IQAAS+F 
Sbjct  259   VGYGDLHPVNTREMIFDIVYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDTIQAASSFA  318

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYLF
Sbjct  319   QRNQLPGRLQDQMLAHLCLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYSLVDKVYLF  378

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVS ++L  LV++MKAEY PP+ED+I+QNE+P D Y++V+G  +++  +   EQV+  +
Sbjct  379   HGVSNDLLFQLVSEMKAEYFPPKEDIILQNEAPTDFYVLVTGVADLVVLKNGVEQVIGEV  438

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K
Sbjct  439   KAGDLIGEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQANVGDGTVIMNNLLQHLK  498

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
               KD  +  + +E  +    G  ++ ++L    + G+   L++LL+ GLDPN  D+ G+T
Sbjct  499   DQKDPIMEGVLLETENMLARGRMDLPLSLCFAASRGDDLLLHQLLRRGLDPNESDNNGRT  558

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIA++KG E CV++LL  G + + KD +GN+ LW+AI      I  +L    +  +  
Sbjct  559   ALHIASAKGSENCVLLLLDFGADPNSKDTDGNSPLWEAILNGHEPIAKLLQDNGADFNSG  618

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
               G   C AA+ +   +++E++ HG  V     +G+TA+  A+ E+  +++K L+  GA+
Sbjct  619   DVGQFACTAAEQSRVDLLKEIVGHGGDVTRPKANGTTALHVAVSEDNVEIVKFLLDQGAD  678

Query  545   ID  540
             ID
Sbjct  679   ID  680



>gb|AAL25648.1|AF197332_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/827 (42%), Positives = 489/827 (59%), Gaps = 54/827 (7%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             L+  IL  LG+        +  ++S +D RYR WE ++VLLV Y+AW  PFE  FL+ K 
Sbjct  38    LATGILLSLGARSNRVVQLRSFIVSSLDRRYRIWENFLVLLVVYTAWASPFEFGFLK-KP  96

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L ++DN+V+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY+++WF +DV S IP
Sbjct  97    KPPLSIIDNVVNGFFAIDIVLTFFVAYLDKATYLLVDDPKKIAWRYMTSWFALDVISIIP  156

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +    H     Y +  MLR WRLRRVS  F+RLEKD  ++YF +RCA+LL VT+
Sbjct  157   SELAQKI---SHSPLGGYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFVLRCAKLLCVTV  213

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
               VHCAGC YY LA R     + W+G   +  + L IRY++++YWS+TT+TTVGYGDLH 
Sbjct  214   FAVHCAGCFYYLLAARNHDPAETWMGKA-ILHDGLGIRYVTSLYWSITTLTTVGYGDLHP  272

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN  EM+F IF+MLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP R
Sbjct  273   VNVREMLFDIFFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPPR  332

Query  1589  LKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
             L++Q+LA++CL+++  +E L Q+  ++ LPK I  SI H+LF  +V++VYLF+G+S ++L
Sbjct  333   LQDQMLAHLCLKYRTDSEGLRQKETLDSLPKAIRSSILHYLFYNIVDQVYLFRGISNDLL  392

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
               LV++MK EY PP EDVI+QNE+P D YI+V+G V+++  +   EQ V    SGD+ GE
Sbjct  393   FQLVSEMKDEYFPPNEDVILQNEAPTDFYILVTGAVDLLVVKNGTEQPVGEAKSGDICGE  452

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             +G LC RPQ FT RTK LSQLL+L  T+L   +Q   ED   ++ N LQH K LKD  + 
Sbjct  453   IGVLCYRPQLFTVRTKRLSQLLRLNRTTLFNIIQSNVEDGTIIMNNLLQHLKDLKDPTME  512

Query  1055  dLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
              + I+  +    G  ++ ++L      G+   L++ L+ GLDPN  D+ G+TPLHIAASK
Sbjct  513   SILIDAENMVAHGQLDLPLSLCFATLRGDDLMLSQPLRRGLDPNESDNSGRTPLHIAASK  572

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCK  702
             G E C ++L+ +G + + +D EGN  LW+AI      +  +L    +       G   C 
Sbjct  573   GSENCALLLMDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLLAENGANLVSGDVGQFSCT  632

Query  701   AAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN  522
             AA+ N+  +++E+ ++G  V     +G+TA+  A+ E+  +++K L+  GA+I+      
Sbjct  633   AAEQNNLDLLKEISRYGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHG  692

Query  521   LAPLDLTEVLQKRELG------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQ----  384
               P DL +     E+G          MP  I  E     AS+    D     S P+    
Sbjct  693   WTPRDLADQQGHEEIGILFQSIKETEMPPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTS  752

Query  383   ----------------QCSIRVSI---------YRGHPATRRETQCPE----PGRLIKLP  291
                             +  + +SI         +   PA R    CPE     G+L+ LP
Sbjct  753   NFHNSLFGIMSAARDGEGDVLLSINHNKSANKPFVARPAIRVVVSCPEVGDVEGKLMLLP  812

Query  290   ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
             E   EL+ +A +K G   T   +  + GA ID + VIRD D L  ++
Sbjct  813   ENFQELLEMARKKFGL--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|NP_001275347.1| potassium channel AKT1-like [Solanum tuberosum]
 emb|CAA60016.1| potassium channel [Solanum tuberosum]
Length=883

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/670 (48%), Positives = 440/670 (66%), Gaps = 10/670 (1%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  +ISP D +YR WET++++LV Y+AWV PFE  FL  K 
Sbjct  33    LSTGILPSLGARSNRRVKLKRFIISPYDRQYRLWETFLIVLVVYTAWVSPFEFGFL-GKP  91

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L   DN+V+ FFA+DI+LTFFVA++D  T LL+   KKIA +Y+STWFL DV STIP
Sbjct  92    EGPLAKTDNVVNGFFAIDIILTFFVAFLDRATYLLVDEHKKIAWKYMSTWFLFDVISTIP  151

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRVS+ F RLEKD  F+YFWVRCA+L+ VTL
Sbjct  152   SELAVKISPKPLRQ---YGLFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRCAKLVCVTL  208

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC YY +A  YP   K W+G+   +   +SL IRYI+++YWS+TT+TTVGYGDL
Sbjct  209   FAVHCAGCFYYLIAAHYPDPKKTWIGASMDDFLNQSLWIRYITSIYWSITTLTTVGYGDL  268

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP
Sbjct  269   HPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLP  328

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             ARL++Q+LA++CL+F+  +E L QQ  +E LPK I  S+ H LF  +V+KVYLF+GVS +
Sbjct  329   ARLQDQMLAHLCLKFRTDSEGLQQQETLESLPKAIRSSVSHFLFYSLVDKVYLFRGVSND  388

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV  + +GD+ 
Sbjct  389   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLVVLKNGVEQVVGEVRAGDLC  448

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N LQH K++K+  
Sbjct  449   GEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIVQANVGDGTIIMSNLLQHLKEMKNPI  508

Query  1061  lgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E         M + L    AT   +   L+ LLK GLDPN  D+ G++ LHIAA
Sbjct  509   MEGVLLETEHMLARGRMDLPLTLCFATLRSDDLLLHHLLKRGLDPNEADNNGRSALHIAA  568

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG E CV++LL  G + + +D EGN  LW+AI  K  S+  +L +  +       G   
Sbjct  569   SKGIENCVVLLLDFGADPNSRDSEGNVPLWEAIMGKHESVIQLLVNNGAKLSAGDVGHFA  628

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C A + N+ S+++E++++G  V     +GS+A+  A+ E   +++K L+  GA +D   +
Sbjct  629   CVAVEQNNLSLLKEIVRYGGDVTLPKINGSSALHVAVCEGNIEIVKYLLDRGANVDQPDE  688

Query  527   LNLAPLDLTE  498
              N  P DL E
Sbjct  689   HNWTPRDLAE  698



>emb|CAN80462.1| hypothetical protein VITISV_015412 [Vitis vinifera]
Length=840

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/670 (49%), Positives = 431/670 (64%), Gaps = 21/670 (3%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  ++SP D RYR WET++VLLV Y+AWV PFE  FL+ K 
Sbjct  11    LSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAWVSPFEFGFLK-KP  69

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L + DN+V+ FFAVDIVLTFFVAY+D TT LL+ + K+IA +Y STW   DV STIP
Sbjct  70    EAPLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIP  129

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+L+ VT+
Sbjct  130   SELARKITPSPFQ---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRCAKLICVTV  186

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCA C YY LA RY    K W+G+   N  E+SL IRY++A+YWS+TT+TTVGYGDL
Sbjct  187   FAVHCAACFYYLLAARYHDPQKTWIGASMNNFLEQSLWIRYVTAIYWSITTLTTVGYGDL  246

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+F  RN LP
Sbjct  247   HPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASSFAQRNQLP  306

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +++KVYLF+GVS +
Sbjct  307   VRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLLDKVYLFRGVSND  366

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+ED+I+QNE+P D YI+VSG +           VV    +GD+ 
Sbjct  367   LLFQLVSEMKAEYFPPKEDLILQNEAPTDFYIVVSGAL-----------VVGEAKTGDLC  415

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N LQH K LKD  
Sbjct  416   GEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPI  475

Query  1061  lgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E  +      M + L    AT  G+   L++LLK GLDPN  DS G+T LHIAA
Sbjct  476   MEGVLVETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNESDSNGRTALHIAA  535

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG E CV++LL +G   + +D EG   LW+A+     S+  +L    +  +    G   
Sbjct  536   SKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLLVDNGANINSGDVGHFA  595

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C AA++ + +++++++ +G  V   D  G+TA+ AA+ E   +M+K L+  GA+ID    
Sbjct  596   CTAAELKNLNLLKQIVHYGGDVKQPDNTGNTALHAAVCEENIEMVKFLLDQGADIDRTND  655

Query  527   LNLAPLDLTE  498
                 P DL +
Sbjct  656   HGWTPRDLAD  665



>gb|KHN15126.1| Potassium channel AKT1 [Glycine soja]
Length=871

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/865 (40%), Positives = 497/865 (57%), Gaps = 89/865 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  13    RDGSHYSLSTGILPSLGAKSNRRLKLKPFIVSPYDRRYRIWETFLVILVVYTAWVSPFEF  72

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L + DNIV+ FF VDIVLTFFVAYID ++ L++  RK+IA +Y  TW   
Sbjct  73    GFLK-KPQAPLSITDNIVNGFFFVDIVLTFFVAYIDKSSYLIVDDRKQIAWKYARTWLSF  131

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV S IP E V  +          Y +  MLR WRLRRV   F+RLEKD  ++YFWVRCA
Sbjct  132   DVISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVGALFSRLEKDKNYNYFWVRCA  188

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +A RY    K W+G+   N  E SL  RY++++YWS+TT+T
Sbjct  189   KLIAVTLFAVHCAACFYYLIAARYHDPKKTWIGATMDNFLEHSLWSRYVTSIYWSITTLT  248

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN+ EMIF +FYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF
Sbjct  249   TVGYGDLHPVNSREMIFDVFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNF  308

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF  +++KVYL
Sbjct  309   AQRNQLPHRLQDQMLAHLCLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLIDKVYL  368

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V ++    +   VV  
Sbjct  369   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVVIV----QLIYVVGE  424

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  425   AKTGDLCGEIGVLCYKPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  484

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K++ D  +  + ++I +    G  ++ +++    A G+   L++LLK G+DPN  D+  +
Sbjct  485   KEINDPIMEGVLVDIENMLARGRMDLPVSVCFAAARGDDLLLHQLLKRGMDPNESDNNRR  544

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAAS+G + CV++LL +G + +++D+EGN  LW+AI     S+  +L    +    
Sbjct  545   TALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLLSENGANLQC  604

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHG--LHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                G   C AA+ N  ++++E++++G  + + +    G+TA+  A+ E   + +K L+ +
Sbjct  605   GDVGQFACTAAEQNSLNLLKEIMRYGGDITLPNSSNTGTTALHVAVSEGNVETVKFLLDH  664

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRE----------------------------LGHRIAM  459
             GA ID   K    P DL +     E                            LG   + 
Sbjct  665   GASIDMPDKHGWTPRDLADQQAHTEIKALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSE  724

Query  458   PNTIL------HEAASKWAKDDHQNSSSMPQQCS---------IRVSIYRGHP-------  345
             P   L      H     W+++  QN S  P++ S         I  + + G         
Sbjct  725   PTMTLPLDGSFHGTDGSWSQNQSQNQSR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVD  783

Query  344   ----------------ATRRETQCPEP----GRLIKLPETIAELISIAGEKLGFDATDSS  225
                              TR    CPE     G+L+ LP +  EL+ I  +K GF    + 
Sbjct  784   MNNNARNGMKSSSAVGPTRVIISCPEKGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNK  841

Query  224   LTDEEGAIIDSIDVIRDNDKLFIVA  150
             +  ++G  I+ I++IRD D L  + 
Sbjct  842   VVCKDGGEIEDIEIIRDGDHLVFLG  866



>gb|AAV59417.1| putative potassium channel protein [Oryza sativa Japonica Group]
Length=561

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/549 (58%), Positives = 406/549 (74%), Gaps = 23/549 (4%)
 Frame = -2

Query  1733  MLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLR  1554
             MLFNLGLTAY+IGNMTNLVVEGTRRTMEFRNSI+AASNFV RNHLP RLK+QILAYMCL+
Sbjct  1     MLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFVGRNHLPPRLKQQILAYMCLK  60

Query  1553  FKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPP  1374
             F+AESLNQQ L++QLPK+ICK IC +LFLPVV+ VYLFKGVSRE+LLL+V  MK EYIPP
Sbjct  61    FRAESLNQQQLMDQLPKSICKGICEYLFLPVVKDVYLFKGVSREVLLLMVTKMKPEYIPP  120

Query  1373  REDVIMQNESPDDVYIIVSGEVEMI--DNEMENEQVVWTLNSGDMFGEVGALCCRPQSFT  1200
             +EDVI+QNE+PDDVYI+VSGEVE+I  D E E E+VV TL +  +FGEV AL  RPQSFT
Sbjct  121   KEDVIVQNEAPDDVYIVVSGEVEVIYSDGEAE-ERVVATLGTRGVFGEVSALSDRPQSFT  179

Query  1199  YRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGDEDGD  1020
              RT+TL QLL+L+  +L EA+Q K ED++ +IKNFL+H  ++ D+K+ DL  E    + D
Sbjct  180   LRTRTLCQLLRLRQAALKEAMQSKPEDSVVIIKNFLKHQIEMHDMKVEDLLGEDAAGEYD  239

Query  1019  -PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHG  843
               N+  NL TV ATGN++FL +LLK G+DP++GDSKG+T LHIAASKG+E+CV+VLLK  
Sbjct  240   HGNIPCNLLTVAATGNSSFLEDLLKVGMDPDVGDSKGRTALHIAASKGYEDCVLVLLKQA  299

Query  842   CNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP-YVAGDLLCKAAKMNDSSVMQE  666
             CN+++KD +GNTALW+AIAA+ H IF+ILYH+A +S P + AGDLLC AA+  D   ++E
Sbjct  300   CNVNIKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRE  359

Query  665   LLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------LAPLD  507
             LLKHGL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       ++  +
Sbjct  360   LLKHGLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDE  419

Query  506   LTEVLQKRELGHRI---------AMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYR  354
             L E+++ REL H +         A    I    +S  +++  + S+        RVSIYR
Sbjct  420   LRELMKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYR  479

Query  353   GHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
             GHP  R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSIDVIRD
Sbjct  480   GHPFVRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRD  537

Query  173   NDKLFIVAD  147
             NDKLFIV +
Sbjct  538   NDKLFIVTE  546



>ref|XP_008352270.1| PREDICTED: potassium channel AKT1-like [Malus domestica]
Length=874

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/676 (47%), Positives = 432/676 (64%), Gaps = 10/676 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQG-LVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
              D S   LS  ILP LG+         G  ++SP D RYR WET++V+LV Y+AWV PFE
Sbjct  25    RDGSHYSLSTGILPSLGARSSNRRVKLGXFIVSPYDRRYRIWETFLVVLVIYTAWVSPFE  84

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+      L + DN+V+ FFA+DI+LTFFVAY+D TT LL+  RKKI  +Y  +W +
Sbjct  85    FGFLKGP-GGPLSITDNVVNGFFAIDIILTFFVAYLDKTTYLLVDDRKKIGWKYARSWLI  143

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV STIP E    +F         Y    MLR WRLRRVS  F+RLEKD  ++YFWVRC
Sbjct  144   FDVISTIPSELATRIFPKSLQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  200

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVREESLKIRYISAMYWSMTTMTT  1794
             A+L+ VTL  +HCAGC YY +A R     K W+G+  +  +SL IRY++A+YWS+TT+TT
Sbjct  201   AKLICVTLFAIHCAGCFYYLIAARNHDPAKTWMGA-EILGQSLWIRYVTAVYWSITTLTT  259

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH VN  EMIF IFYM FNLGLT+Y+IGNMTNLVV GT RT +FR++IQAAS+F 
Sbjct  260   VGYGDLHPVNAREMIFDIFYMFFNLGLTSYLIGNMTNLVVHGTSRTRKFRDTIQAASSFA  319

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYLF
Sbjct  320   QRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDKVYLF  379

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVS ++L  LV++MKAEY PP+EDVI+QNE+P D Y++V+G  +++  +   EQV+   
Sbjct  380   HGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYLLVTGAADLVVLKHGVEQVIGEA  439

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              SGD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K
Sbjct  440   KSGDLIGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTVIMNNLLQHLK  499

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
              LKD  +  +  E  +    G  ++ ++L      G+   LN+LLK GLDPN  D+ G++
Sbjct  500   DLKDPIMEGVLSETENMLARGRMDLPLSLCFAAIRGDDLLLNQLLKRGLDPNESDNNGRS  559

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIA+SKG E CV++LL +G +   +D +GN  LW+AI      I  +L    +     
Sbjct  560   ALHIASSKGSENCVLLLLDYGADPKSRDSDGNVPLWEAILNGHEQIAKLLLDNGANLXSG  619

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAE  546
               G   C AA+ N   +++E+ +HG  V     +G+TA+  A+ E+  D++K L+  GA+
Sbjct  620   DVGQFACTAAEQNRLDLLKEIARHGGDVTRPKSNGTTALHVAVSEDNVDIVKYLLDQGAD  679

Query  545   IDDAVKLNLAPLDLTE  498
             ID        P  L E
Sbjct  680   IDKPDLHGWTPRALAE  695



>gb|AAF36832.1|AF207745_1 AKT1-like potassium channel [Triticum aestivum]
Length=897

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/863 (41%), Positives = 496/863 (57%), Gaps = 89/863 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  36    RDGSHYSLSSGILPSLGARSNRRVKLRRFIISPYDRRYRLWETFLIVLVVYSAWVSPFEF  95

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+       L   DN V+  FAVDI+LTFFVAY+D  T LL    K+IA RY ++W ++
Sbjct  96    GFIRIPTG-GLAATDNAVNAIFAVDIILTFFVAYLDRLTYLLEDDPKRIAWRYATSWLVL  154

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +   K      Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  155   DVASTIPSEIARRMLPSKLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  211

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP   + W+G+   +   + L IRY++++YWS+TT+T
Sbjct  212   KLICVTLFAVHCAACFYYLLADRYPDPKETWIGNTMPDFHSKGLWIRYVTSVYWSITTLT  271

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGD HA N  EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  272   TVGYGDYHAENIREMIFNIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  331

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LFL +V+ +YL
Sbjct  332   ALRNQLPPRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISQYLFLNLVQNIYL  391

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMID----NEMENEQ  1275
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++     E   EQ
Sbjct  392   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEVPNGAEHGAEQ  451

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    SG++ GE+G LC RPQ FT RT++L QLL++  T+ L  +Q    D   ++ N 
Sbjct  452   VVGVAKSGEVIGEIGVLCYRPQLFTVRTRSLCQLLRMNRTAFLSIVQSNVGDGTIIMNNL  511

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             +Q  K+  D  +  +  EI      G  ++ I L   V  G+   L++LLK  LDPN  D
Sbjct  512   IQLLKEQTDGVMVGVLKEIESMLARGRLDLPITLCFAVTRGDDHLLHQLLKRNLDPNESD  571

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
               G+T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+ AK  ++  +L    +
Sbjct  572   QDGRTALHIAASKGNEQCVKLLLEYGADPNARDSEGKVPLWEAVYAKHDTVVQLLVKGGA  631

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
                        C A + N+  +++++LKH + V+   + G+  +  A+ +   +M++LL+
Sbjct  632   ELSSGDTSLYACTAVEQNNIELLKQILKHVIDVNRPSKDGNIPLHRAVCDGNVEMVELLL  691

Query  560   MNGAEIDDAVKLNLAPLDLTE-------------VLQKRE-----------LGHRIAMPN  453
              +GA+ID        P  L E             V+  R+           LG   + P+
Sbjct  692   RHGADIDKQDSNGWTPRALAEQQGHEEIQNLFRSVIAPRKYTSNGRVTPMLLGRFSSDPS  751

Query  452   --TILHEAASKWAKDDHQNSSSMPQQCSIRVS------IYRGHPATRRET----------  327
                ++HE        + Q S  +PQ+  +         I   HP  RRET          
Sbjct  752   MQKVIHEDV------EQQPSKVLPQRRKVSFHNSLFGVISSAHP--RRETDHLLSRGLAA  803

Query  326   -------------------QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTD  216
                                 CPE     G+L+ LP +I EL+ +  +K  FD   + +  
Sbjct  804   TGGPTYPQAHHNPLIRVTISCPEMGNTAGKLVILPGSIKELLQLGAKK--FDMMPTKVLT  861

Query  215   EEGAIIDSIDVIRDNDKLFIVAD  147
              EGA +D +++IRD D L + +D
Sbjct  862   IEGAEVDEVELIRDGDHLVLASD  884



>ref|NP_001291230.1| potassium channel AKT1-like [Populus euphratica]
 gb|ADA79675.1| shaker-like potassium channel 2 [Populus euphratica]
Length=877

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/857 (42%), Positives = 507/857 (59%), Gaps = 75/857 (9%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  ILP LG+           +ISP D RYR WET++VLLV Y+AWV P
Sbjct  23    QLSRDGSHYSLSTGILPSLGARSNRRVKLNRFIISPHDRRYRIWETFLVLLVIYTAWVSP  82

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+    + L + DN+V+ FFAVDIVLTFFVAY+D  T LLI   KKIA +Y S+W
Sbjct  83    FEFGFLKQP-QSPLSICDNVVNGFFAVDIVLTFFVAYLDKATYLLIDDHKKIAWKYASSW  141

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
               +D+ STIP E    +          Y    MLR WRLRRVS  F+RLEKD   +YF V
Sbjct  142   LALDIISTIPAELARKISPKPLQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNCNYFGV  198

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSM  1809
             RCA+LL VTL  VH AGC YY +A RY    + W+G+    N  E+ + IRY++++YWS+
Sbjct  199   RCAKLLCVTLFAVHSAGCFYYLIAARYHDPLRTWIGAALGDNFLEQGIWIRYVTSIYWSI  258

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT+TTVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR+++Q+
Sbjct  259   TTLTTVGYGDLHPVNTSEMVFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTVQS  318

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS+F  RN LPARL++QI+A++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+
Sbjct  319   ASSFAQRNKLPARLQDQIVAHLCLKFRTDSEGLQQQETLDLLPKAIRSSISHYLFYSLVD  378

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             KVYLF+GVS  +L  LV++M+AEY PP EDVI+QNE+P D YI+V+G V+++  +   EQ
Sbjct  379   KVYLFRGVSNNLLFQLVSEMEAEYFPPNEDVILQNEAPTDFYILVTGAVDVLAMKTGGEQ  438

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    +GD+ GE+G LC RPQ FT RTK LSQLL++  TS L  +Q    D   ++ N 
Sbjct  439   VVGEAKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRMNRTSFLNIVQANVGDGTIIMNNL  498

Query  1094  LQHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGD  921
             LQ+ K+ KD  +  +F+E  +      M + L   +A   G+   L++LLK GLDPN  D
Sbjct  499   LQYLKEHKDPVMEGVFLEATNMLAHGRMELPLSLCIAALRGDDLLLHQLLKRGLDPNEAD  558

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWA  744
             + G++ LHIAASKG E CV++LL +G + + +D EGN  LW+A+     S+  +L  + A
Sbjct  559   NNGRSALHIAASKGSENCVLLLLDYGADPNCRDSEGNIPLWEAMLGGHESLTKLLIENGA  618

Query  743   SISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
             SI    V G   C AA++N+ ++++E++++G  V     +G+TA+  A+ E+  ++++ L
Sbjct  619   SIHHGEV-GHFACTAAELNNLNLLEEIVQYGGDVTIPRDNGTTALHVAVSEDNIELVRFL  677

Query  563   VMNGAEIDDAVKLNLAPLDLTE---------VLQKRELGHR---IAMPNTILHEAASKWA  420
             +  GA+ID        P DL +         + Q R+   +   +A+P   + E  +++ 
Sbjct  678   LDQGADIDKPDGHGWGPRDLADQQGHEEIKLIFQTRKEAKKQTLVAIPE--MQEQGTRFL  735

Query  419   K-------------------DDHQNSSSMPQQ------CSIRVSIYRGHPA---------  342
             +                    D   S + P++       S+  +I   H           
Sbjct  736   ERFTSEPAIRPVSQEGSFPATDGSLSQTRPRRRINHFHNSLFGTISAAHKGEKDLLSQNS  795

Query  341   --------TRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
                      R    CPE     G+L+ LP +   L+ +  +K  F  + + +  ++ A I
Sbjct  796   HNNHGTSPARVTISCPEKGEVAGKLVLLPNSFRALLEMGSKK--FRISSAKVMRKDRAEI  853

Query  197   DSIDVIRDNDKLFIVAD  147
             D+I++IRD D L  VAD
Sbjct  854   DAIELIRDGDHLMFVAD  870



>ref|XP_003524528.2| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=893

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/677 (47%), Positives = 442/677 (65%), Gaps = 11/677 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   LS  ILP LG+        +  +ISP D RYR WET++V+LV Y+AWV PFE  
Sbjct  18    DGSHYSLSTGILPSLGAKSNRRLKLKPFIISPYDRRYRIWETFLVILVVYTAWVSPFEFG  77

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             FL+ K    L + DNIV+ FF VDIVLTFFVAYID +T L++  RK+IA +Y  TW   D
Sbjct  78    FLK-KPQAPLSITDNIVNGFFFVDIVLTFFVAYIDKSTYLIVDDRKQIAWKYARTWLAFD  136

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             V S IP E V  +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA+
Sbjct  137   VISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDKNYNYFWVRCAK  193

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHCA C YY +A RY    K W+G+   N  E SL  RY++++YWS+TT+TT
Sbjct  194   LIAVTLFAVHCAACFYYLIAARYHDPKKTWIGATMDNFLERSLWSRYVTSIYWSITTLTT  253

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFV  1614
             VGYGDLH VN+ EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF 
Sbjct  254   VGYGDLHPVNSREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNFA  313

Query  1613  SRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLF  1440
              RN LP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF  +++KVYLF
Sbjct  314   QRNQLPHRLQDQMLAHLCLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLIDKVYLF  373

Query  1439  KGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTL  1260
              GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G VE++  +   EQVV   
Sbjct  374   HGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVELLVLKNGVEQVVGEA  433

Query  1259  NSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHk  1080
              +GD+ GE+G LC +PQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQH K
Sbjct  434   KTGDLCGEIGVLCYKPQLFTVRTKRLSQLLRLNRTSFLNIVQANVGDGTIIMNNLLQHLK  493

Query  1079  klkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKT  906
             ++ D  +  + ++I +    G  ++ +++    A G+   L++LLK G+DPN  D+  +T
Sbjct  494   EINDPIMEGVLVDIENMLARGRMDLPVSVCFAAARGDDLLLHQLLKRGMDPNESDNNRRT  553

Query  905   PLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY  726
              LHIAAS+G E CV +LL +G + +++D+EGN  LW+AI     S+  +L    +     
Sbjct  554   ALHIAASQGKENCVSLLLDYGADPNIRDLEGNVPLWEAIVEGHESMSKLLSENGANLQCG  613

Query  725   VAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRH-GSTAIQAAMEENQADMIKLLVMNGA  549
               G   C A + N  ++++E++++G  +   + + G+TA+  A+ E   +++K L+ +GA
Sbjct  614   DVGQFACNAVEQNSLNLLKEIMRYGGDITLPNSNTGTTALHVAVSEGNVEIVKFLLDHGA  673

Query  548   EIDDAVKLNLAPLDLTE  498
              ID   K    P DL +
Sbjct  674   SIDKPDKHGWTPRDLAD  690



>ref|XP_006451007.1| hypothetical protein CICLE_v10007412mg [Citrus clementina]
 gb|ESR64247.1| hypothetical protein CICLE_v10007412mg [Citrus clementina]
Length=885

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/858 (40%), Positives = 499/858 (58%), Gaps = 71/858 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  +LP LG+        +  ++SP D RYR WET++VLLV Y+AW  P
Sbjct  24    QLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASP  83

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L V+DN+V+ FFAVDI+LTFFVAY+D  T LL+   K+IA +Y S+W
Sbjct  84    FEFGFLR-KPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSW  142

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV STIP E    +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWV
Sbjct  143   LVFDVISTIPSELAQKISPKPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWV  199

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS---LNVREESLKIRYISAMYWSM  1809
             RC +L+FVTL  VHCAGC YY LA RY +  + W+G+    N  E+SL IRY+++MYWS+
Sbjct  200   RCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSI  259

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT+TTVGYGDLH VNT EM+F IF+MLFNLGLTAY+IGNMTNLVV GT RT +FR++IQA
Sbjct  260   TTLTTVGYGDLHPVNTREMVFDIFFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQA  319

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +++
Sbjct  320   ASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMD  379

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEM--IDNEMEN  1281
             KVYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V++  + N +E 
Sbjct  380   KVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQ  439

Query  1280  EQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
               VV    +G++ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ 
Sbjct  440   ASVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMN  499

Query  1100  NFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNI  927
             N LQH K LKD  +  + +E  +    G  ++ ++L      G+   L++LLK GLDPN 
Sbjct  500   NLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNE  559

Query  926   GDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHW  747
              D+ G+T LHIAASKG E CV++LL +  + + +D +GN  +W+A+     ++  +L   
Sbjct  560   SDNNGRTALHIAASKGSENCVLLLLDYEADPNSRDSDGNVPIWEAMLGGHENVIKLLMEN  619

Query  746   ASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKL  567
              +  +    G   C AA+ N+  +++E++++G  V  +  +GSTA+  A+ E+  ++++ 
Sbjct  620   HADINSGDVGHFACTAAEQNNLELLKEIVRYGGDVTRQRNNGSTALHVAVCEDNVEIVRF  679

Query  566   LVMNGAEIDDAVKLNLAPLDLTEVLQKRE-----------------------------LG  474
             L+   A++D        P DL +     E                             LG
Sbjct  680   LLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCIETKAQSIISVAERPQQEVHYLG  739

Query  473   HRIAMP--NTILHEAASKWAKDDHQNSSSMPQQCSIRVSIY----RGHPATRRETQCPEP  312
                + P    I HE + +        + S  +  +   S++      H   +     P+ 
Sbjct  740   RFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQH  799

Query  311   GRLIKLPETIAELISIA----GEKLG-------------------FDATDSSLTDEEGAI  201
              ++ K P   +  ++I     GE  G                   F  + + + ++ GA 
Sbjct  800   TKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAE  859

Query  200   IDSIDVIRDNDKLFIVAD  147
             ++ I+VIRD D L  V+D
Sbjct  860   VEDIEVIRDGDHLVFVSD  877



>ref|XP_006579054.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=878

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/834 (42%), Positives = 490/834 (59%), Gaps = 62/834 (7%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGL---VISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLE  2319
             L+   LPPLG++   H+    L   ++S  + RYR W T++VLLV Y+A+VCPFE  FL 
Sbjct  44    LTGIPLPPLGATSAGHSGRHKLRSYIVSRYNPRYRLWNTFLVLLVFYTAFVCPFEFGFL-  102

Query  2318  SKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAS  2139
             S     L +VDN+V+ FFA+DIVLTFFVAY+D TT LL+   K IA+RYL TWF  DV +
Sbjct  103   SDPSLPLSIVDNVVNGFFAIDIVLTFFVAYLDKTTYLLVDEPKLIASRYLKTWFAFDVIA  162

Query  2138  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLF  1959
             TIP E               Y V  MLR WRLRRVS  F RLEKD  ++YFWVRC++L+ 
Sbjct  163   TIPAEIARDSLPPDLK---SYGVFNMLRLWRLRRVSAMFARLEKDRNYNYFWVRCSKLIC  219

Query  1958  VTLLLVHCAGCLYYFLA-DRYPHQGKNWLGSLNV-REESLKIRYISAMYWSMTTMTTVGY  1785
             VTL  +H A C++YFLA DR P     WL  ++   + S+  RY+++MYWS+ T+ TVGY
Sbjct  220   VTLFSMHFAACIFYFLALDRDP--SSTWLSLVSEDAQSSVWKRYVTSMYWSIVTLATVGY  277

Query  1784  GDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRN  1605
             GDLH V+T EM+F IFYMLFNLGLTAY+IGNMTNL+V GT RT ++R+++QAA+ F  RN
Sbjct  278   GDLHPVSTREMVFDIFYMLFNLGLTAYLIGNMTNLIVHGTSRTRKYRDTVQAATGFAHRN  337

Query  1604  HLPARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
              LP RL+EQ+LA++ L+++   E L QQ +IE LPK I  SI H+LF P+V+KVYLF GV
Sbjct  338   QLPIRLEEQMLAHLFLKYRTDLEGLQQQEIIESLPKAIRSSISHYLFYPLVDKVYLFHGV  397

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S ++L  LV +M+AEY PP+EDVI+QNE+P D+YI+V+G  E+I  +   EQV+  +  G
Sbjct  398   SSDLLFQLVTEMRAEYFPPKEDVILQNEAPTDLYIVVTGAAELIIRKNGMEQVIGEVGFG  457

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             D+ GE+G LC RPQ+FT RTK LSQ+L+L  T+ L  +     D   ++ NFLQH ++ +
Sbjct  458   DIVGEIGVLCYRPQTFTVRTKRLSQILRLNRTTFLNLVHSNIGDGTIVMNNFLQHLQESR  517

Query  1070  dlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
                +  +  E       G  +M I      +  +   L+ LLK G DPN  D  GKT LH
Sbjct  518   YPGMDAILAETEAMLARGKMDMPITTCFAASRNDDLLLHRLLKKGSDPNELDKNGKTTLH  577

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAASKG+E CV +LL++G + + KDM+G+  LW+A+  +  S+  IL    +      AG
Sbjct  578   IAASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKILIDNGADISLANAG  637

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
              L C A + N+  +++E+++ G+ V    ++G TA+  A+ E   +MI  LV  GA+ID 
Sbjct  638   HLACSAVEQNNMELLKEIIQCGVDVTQPKKNGITALHTAIAEGNTEMINFLVDQGADIDM  697

Query  536   AVKLNLAPLDLTEVLQKRELGH------------RIAMPNT---------------ILHE  438
                    P  + E   + E+ +             I +P                 I  E
Sbjct  698   PDANGWTPRVMAEQHGREEIRNIFDNIKESRKPSVIPIPRNDNRSGRFQIDPSMPAITQE  757

Query  437   AASKWAKDDHQNSSSMPQQCSIRVSIY-RGHPA-------------TRRETQCPE----P  312
             + S       ++SSS        +SI  RG  +             TR    CPE     
Sbjct  758   SMSLLPYHGRRSSSSFDNSIFGMISIANRGKVSEGRSSNRGNVNGLTRVTLSCPEKGEHA  817

Query  311   GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  150
             G+L+ LP+T+ EL+ I   K  FD + + +   +GA +D I+++RD D L I  
Sbjct  818   GKLVLLPKTLEELLDIGARK--FDISATKILTIDGAEVDDINLLRDGDHLIIAG  869



>ref|XP_010051190.1| PREDICTED: potassium channel AKT1-like [Eucalyptus grandis]
Length=931

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/735 (46%), Positives = 455/735 (62%), Gaps = 22/735 (3%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             DE++S+   SK ILP LG+        +  +ISP D RYR W++++VLLV Y+AWV PFE
Sbjct  45    DEEYSM---SKGILPSLGARTHRRVKLRQFIISPFDYRYRLWQSFLVLLVFYTAWVSPFE  101

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FLE K    L + DN+V+ FFA+DI+LTFFVAY+D T+ LL+  RKKIA RY++TW  
Sbjct  102   FGFLE-KPQGPLAITDNVVNGFFAIDIILTFFVAYLDKTSYLLVDDRKKIALRYVTTWLA  160

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              D+ STIPFE V  +          Y +  MLR WRLRRVS+ F RLEKD  F+YFWVRC
Sbjct  161   FDIISTIPFEVVKSILPSPLE---QYGIFNMLRLWRLRRVSSMFARLEKDKNFNYFWVRC  217

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLG---SLNVREESLKIRYISAMYWSMTT  1803
             A+L FVTL  VH A C YY LA RY      W+G        E SL IRY++++YWS+TT
Sbjct  218   AKLTFVTLFAVHLAACFYYLLAARYKDPKNTWIGLTMGEYFHERSLGIRYVTSIYWSITT  277

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             +TT GYGDLH VNT EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS
Sbjct  278   LTTTGYGDLHPVNTREMIFDIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAAS  337

Query  1622  NFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             NF  RN LP RL++Q+LA++ LR++  +E L QQ  +E LPK I  SI H LF  +V++V
Sbjct  338   NFAQRNQLPVRLQDQMLAHISLRYRTDSEGLQQQEFLEALPKAIRSSISHFLFYSLVDQV  397

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLF+GVS ++L  LV++MKAEY  P+EDVI+QNE+P D+YI+V+G  ++I      EQ V
Sbjct  398   YLFRGVSNDLLFQLVSEMKAEYFSPKEDVILQNEAPTDLYILVTGAADLIMQRNGIEQEV  457

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
                  GD+ GEVG LC RPQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQ
Sbjct  458   GEAKKGDVCGEVGVLCYRPQLFTVRTKRLSQLLRLNRTSFLNIVQANVGDGTIIMNNLLQ  517

Query  1088  HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSK  915
             H ++ +   + +L  E        NM + L    A   G+   L++LL+ GLDPN  D  
Sbjct  518   HLRERRQPLMEELLDETEHMLARGNMELPLSLCFAAMRGDDQLLHQLLRRGLDPNEVDKN  577

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASI  738
             G+T +HIAAS G + CV +LL+ G + ++KD EG+  LWDAI  K  S+  +L  + A+I
Sbjct  578   GRTAMHIAASIGSQHCVTLLLEFGGDPNIKDSEGSVPLWDAIVGKHESVIKLLSDNGATI  637

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
             S   V G   C A + N+  ++++++K+G  V     +G+T +  A+ E   ++++ L+ 
Sbjct  638   SSGEV-GHFACTAVEQNNLELLKDIVKYGGDVTLPASNGTTPLHKAVSEGNIEIVQFLLD  696

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQC  378
              GA++D        P  L +     E+       + I     S      H N  S+P++ 
Sbjct  697   QGADVDKPDVYGWTPRALADHQGHEEIKFLFQRKSVI---TISSGQGSGHPN--SIPKKL  751

Query  377   SI-RVSIYRGHPATR  336
             ++  ++ Y   PA R
Sbjct  752   AVPHLAKYPSEPAIR  766



>ref|NP_001234258.1| potassium channel [Solanum lycopersicum]
 emb|CAA65254.1| potassium channel [Solanum lycopersicum]
Length=883

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/670 (48%), Positives = 437/670 (65%), Gaps = 10/670 (1%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  +ISP D +YR WET++V+LV Y+AWV PFE  FL  K 
Sbjct  33    LSTGILPSLGARSNRRVKLKRFIISPYDRQYRLWETFLVVLVVYTAWVSPFEFGFL-GKP  91

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L   DN+V+ FFA+DI+LTFFVA++D TT LL+   KKIA +Y+STWFL DV STIP
Sbjct  92    AGPLAKTDNVVNGFFAIDIILTFFVAFLDRTTYLLVDEHKKIAWKYMSTWFLFDVISTIP  151

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRVS  F RLEKD  F+YFWVRCA+L+ VTL
Sbjct  152   SELAVKISPKPLRQ---YGLFNMLRLWRLRRVSALFARLEKDRNFNYFWVRCAKLVCVTL  208

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC YY +A  YP   + W+G    +   +SL IRY++++YWS+TT+TTVGYGDL
Sbjct  209   FAVHCAGCFYYLIAVHYPDPKRTWIGVAMDDFLNQSLWIRYVTSIYWSITTLTTVGYGDL  268

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H  NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F  RN LP
Sbjct  269   HPENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLP  328

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             ARL++Q+LA++CL+F+  +E L QQ  +E LPK I  S+ H LF  +V+KVYLF+GVS +
Sbjct  329   ARLQDQMLAHLCLKFRTDSEGLQQQETLESLPKAIRSSVSHFLFYSLVDKVYLFRGVSND  388

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV  + +GD+ 
Sbjct  389   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLVVLKNGVEQVVGEVRAGDLC  448

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N LQH K++K+  
Sbjct  449   GEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIVQANVGDGTIIMNNLLQHLKEMKNPI  508

Query  1061  lgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E         M + L    AT   +   L+ LLK GLDPN  D+ G++ LHIAA
Sbjct  509   MEGVLLETEHMLARGRMDLPLTLCFATLRSDDLLLHHLLKRGLDPNESDNNGRSALHIAA  568

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG E CV++LL  G + + +D EGN  LW+AI  K  S+  +L    +       G   
Sbjct  569   SKGIENCVVLLLDFGADPNSRDSEGNVPLWEAIMGKHESVIQLLVDNGAKLSAGDVGHFA  628

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C A + N+ S+++E++++G  V     +GS+A+  A+ E   +++K L+  GA +D   +
Sbjct  629   CVAVEQNNLSLLKEIVRYGGDVTLPKINGSSALHVAVCEGNIEIVKYLLDRGANVDQPDE  688

Query  527   LNLAPLDLTE  498
              N  P DL E
Sbjct  689   HNWTPRDLAE  698



>gb|KCW81436.1| hypothetical protein EUGRSUZ_C02815 [Eucalyptus grandis]
Length=882

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/727 (46%), Positives = 450/727 (62%), Gaps = 19/727 (3%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             +SK ILP LG+        +  +ISP D RYR W++++VLLV Y+AWV PFE  FLE K 
Sbjct  1     MSKGILPSLGARTHRRVKLRQFIISPFDYRYRLWQSFLVLLVFYTAWVSPFEFGFLE-KP  59

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DN+V+ FFA+DI+LTFFVAY+D T+ LL+  RKKIA RY++TW   D+ STIP
Sbjct  60    QGPLAITDNVVNGFFAIDIILTFFVAYLDKTSYLLVDDRKKIALRYVTTWLAFDIISTIP  119

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             FE V  +          Y +  MLR WRLRRVS+ F RLEKD  F+YFWVRCA+L FVTL
Sbjct  120   FEVVKSILPSPLE---QYGIFNMLRLWRLRRVSSMFARLEKDKNFNYFWVRCAKLTFVTL  176

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLG---SLNVREESLKIRYISAMYWSMTTMTTVGYGD  1779
               VH A C YY LA RY      W+G        E SL IRY++++YWS+TT+TT GYGD
Sbjct  177   FAVHLAACFYYLLAARYKDPKNTWIGLTMGEYFHERSLGIRYVTSIYWSITTLTTTGYGD  236

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH VNT EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT  FR++IQAASNF  RN L
Sbjct  237   LHPVNTREMIFDIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASNFAQRNQL  296

Query  1598  PARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             P RL++Q+LA++ LR++  +E L QQ  +E LPK I  SI H LF  +V++VYLF+GVS 
Sbjct  297   PVRLQDQMLAHISLRYRTDSEGLQQQEFLEALPKAIRSSISHFLFYSLVDQVYLFRGVSN  356

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV++MKAEY  P+EDVI+QNE+P D+YI+V+G  ++I      EQ V     GD+
Sbjct  357   DLLFQLVSEMKAEYFSPKEDVILQNEAPTDLYILVTGAADLIMQRNGIEQEVGEAKKGDV  416

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
              GEVG LC RPQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQH ++ +  
Sbjct  417   CGEVGVLCYRPQLFTVRTKRLSQLLRLNRTSFLNIVQANVGDGTIIMNNLLQHLRERRQP  476

Query  1064  klgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              + +L  E        NM + L    A   G+   L++LL+ GLDPN  D  G+T +HIA
Sbjct  477   LMEELLDETEHMLARGNMELPLSLCFAAMRGDDQLLHQLLRRGLDPNEVDKNGRTAMHIA  536

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGD  714
             AS G + CV +LL+ G + ++KD EG+  LWDAI  K  S+  +L  + A+IS   V G 
Sbjct  537   ASIGSQHCVTLLLEFGGDPNIKDSEGSVPLWDAIVGKHESVIKLLSDNGATISSGEV-GH  595

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
               C A + N+  ++++++K+G  V     +G+T +  A+ E   ++++ L+  GA++D  
Sbjct  596   FACTAVEQNNLELLKDIVKYGGDVTLPASNGTTPLHKAVSEGNIEIVQFLLDQGADVDKP  655

Query  533   VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVSIY  357
                   P  L +     E+       + I     S      H N  S+P++ ++  ++ Y
Sbjct  656   DVYGWTPRALADHQGHEEIKFLFQRKSVI---TISSGQGSGHPN--SIPKKLAVPHLAKY  710

Query  356   RGHPATR  336
                PA R
Sbjct  711   PSEPAIR  717



>ref|XP_010670706.1| PREDICTED: potassium channel AKT1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=867

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/837 (41%), Positives = 488/837 (58%), Gaps = 67/837 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +   +SP D RYR WE ++V LV Y+AWV PFE  FL+S +
Sbjct  30    LSTNILPSLGARSTRGVILRRFTVSPFDPRYRSWEMYLVFLVFYTAWVSPFEFGFLKSPI  89

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DNIV+ FFA+DI+LTFFVAY+DP T LL+  R+ IA +Y+ TWF  D+ ST+P
Sbjct  90    -KGLAITDNIVNAFFAIDIILTFFVAYLDPQTFLLVDDRRLIAWKYIRTWFFFDIISTVP  148

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +     H    Y +  MLR WRLRRVS  F+RLEKD   +YFW+RC +L+ VTL
Sbjct  149   SELATKIIPDHIH---AYGLFNMLRLWRLRRVSKMFSRLEKDRNINYFWIRCCKLVCVTL  205

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCA C Y+FLA  YP   K W+G    N    +L + Y++++YWS+TT+TTVGYGDL
Sbjct  206   FSVHCAACFYFFLAAHYPDPKKTWIGLSFPNFETANLWLLYVTSIYWSITTLTTVGYGDL  265

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H VN  EM+F IF+MLFNLGLTAY+IGNMTNLVV GT +T  FR+ IQAASNF  RN LP
Sbjct  266   HPVNIREMVFDIFFMLFNLGLTAYLIGNMTNLVVHGTSKTRNFRDRIQAASNFSLRNRLP  325

Query  1595  ARLKEQILAYMCLRFKAES--LNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL++Q+L+++CL+++A+S  L QQ ++E LPK I  SI H LF  +++KVYLF+GVS +
Sbjct  326   VRLQDQMLSHLCLKYRADSEGLQQQEILESLPKAIKSSISHFLFYSLLDKVYLFRGVSND  385

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D+Y++V G +E I  ++ NEQVV  + +GD+ 
Sbjct  386   LLFQLVSEMKAEYFPPKEDVILQNEAPTDLYVLVHGAMEFIVQKLGNEQVVKEVKAGDVC  445

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL+L  T+LL  +Q    D   ++ N L+H K  +D  
Sbjct  446   GEIGVLCYRPQLFTVRTKRLCQLLRLNRTALLNLVQANVGDGAIIMNNLLEHLKVQEDPL  505

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  +  ++      G  ++ ++L    A  +   L  LL+ G  P+  D  G+T LHIAA
Sbjct  506   MQSVLTDVEKMLAQGQMDLPLSLCFAAAREDEPLLQHLLRRGCHPDERDMNGRTALHIAA  565

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL-  711
             + G+E    +LL HG   ++KD EGN  LWDAI  K  S+  +L    +       GD+ 
Sbjct  566   ANGNETIASILLAHGAEPNVKDSEGNIPLWDAILGKHDSLIKLLRDRGA---DLALGDVP  622

Query  710   --LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
                  A + ++  ++++++++G  + + +  GST +  A+     ++++ ++  G +ID 
Sbjct  623   RYASHAIEQDNLQLLKDIVRYGGDLTTSNSDGSTPLHFAVSSGNMNIVQFILEQGGDIDK  682

Query  536   AVKLNLAPLDLTEVLQKREL-------------------------GHRIAM---------  459
                    P  L +     E+                           RI           
Sbjct  683   PDVDKWTPRSLADFQGNEEIKALFDSKKKAGLDPAVKFSGTATGPASRIMKYPSTGTINV  742

Query  458   -PNTILHEAASKWAK---DDHQNS-----SSMPQQCSI---RVSIYRGHPATRRETQCPE  315
              PNT+      K  +   D  QNS     S+  +  S+    +S   G+ ATR   +CPE
Sbjct  743   PPNTVQMTQVEKNPRRQVDTFQNSLFGFVSAATRGESVDLNNLSNTSGNQATRVTLRCPE  802

Query  314   PG---RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
                  +L+ LP+T+ EL+ I G+K G     S +   EGA ID ID+IRD D+L ++
Sbjct  803   KSEVTKLVMLPKTMQELLEIGGKKFGCHC--SKVVTAEGAEIDEIDLIRDGDQLSLI  857



>ref|XP_004508540.1| PREDICTED: potassium channel AKT1-like isoform X2 [Cicer arietinum]
Length=889

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/684 (47%), Positives = 442/684 (65%), Gaps = 16/684 (2%)
 Frame = -2

Query  2519  QEDEDFSLG----KLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  2352
             QE+ + SL      LS  ILP LG+        + L+ISP D RYR WET++V+LV Y+A
Sbjct  10    QEELELSLDGSHYSLSTGILPSLGAKSNRRVKLRPLIISPYDRRYRIWETFLVILVVYTA  69

Query  2351  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  2172
             WV PFE  FL  K    L + DNIV+ FF +DIVLTFFVAY+D TT L +   K+IA +Y
Sbjct  70    WVSPFEFGFLR-KPQAPLSITDNIVNGFFFIDIVLTFFVAYVDKTTYLFVDKPKQIAWKY  128

Query  2171  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFS  1992
               TW   DV S IP E V  L          Y +  MLR WRLRRVS  F+RLEKD  ++
Sbjct  129   ARTWLAFDVISIIPSELVVKLSPSPFQ---TYGLFDMLRLWRLRRVSALFSRLEKDRNYN  185

Query  1991  YFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLG--SLNVREESLKIRYISAMY  1818
             YFWVRCA+L+ VTL  VHCAGC YY +A RY    + W+G  S +  + SL  RY++ +Y
Sbjct  186   YFWVRCAKLICVTLFAVHCAGCFYYLIAARYHDPKRTWIGQTSEDFVQLSLWTRYVTTIY  245

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+TT+TTVGYGDLH VN  EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++
Sbjct  246   WSITTLTTVGYGDLHPVNEREMMFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDT  305

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLP  1464
             IQAAS+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  
Sbjct  306   IQAASSFAQRNQLPPRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYS  365

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
             +++ VYLFKGVS ++L  LV++MK EY PP+EDVI+QNE+P D YI+V+G VE++  +  
Sbjct  366   LMDNVYLFKGVSNDLLFQLVSEMKPEYFPPKEDVILQNEAPTDFYILVTGAVELLVLKGG  425

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              EQV+    +G++ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++
Sbjct  426   VEQVM--AKTGELCGEIGVLCYKPQHFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIM  483

Query  1103  KNFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPN  930
              N L+H K+L D  +  + +E  +    G  ++ ++L    + G+   L++LLK GLDPN
Sbjct  484   NNLLKHLKELNDPIMEGVLVETENMLARGRMDLPVSLCFAASRGDDLLLHQLLKRGLDPN  543

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D+ G+T LHIAASKG E CV++LL +G N ++KD +GN ALW+AI      +  +L  
Sbjct  544   ESDNNGRTALHIAASKGKENCVLLLLDYGANPNIKDSDGNVALWEAILGGHELVGKLLIE  603

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
               +       G   C AA+ N+ ++++++ +HG  +   +  G+TA+  A+ E+  D++K
Sbjct  604   NGATLQNGDVGQYACTAAEQNNLNLLKDIRRHGGDITLTNSLGTTALHVAVSEDNVDIVK  663

Query  569   LLVMNGAEIDDAVKLNLAPLDLTE  498
              L+  GA ID   K    P DL +
Sbjct  664   YLLDQGANIDKPDKHGWTPRDLAD  687



>gb|KHG29670.1| Potassium channel AKT1 -like protein [Gossypium arboreum]
Length=872

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/842 (41%), Positives = 491/842 (58%), Gaps = 69/842 (8%)
 Frame = -2

Query  2486  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  2307
             S  ILP LG+        +  ++SP D RYR W+T++V+LV Y+AWV PFE  FL +K  
Sbjct  34    STGILPSLGARSNRRVKLRRFIVSPYDRRYRIWQTFLVILVVYTAWVSPFEFGFL-NKPR  92

Query  2306  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  2127
               L V DN+V+ FFA+DI+LTFFVAY+D  T L I   KKIA +Y  +W L D+ S+IP 
Sbjct  93    PILSVTDNVVNGFFALDIILTFFVAYLDKATYLFIDDPKKIAWKYGRSWLLFDIISSIPS  152

Query  2126  EFVAFLFTGKHHLGVC-YSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
             E    +        +C Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA+L+ VTL
Sbjct  153   ELARKISPKP----LCSYGLFNMLRLWRLRRVSAMFSRLEKDKNYNYFWVRCAKLVCVTL  208

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
              +VHCAGC  Y +A RY   G+ W+G++   N  E+SL  RY++++YWS+TT+TTVGYGD
Sbjct  209   FIVHCAGCFIYLIAARYHDPGRTWIGAVLGDNFTEQSLLSRYVTSIYWSITTLTTVGYGD  268

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             +H VNT EM F + YML NLGL AY+IGNMTNLVV  T RT  FR++IQAAS+F  RN L
Sbjct  269   IHPVNTGEMAFDVLYMLLNLGLIAYLIGNMTNLVVHRTSRTRLFRDTIQAASSFAVRNQL  328

Query  1598  PARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             P RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+ V+LF+GVS 
Sbjct  329   PVRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDNVFLFRGVST  388

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV     GD+
Sbjct  389   DLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKEGDI  448

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
             FGE+G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N LQH K   + 
Sbjct  449   FGEIGVLCYRPQLFTVRTKRLCQLLRLNRTTFLNIIQANVGDGTIIMNNLLQHLKDTDNP  508

Query  1064  klgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              +  +  E  +    G  ++ +NL      G+ + L+ LLK GLDPN  D+ G+T LHIA
Sbjct  509   IMQGILKETENMLARGRMDLPLNLCFATLRGDDSLLHRLLKRGLDPNESDNNGRTALHIA  568

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             ASKG E C+++LL +G + + KD EG   LW+A+    + +  +L    +  +    G  
Sbjct  569   ASKGSENCILLLLYYGADPNYKDSEGIVPLWEALLGGHNKVAKLLKENGANINAGDVGHY  628

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
              C AA+ N+ +++++++ +G  V     +G TA+ AA+ E   +++K LV  GA+I+   
Sbjct  629   ACTAAEQNNLTLLKQIIYYGGDVTCPSHNGHTALHAAVCEGNIEIVKFLVEQGADINKPD  688

Query  530   KLNLAPLDLTE---------------------------VLQKRELGHRIAMP--------  456
               +  P +L E                           V +K+ LG   + P        
Sbjct  689   VHHWTPSELAEQQGHEEIKAIFESSKELKTKTDQSSMFVPEKQFLGRFTSEPVIRPAPID  748

Query  455   --NTILHEAASKWAKDDHQN------SSSMPQQCSIRVSIYRGHPAT-------RRETQC  321
               +    ++  +   ++  N      S++   +  + +S+ R    T       R    C
Sbjct  749   TSDGSCSQSRPRRRTNNFHNSLFGIMSAARNGEKGLLLSVNRNKGVTDSIVTSARVVISC  808

Query  320   PE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
             PE     G+LI LP T  E I I  +K G     + +  +EG  ID IDVIRD D L  V
Sbjct  809   PEIGHVHGKLIVLPGTFKEFIEIGAKKFGIFG--AKVVTKEGVEIDDIDVIRDGDHLVFV  866

Query  152   AD  147
              +
Sbjct  867   TN  868



>sp|P0C550.1|AKT1_ORYSI RecName: Full=Potassium channel AKT1; Short=OsAKT1 [Oryza sativa 
Indica Group]
Length=935

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/678 (46%), Positives = 438/678 (65%), Gaps = 11/678 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  64    RDGSHYSISSAILPSLGARSNRRIKLRRFIISPYDRRYRIWETFLIVLVVYSAWVSPFEF  123

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L   DN+V+ FFAVDI+LTFFVAY+D  + +L    KKIA RY +TW ++
Sbjct  124   GFI-PKPTGALATADNVVNAFFAVDIILTFFVAYLDKMSYMLEDDPKKIAWRYSTTWLVL  182

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA
Sbjct  183   DVASTIPSEFARRILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCA  239

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+T
Sbjct  240   KLICVTLFAVHCAACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLT  299

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA++F
Sbjct  300   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNYRDTIQAATSF  359

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYL
Sbjct  360   GVRNQLPPRLQDQMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYL  419

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++ +   +QV+  
Sbjct  420   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEQQNGADQVIQV  479

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FL  1092
               SG++ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL
Sbjct  480   ATSGEVVGEIGVLCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFL  539

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +  K+   +      IE     G+ ++ I L   V  G+   L++LLK G+DPN  D+ G
Sbjct  540   KEQKENSVMAGVVKEIESMLARGNLDLPITLCFAVTRGDDFLLHQLLKRGMDPNESDNDG  599

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +   
Sbjct  600   HTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLS  659

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + +D+ ++ +++ +G  V+   R G+TA+  A+ +    M +LL+ +G
Sbjct  660   SGDTGLYACIAVEESDTELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMAELLLEHG  719

Query  551   AEIDDAVKLNLAPLDLTE  498
             A+ID        P  L E
Sbjct  720   ADIDKQDGNGWTPRALAE  737



>ref|NP_001043713.1| Os01g0648000 [Oryza sativa Japonica Group]
 sp|Q0JKV1.1|AKT1_ORYSJ RecName: Full=Potassium channel AKT1; Short=OsAKT1 [Oryza sativa 
Japonica Group]
 dbj|BAF05627.1| Os01g0648000 [Oryza sativa Japonica Group]
Length=935

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/678 (46%), Positives = 438/678 (65%), Gaps = 11/678 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  64    RDGSHYSISSAILPSLGARSNRRIKLRRFIISPYDRRYRIWETFLIVLVVYSAWVSPFEF  123

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L   DN+V+ FFAVDI+LTFFVAY+D  + +L    KKIA RY +TW ++
Sbjct  124   GFI-PKPTGALATADNVVNAFFAVDIILTFFVAYLDKMSYMLEDDPKKIAWRYSTTWLVL  182

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA
Sbjct  183   DVASTIPSEFARRILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCA  239

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+T
Sbjct  240   KLICVTLFAVHCAACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLT  299

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA++F
Sbjct  300   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNYRDTIQAATSF  359

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYL
Sbjct  360   GVRNQLPPRLQDQMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYL  419

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE+++ +   +QV+  
Sbjct  420   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEQQNGADQVIQV  479

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FL  1092
               SG++ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL
Sbjct  480   ATSGEVVGEIGVLCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFL  539

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +  K+   +      IE     G+ ++ I L   V  G+   L++LLK G+DPN  D+ G
Sbjct  540   KEQKENSVMAGVVKEIESMLARGNLDLPITLCFAVTRGDDFLLHQLLKRGMDPNESDNDG  599

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +   
Sbjct  600   HTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLS  659

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + +D+ ++ +++ +G  V+   R G+TA+  A+ +    M +LL+ +G
Sbjct  660   SGDTGLYACIAVEESDTELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMAELLLEHG  719

Query  551   AEIDDAVKLNLAPLDLTE  498
             A+ID        P  L E
Sbjct  720   ADIDKQDGNGWTPRALAE  737



>ref|XP_009400651.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=890

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/679 (47%), Positives = 430/679 (63%), Gaps = 12/679 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++++LV YSAWV PFE 
Sbjct  17    RDGSHYSLSSGILPSLGARSNRRVKLRSSIVSPYDRRYRTWETFLIVLVIYSAWVSPFEF  76

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL++     L + DNIV+ FFAVDIVLTFFVAY++ TT LL+   KKIA RYL+TWF++
Sbjct  77    GFLDNS-KGSLALADNIVNAFFAVDIVLTFFVAYLNRTTYLLVDDHKKIAVRYLTTWFIL  135

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +          Y    MLR WRLRRVS  F RLEKD  F+YFWVRCA
Sbjct  136   DVASTIPSEIALRILPSSLR---SYGFFNMLRLWRLRRVSALFARLEKDRSFNYFWVRCA  192

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY      W+G+   +  E SL  RY+++MYWS+TT+T
Sbjct  193   KLICVTLFAVHCAGCFYYLLAARYHDPSGTWIGASMADFLERSLWDRYVTSMYWSITTLT  252

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF   YMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA+ F
Sbjct  253   TVGYGDLHAENTREMIFATIYMLFNLGLTAYLIGNMTNLVVHGTSRTRRYRDTIQAATGF  312

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN +P RL+EQ+++++ L+F+  +E L QQ +++ LPK I  SI H+LF  +V++VYL
Sbjct  313   AQRNQIPERLQEQMISHLSLKFRTDSEGLQQQEILDSLPKAIRSSISHYLFYSLVQQVYL  372

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEM-ENEQVVW  1266
             F+GVS ++L  LV++MK EY PPREDVI+QNE+P D YI+V+G  E+ID+     EQ+V 
Sbjct  373   FRGVSHDLLFQLVSEMKGEYFPPREDVILQNEAPTDFYILVTGSAELIDHRSGSEEQIVR  432

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
                 GD+ GE+G LC RPQ FT RT++L QLL+L  T  L  +Q    D   +I N LQ+
Sbjct  433   VAKKGDLVGEIGILCYRPQLFTVRTRSLCQLLRLNRTVFLNLVQSNVGDGTIIINNLLQY  492

Query  1085  HkklkdlklgdLF---IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
              K+  D  L +     IE     G   + + L   V  G+   L++LL+ GLDP+  D+ 
Sbjct  493   LKEQMDDPLMEGLLRDIETMLTRGRLELPLTLSFAVVRGDDLLLHQLLRRGLDPSESDNN  552

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G T LHIAASKG+E CV +LL  G + +  D EG+  LW+AI  K   +  +L    +  
Sbjct  553   GHTALHIAASKGNEHCVRLLLDFGADPNSLDSEGSVPLWEAILGKHEQVVKLLIDNGAHL  612

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                  G   C AA  N+  +++++++HG  V ++ + GSTA+  A+ E    + + L+ +
Sbjct  613   SAGDMGHFACTAAAQNNIELLEDIIRHGGDVTAEKKDGSTALHRAVCEGNPRLAEFLIQH  672

Query  554   GAEIDDAVKLNLAPLDLTE  498
             GA++D        P  L +
Sbjct  673   GADMDKPDHHGWTPRSLAD  691



>ref|XP_010546590.1| PREDICTED: potassium channel AKT6 [Tarenaya hassleriana]
Length=884

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/844 (41%), Positives = 498/844 (59%), Gaps = 70/844 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQ--GLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  2316
             LSK +LPPLG++  +    +    +ISP D RYR WET++V LV Y+AW  PFE  FL S
Sbjct  41    LSKGLLPPLGATSRSSRDPKLRRFMISPFDPRYRAWETFLVFLVLYTAWASPFEFGFLRS  100

Query  2315  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  2136
                  L ++DN+V+ FFA+DI+L FF+A++D  T LLI   KKIA RY STW   DV ST
Sbjct  101   P-RAPLGILDNVVNGFFAMDIILRFFLAFLDKATYLLIDDPKKIAWRYASTWLAFDVVST  159

Query  2135  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFV  1956
             IP+E  A +    H     Y +  MLR WRLRRVSN F+RLEKD ++SYFWVRC +LL V
Sbjct  160   IPYELFASVVL--HETIQGYGIFSMLRLWRLRRVSNLFSRLEKDRKYSYFWVRCTKLLLV  217

Query  1955  TLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVGYG  1782
             TL ++HCA C  Y +A  YP   K +  L + N ++  L  +YI+AMYWS+TT++T GYG
Sbjct  218   TLFVIHCAACFCYSIAAHYPDPSKTFMALSNENWQQAPLSGQYITAMYWSITTLSTTGYG  277

Query  1781  DLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNH  1602
             D+H VNT EM FI+ YM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQAAS F  RNH
Sbjct  278   DIHGVNTREMTFILCYMVFNLGLSAYIIGNMTNLVVHVTSRTRKFRDTIQAASGFAQRNH  337

Query  1601  LPARLKEQILAYMCLRFKAES--LNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVS  1428
             LP RL+EQ++A++ LR++A+S  L QQ + + LPK I  SI H+LF  +V+KVYL++G+S
Sbjct  338   LPVRLQEQMVAHLSLRYRADSEGLQQQEIFDTLPKAIRSSISHYLFYDIVDKVYLYQGIS  397

Query  1427  REILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGD  1248
              ++L  LV++ KAEY PPREDVI+QNE+P D YI+V+G V++I      EQVV    +GD
Sbjct  398   NDLLFQLVSETKAEYFPPREDVILQNEAPTDFYILVTGAVDIIARVNGVEQVVGEAQTGD  457

Query  1247  MFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkd  1068
             + GEVG LC RPQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQH K  +D
Sbjct  458   VVGEVGVLCYRPQLFTVRTKRLSQLLRLNRTSFLHLVQANVGDGAIIMTNLLQHLKDSED  517

Query  1067  lklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
               +  +  +       G  ++ ++L    A G+   L++L+K G +PN  D+ G+T LH+
Sbjct  518   PVMQGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLIKRGSNPNETDNNGRTALHV  577

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AAS+G + CV++LL+HG + +++D EG+  LW+AI  +   I  +L    +   P +AG 
Sbjct  578   AASRGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHGEIAQLLAENGARLSPDMAGH  637

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
               C A ++N    ++ ++K+G      D +G+TA+  A+ E   +++K L+  G++ID  
Sbjct  638   FSCLAVELNSIDALKGIIKYGGKTSLPDSNGTTALHKAVSEGNIEIVKFLLQQGSDIDKT  697

Query  533   VKLNLAPLDLTE---------VLQKRELGHRIAMPNT-ILHEAASKWAKD---DHQNSS-  396
                   P  L E         + Q  +    + +P   +L +   K++ +     +NSS 
Sbjct  698   DMYGWTPRGLAEHQGHEDIKSLFQNHKPKSVVGIPEAPVLGKPLMKYSSEPLVPPRNSSD  757

Query  395   -SMP-----------QQCSI---RVSIY----RGHPATRRETQC---PEPG---------  309
              SMP           Q+  I   R S++      + A  +       P PG         
Sbjct  758   TSMPITPERRGSDVSQRRKINNFRNSLFGIMSSANTAEDKGASARNPPTPGVSAIYPARI  817

Query  308   -------------RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDND  168
                          +++ LP ++ EL+ I  +K+GF  T   L +   A ID I +IRD D
Sbjct  818   TISWSENGEITRKKVVLLPNSMEELLEICQKKIGFVPT-KVLLEGADAEIDDIKLIRDGD  876

Query  167   KLFI  156
              L +
Sbjct  877   HLLL  880



>ref|XP_010925144.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Elaeis 
guineensis]
Length=894

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/682 (48%), Positives = 446/682 (65%), Gaps = 19/682 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP + RYR WET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSLSSGILPSLGAMTNRRIKLRRFIVSPYERRYRSWETFLIILVIYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FLE K    L V+DNIV+ FFAVDI+LTFFVA+ID  T LLI   K+IA +Y+++WF++
Sbjct  87    GFLE-KEKGALPVMDNIVNGFFAVDIILTFFVAFIDRVTYLLIDDPKQIAWKYITSWFVL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +   K      Y    MLR WRLRRVS  F RLEKD  F+YFWVRC 
Sbjct  146   DVVSTIPTELARKILPPKLR---SYGFFNMLRLWRLRRVSALFARLEKDRNFNYFWVRCV  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA R  +  K W+G    +  E SL IRY+++MYWS+TT+T
Sbjct  203   KLICVTLFAVHCAGCFYYLLAARNHNPSKTWIGVYMPDFHERSLWIRYVTSMYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  263   TVGYGDLHAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATDF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI HHLF  +V+KVYL
Sbjct  323   AQRNQLPVRLQDQMISHLTLKFRTDSEGLQQQETLDALPKAIRSSISHHLFYDLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++M+AEY PPREDVI+QNE+P D YI+V+G  E+ID +   EQ V  
Sbjct  383   FRGVSNDLLFQLVSEMRAEYFPPREDVILQNEAPTDFYILVTGTAELIDLKNAIEQTVRV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC RPQ FT RTK+L QLL+L  T+ L  +Q    D  T++ N LQ+ 
Sbjct  443   ARAGDLVGEIGVLCYRPQLFTVRTKSLCQLLRLNRTAFLSTVQSNVGDGTTIMNNLLQYL  502

Query  1082  kklkdlklgdLFIEIGDED---GDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             K+ +D  + +  +   +     G  ++ + L   V  G+   L++LL+ GLDPN  D+ G
Sbjct  503   KEQEDDPVMEGILREVENMLTWGRLDLPLTLCFAVIRGDDLLLHQLLRRGLDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASIS  735
              T LHIAASKG + CV +LL +G N + +D EG+  LW+A+  K  ++  +L  + A++S
Sbjct  563   HTALHIAASKGSKHCVRLLLDYGANPNCRDSEGSVPLWEAVLGKHDAVVKLLRDNGANLS  622

Query  734   DPYVAGDL---LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
                 AGD+    C AA+ N   +++++++HG  V    + G+TA+  A+ E    +++ L
Sbjct  623   ----AGDMGLFACIAAEQNSLELLKDIIRHGGDVTLPKKDGNTALHLAVCEGNHQIVEFL  678

Query  563   VMNGAEIDDAVKLNLAPLDLTE  498
             +  GA+ID        P +L E
Sbjct  679   LKQGADIDKPNYHGWTPRNLAE  700



>ref|XP_010670705.1| PREDICTED: potassium channel AKT1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=871

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/844 (41%), Positives = 490/844 (58%), Gaps = 67/844 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             +D S   LS  +LP LG+            +SP D RYR WE ++V LV Y+AWV PFE 
Sbjct  27    DDSSHYSLSNGVLPSLGARSNRGVILHRSTVSPFDPRYRSWEMYLVFLVFYTAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+S +   L + DNIV+ FFA+DI+LTFFVAY+DP T LL+  R+ IA +Y+ TWF  
Sbjct  87    GFLKSPI-KGLAITDNIVNAFFAIDIILTFFVAYLDPQTFLLVDDRRLIAWKYIRTWFFF  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ ST+P E    +     H    Y +  MLR WRLRRVS  F+RLEKD   +YFW+RC 
Sbjct  146   DIISTVPSELATKIIPDHIH---AYGLFNMLRLWRLRRVSKMFSRLEKDRNINYFWIRCC  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C Y+FLA  YP   K W+G    N    +L + Y++++YWS+TT+T
Sbjct  203   KLVCVTLFSVHCAACFYFFLAAHYPDPKKTWIGLSFPNFETANLWLLYVTSIYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN  EM+F IF+MLFNLGLTAY+IGNMTNLVV GT +T  FR+ IQAASNF
Sbjct  263   TVGYGDLHPVNIREMVFDIFFMLFNLGLTAYLIGNMTNLVVHGTSKTRNFRDRIQAASNF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFKAES--LNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+L+++CL+++A+S  L QQ ++E LPK I  SI H LF  +++KVYL
Sbjct  323   SLRNRLPVRLQDQMLSHLCLKYRADSEGLQQQEILESLPKAIKSSISHFLFYSLLDKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D+Y++V G +E I  ++ NEQVV  
Sbjct  383   FRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDLYVLVHGAMEFIVQKLGNEQVVKE  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
             + +GD+ GE+G LC RPQ FT RTK L QLL+L  T+LL  +Q    D   ++ N L+H 
Sbjct  443   VKAGDVCGEIGVLCYRPQLFTVRTKRLCQLLRLNRTALLNLVQANVGDGAIIMNNLLEHL  502

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K  +D  +  +  ++      G  ++ ++L    A  +   L  LL+ G  P+  D  G+
Sbjct  503   KVQEDPLMQSVLTDVEKMLAQGQMDLPLSLCFAAAREDEPLLQHLLRRGCHPDERDMNGR  562

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAA+ G+E    +LL HG   ++KD EGN  LWDAI  K  S+  +L    +    
Sbjct  563   TALHIAAANGNETIASILLAHGAEPNVKDSEGNIPLWDAILGKHDSLIKLLRDRGA---D  619

Query  728   YVAGDL---LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                GD+      A + ++  ++++++++G  + + +  GST +  A+     ++++ ++ 
Sbjct  620   LALGDVPRYASHAIEQDNLQLLKDIVRYGGDLTTSNSDGSTPLHFAVSSGNMNIVQFILE  679

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKREL-------------------------GHRI----  465
              G +ID        P  L +     E+                           RI    
Sbjct  680   QGGDIDKPDVDKWTPRSLADFQGNEEIKALFDSKKKAGLDPAVKFSGTATGPASRIMKYP  739

Query  464   ------AMPNTILHEAASKWAK---DDHQNS-----SSMPQQCSI---RVSIYRGHPATR  336
                     PNT+      K  +   D  QNS     S+  +  S+    +S   G+ ATR
Sbjct  740   STGTINVPPNTVQMTQVEKNPRRQVDTFQNSLFGFVSAATRGESVDLNNLSNTSGNQATR  799

Query  335   RETQCPEPG---RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  165
                +CPE     +L+ LP+T+ EL+ I G+K G     S +   EGA ID ID+IRD D+
Sbjct  800   VTLRCPEKSEVTKLVMLPKTMQELLEIGGKKFGCHC--SKVVTAEGAEIDEIDLIRDGDQ  857

Query  164   LFIV  153
             L ++
Sbjct  858   LSLI  861



>gb|AAL40894.1| AKT1-like potassium channel, partial [Oryza sativa]
Length=860

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/871 (40%), Positives = 499/871 (57%), Gaps = 110/871 (13%)
 Frame = -2

Query  2474  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  2295
             LP LG+        +  +ISP D RYR WET++++LV YSAWV PFE  F+  K    L 
Sbjct  1     LPSLGARSNRRIKLRRFIISPYDRRYRIWETFLIVLVVYSAWVSPFEFGFI-PKPTGALA  59

Query  2294  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  2115
               DN+V+ FFAVDI+LTFFVAY+D  + +L    KKIA RY +TW ++DVASTIP EF  
Sbjct  60    TADNVVNAFFAVDIILTFFVAYLDKMSYMLEDDPKKIAWRYSTTWLVLDVASTIPSEFAR  119

Query  2114  FLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVHC  1935
              +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA+L+ VTL  VHC
Sbjct  120   RILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCAKLICVTLFAVHC  176

Query  1934  AGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNT  1761
             A C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+TTVGYGDLHA NT
Sbjct  177   AACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLTTVGYGDLHAENT  236

Query  1760  LEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKE  1581
              EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA++F  RN LP RL++
Sbjct  237   REMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNYRDTIQAATSFGVRNQLPPRLQD  296

Query  1580  QILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLL  1407
             Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYLF+GVS +++  L
Sbjct  297   QMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYLFQGVSNDLIFQL  356

Query  1406  VADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGA  1227
             V++MKAEY PPREDVI+QNE+P D YI+VSG VE+++ +   +QV+    SG++ GE+G 
Sbjct  357   VSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELVEQQNGADQVIQVATSGEVVGEIGV  416

Query  1226  LCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FLQHHkklkdlklg  1056
             LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL+  K+   +   
Sbjct  417   LCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFLKEQKENSVMAGV  476

Query  1055  dLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
                IE     G+ ++ I L   V  G+   L++LLK G+DPN  D+ G T LHIAASKG+
Sbjct  477   VKEIESMLARGNLDLPITLCFAVTRGDDFLLHQLLKRGMDPNESDNDGHTALHIAASKGN  536

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +       G   C A 
Sbjct  537   EQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLSSGDTGLYACIAV  596

Query  695   KMNDSSVMQE---------------------------------LLKHGLHVDSKDRHGST  615
             + +D+ ++ +                                 LL+HG  +D +D +G T
Sbjct  597   EESDTELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMAELLLEHGADIDKQDGNGWT  656

Query  614   AIQAAMEENQADMIKLLVMNGAEIDDAV-----------------------KLNLAPL--  510
               +A  E+   D I+LL  +      +                        + N  P+  
Sbjct  657   P-RALAEQQGHDDIQLLFRSRKAATASGHHHVPSSTTTRVAPAAAAASLIGRFNSEPMMK  715

Query  509   -------DL-TEVLQKRELGHRIAMPNTILHEAASKWAK--DDHQ------------NSS  396
                    DL + VL ++    R+   N++    +S  A+   DH             N S
Sbjct  716   NMIHEDADLPSRVLPEKLRRKRVTFQNSLFGVISSSQAQRETDHPLSRGGLAATGSPNPS  775

Query  395   SMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDS  228
             S  +   IRV+I            CPE     G+L+ LP+T+  L+ +  +K  FD   +
Sbjct  776   SGSRNAVIRVTI-----------SCPEKGNTAGKLVLLPQTLDMLLELGAKK--FDFAPT  822

Query  227   SLTDEEGAIIDSIDVIRDNDKLFIVAD-WNS  138
              +   EGA +D +++IRD D L +V+D W++
Sbjct  823   KVLTVEGAEVDEVELIRDGDHLVLVSDEWDA  853



>ref|XP_011014911.1| PREDICTED: potassium channel AKT1-like [Populus euphratica]
Length=880

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/665 (48%), Positives = 440/665 (66%), Gaps = 13/665 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+           +ISP D RYR WET++V+LV Y+AWV PFE 
Sbjct  25    RDGSHYSLSTGILPSLGARSNRRVKLNRFIISPYDRRYRVWETFLVVLVIYTAWVSPFEF  84

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+   +  L + DN+V+ FFA DIVLTFF+AY+D TT LL+  RKKIA +Y ++W  +
Sbjct  85    GFLKQP-ERPLSICDNVVNGFFATDIVLTFFLAYLDKTTYLLVDDRKKIAWKYATSWLAL  143

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ ST P E    +          Y    MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  144   DIISTTPTELARKISPKPFQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  200

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSMTTM  1800
             +L+ VTL  VH AGC YY +A RY    + W+G+    N  E+SL  RY++++YWS+TT+
Sbjct  201   KLICVTLFAVHSAGCFYYLIAARYHDPQRTWIGASLGDNFLEQSLWRRYVTSIYWSITTL  260

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+
Sbjct  261   TTVGYGDLHPVNTREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASS  320

Query  1619  FVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVY
Sbjct  321   FAQRNQLPGRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDKVY  380

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LF+GVS ++L  LV++MKAEY PP EDVI+QNE+P D YI+V+G V+++  +   EQVV 
Sbjct  381   LFQGVSNDLLFQLVSEMKAEYFPPNEDVILQNEAPTDFYILVTGAVDLLVIKNGVEQVVG  440

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
                +GD+ GE+  LCCRPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQ+
Sbjct  441   EAKTGDLCGEIAVLCCRPQLFTVRTKRLSQLLRLNRTAFLNIVQANVGDGTLIVNNLLQY  500

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              K+LKD  +  + +E  +    G  ++ + L      G+   L++LLK GLDPN  D+ G
Sbjct  501   LKELKDPIMEGVLLETENMLARGRMDLPLTLCFAALRGDDLLLHQLLKRGLDPNESDNNG  560

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSIL-YHWASIS  735
             ++ +HIAASKG E CV++LL HG + + +D +GN  LW+A+     ++  +L  + ASI 
Sbjct  561   RSAMHIAASKGSENCVLLLLDHGADPNCRDSDGNVPLWEAMLGGHEAVAILLIQNGASIR  620

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                V G   C AA+ N+ +++ E++++G  V S   +G TA+  A+ E+ A++++ L+  
Sbjct  621   HGDV-GHFACTAAEKNNLNLLNEIVRYGGDVTSPRNNGITALHVAVCEDNAEIVRFLLDQ  679

Query  554   GAEID  540
             GA+ID
Sbjct  680   GADID  684



>gb|ADA79674.1| shaker-like potassium channel 1 [Populus euphratica]
Length=880

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/665 (48%), Positives = 440/665 (66%), Gaps = 13/665 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+           +ISP D RYR WET++V+LV Y+AWV PFE 
Sbjct  25    RDGSHYSLSTGILPSLGARSNRRVKLNRFIISPYDRRYRVWETFLVVLVIYTAWVSPFEF  84

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+   +  L + DN+V+ FFA DIVLTFF+AY+D TT LL+  RKKIA +Y ++W  +
Sbjct  85    GFLKQP-ERPLSICDNVVNGFFATDIVLTFFLAYLDKTTYLLVDDRKKIAWKYATSWLAL  143

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ ST P E    +          Y    MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  144   DIISTTPTELARKISPKPFQ---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  200

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL---NVREESLKIRYISAMYWSMTTM  1800
             +L+ VTL  VH AGC YY +A RY    + W+G+    N  E+SL  RY++++YWS+TT+
Sbjct  201   KLICVTLFAVHSAGCFYYLIAARYHDPQRTWIGASLGDNFLEQSLWRRYVTSIYWSITTL  260

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TTVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+
Sbjct  261   TTVGYGDLHPVNTREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASS  320

Query  1619  FVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVY
Sbjct  321   FAQRNQLPGRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLVDKVY  380

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LF+GVS ++L  LV++MKAEY PP EDVI+QNE+P D YI+V+G V+++  +   EQVV 
Sbjct  381   LFQGVSNDLLFQLVSEMKAEYFPPNEDVILQNEAPTDFYILVTGAVDLLVIKNGVEQVVG  440

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
                +GD+ GE+  LCCRPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQ+
Sbjct  441   EAKTGDLCGEIAVLCCRPQLFTVRTKRLSQLLRLNRTAFLNIVQANVGDGTLIVNNLLQY  500

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              K+L+D  +  + +E  +    G  ++ + L      G+   L++LLK GLDPN  D+ G
Sbjct  501   LKELRDPIMEGVLLETENMLARGRMDLPLTLCFAALRGDDLLLHQLLKRGLDPNESDNNG  560

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSIL-YHWASIS  735
             ++ +HIAASKG E CV++LL HG + + +D +GN  LW+A+     ++  +L  + ASI 
Sbjct  561   RSAMHIAASKGSENCVLLLLDHGADPNCRDSDGNVPLWEAMLGGHEAVAVLLIQNGASIR  620

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                V G   C AA+ N+ +++ E++++G  V S   +G TA+  A+ E+ A++++ L+  
Sbjct  621   HGDV-GHFACTAAEKNNLNLLNEIVRYGGDVTSPRNNGITALHVAVCEDNAEIVRFLLDQ  679

Query  554   GAEID  540
             GA+ID
Sbjct  680   GADID  684



>emb|CAG27094.1| inwardly rectifying potassium channel subunit [Daucus carota]
Length=873

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/677 (47%), Positives = 433/677 (64%), Gaps = 10/677 (1%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   L+  ILP LG+        +  +ISP D RYR WET++V+LV Y+AWV PFE+
Sbjct  20    RDGSHYSLTTGILPSLGARSNRRVQLRNFIISPYDRRYRFWETFLVILVIYTAWVSPFEL  79

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL  K    L V+DN+V+ FFA+DIVLTFFVAY+D  T LLI  RK IA +Y STW   
Sbjct  80    GFLH-KARPPLSVLDNVVNGFFAIDIVLTFFVAYLDRNTYLLIDDRKLIAWKYTSTWLAF  138

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +          Y +  MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  139   DVISTIPSELALKISPSPLR---TYGLFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRCA  195

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VH + C YY +A  Y    K W+G+   + + +SL IRY++++YWS+TT+T
Sbjct  196   KLICVTLFAVHSSACFYYLIAADYHDPSKTWIGASITDFKNQSLWIRYVTSIYWSITTLT  255

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMI+ IFYMLFNLGLTAY+IGNMTNLVV GT +T +FR++IQAAS+F
Sbjct  256   TVGYGDLHAQNTGEMIYDIFYMLFNLGLTAYLIGNMTNLVVHGTSKTRQFRDTIQAASSF  315

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +V+KVYL
Sbjct  316   AHRNRLPVRLQDQMLAHLCLKFRTDSEGLQQQETLDTLPKAIRSSISHFLFYTLVDKVYL  375

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV  
Sbjct  376   FRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLVVLKNGVEQVVGE  435

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+    +Q    D   ++ N LQH 
Sbjct  436   AKTGDLCGEIGVLCYRPQLFTARTKRLSQLLRLNRTTFFNIIQANVGDGTIIMNNLLQHL  495

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGK  909
              + KD  +  + +E         M + L    AT  G+   LN+LLK GLDPN  D+  +
Sbjct  496   IEEKDPMMEGVLLETEHMLARGRMDLPLSLCFATLRGDDQLLNQLLKRGLDPNESDNNNR  555

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAASKG+E CV++LL +G + + +D EGN  LW+A+ +    +  +L    ++   
Sbjct  556   TALHIAASKGNENCVLLLLDYGADPNSRDSEGNVPLWEAMLSNHEQVVKVLADNGAVISS  615

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGA  549
                G   C AA+ N+  +++E++  G  V     +G+TA+  A+ E   D++K L+  G 
Sbjct  616   GDTGYFACIAAEQNNLDLLKEIVHRGGDVTRPKSNGATALHVAVCEGNVDIVKFLLDQGC  675

Query  548   EIDDAVKLNLAPLDLTE  498
               D A      P +L E
Sbjct  676   YADKADDHGWTPRNLAE  692



>ref|XP_006475780.1| PREDICTED: potassium channel AKT1-like [Citrus sinensis]
 gb|KDO80354.1| hypothetical protein CISIN_1g002763mg [Citrus sinensis]
Length=883

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/856 (40%), Positives = 496/856 (58%), Gaps = 69/856 (8%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             Q   D S   LS  +LP LG+        +  ++SP D RYR WET++VLLV Y+AW  P
Sbjct  24    QLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASP  83

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L V+DN+V+ FFAVDI+LTFFVAY+D  T LL+   K+IA +Y S+W
Sbjct  84    FEFGFLR-KPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSW  142

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV STIP E    +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWV
Sbjct  143   LVFDVISTIPSELAQKISPKPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWV  199

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGS---LNVREESLKIRYISAMYWSM  1809
             RC +L+FVTL  VHCAGC YY LA RY +  + W+G+    N  E+SL IRY+++MYWS+
Sbjct  200   RCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSI  259

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT+TTVGYGDLH VNT EM+F I +MLFNLGLTAY+IGNMTNLVV GT RT +FR++IQA
Sbjct  260   TTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQA  319

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS+F  RN LP RL++Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H+LF  +++
Sbjct  320   ASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMD  379

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             KVYLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQ
Sbjct  380   KVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQ  439

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV    +G++ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N 
Sbjct  440   VVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNL  499

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             LQH K LKD  +  + +E  +    G  ++ ++L      G+   L++LLK GLDPN  D
Sbjct  500   LQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESD  559

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
             + G+T LHIAASKG E CV++LL +  + +  D +GN  LW+A+     ++  +L    +
Sbjct  560   NNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHA  619

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
               +    G   C AA+ N+  +++E++ +G  V  +  +GSTA+  A+ E+  ++++ L+
Sbjct  620   DINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLL  679

Query  560   MNGAEIDDAVKLNLAPLDLTEVLQKRE-----------------------------LGHR  468
                A++D        P DL +     E                             LG  
Sbjct  680   DQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRF  739

Query  467   IAMP--NTILHEAASKWAKDDHQNSSSMPQQCSIRVSIY----RGHPATRRETQCPEPGR  306
              + P    I HE + +        + S  +  +   S++      H   +     P+  +
Sbjct  740   TSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTK  799

Query  305   LIKLPETIAELISIA----GEKLG-------------------FDATDSSLTDEEGAIID  195
             + K P   +  ++I     GE  G                   F  + + + ++ GA ++
Sbjct  800   VFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVE  859

Query  194   SIDVIRDNDKLFIVAD  147
              I+VIRD D L  V+D
Sbjct  860   DIEVIRDGDHLVFVSD  875



>emb|CAM88967.1| AKT2 inward rectifier channel [Physcomitrella patens]
Length=967

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/673 (47%), Positives = 431/673 (64%), Gaps = 12/673 (2%)
 Frame = -2

Query  2486  SKFILPPLGSSQPTHTSSQGL---VISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  2316
             S  ILP LGS     + +  L   VI P + RYR W  W++LLV YSAWV PFE  F+E 
Sbjct  35    SSGILPALGSRASISSRNIVLNKYVIHPHNHRYRLWCNWLILLVFYSAWVSPFEFGFIED  94

Query  2315  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL-STWFLMDVAS  2139
                  L+  D IV+ FFA+DI+LTFFVAY+D  T L++   +KIA RYL STWF +DVAS
Sbjct  95    PRGA-LFTADMIVNGFFAIDIILTFFVAYLDSETYLMVDSFRKIAKRYLTSTWFTLDVAS  153

Query  2138  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLF  1959
             T+PF  +A +FTGK+  G  YS++ MLR WRLRRVS  F R EKD+RFSYFW+RC +L  
Sbjct  154   TVPFGLLALVFTGKYGTGFTYSLINMLRLWRLRRVSAMFARFEKDVRFSYFWIRCIKLFL  213

Query  1958  VTLLLVHCAGCLYYFLADRYP--HQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTV  1791
             VT+ + HCA C YY LA R+P   + + WLG+   N  EESL  RY++++YWS+TT+TTV
Sbjct  214   VTVFVCHCAACFYYLLAARHPSHKEAETWLGATLPNFPEESLWTRYVTSIYWSITTLTTV  273

Query  1790  GYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVS  1611
             GYGDLH VN  EMI+ IF+ML NL LTAYIIGNMTNL+ + T RT  FR+S+QA ++F +
Sbjct  274   GYGDLHPVNQGEMIYDIFFMLMNLALTAYIIGNMTNLITQLTARTRAFRDSVQAVTDFAT  333

Query  1610  RNHLPARLKEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             RN LP +L EQ+LA+M L+FK +S  QQ  +  LPK I  SI  +LFL  VEKVYLF G 
Sbjct  334   RNQLPFKLHEQMLAHMQLKFKTDSFQQQGTMAVLPKAIRSSIAQYLFLETVEKVYLFHGT  393

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S   L  LV +MKAEY PPRE++I+ NE+P + YI+V+G V++I  +  +EQ+++T  +G
Sbjct  394   SYNFLTQLVTEMKAEYFPPREEIILFNEAPSEFYIVVNGSVDVITMKDASEQILFTAVTG  453

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--HHkk  1077
             D+ GE+G LC  PQ FT R++ LSQLL+L  +  +  +Q  +ED   ++ N LQ      
Sbjct  454   DVIGEIGVLCYMPQPFTVRSRKLSQLLRLDRSVFMNVVQSFQEDGQRIVDNLLQRLRESD  513

Query  1076  lkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
                 +     IE    DG   MSI+L +V A GN   + +LLK G DPN  D  G+TPL 
Sbjct  514   DPRFEELSSDIEALLADGG-EMSISLCSVAAGGNVVVMEQLLKGGADPNKADYSGRTPLL  572

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IA++KGH ECV +LL+H  + +  D++G   L +A+ A++ +   +L+   +  +    G
Sbjct  573   IASTKGHLECVKLLLEHKADANQADVDGKVPLVEALIARDPTTVKLLWEHGATLENADKG  632

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
              LL +A +  +  ++++ LK+G  +D  D  G TA+  A+   Q DM+K L+  GA+ + 
Sbjct  633   QLLGQAVQDCNVDLIEDYLKYGASIDEADDEGLTALHVAVLHGQLDMMKFLLSKGADPNK  692

Query  536   AVKLNLAPLDLTE  498
                   +PL L E
Sbjct  693   ESNGLPSPLQLAE  705



>ref|XP_007154951.1| hypothetical protein PHAVU_003G160800g [Phaseolus vulgaris]
 gb|ESW26945.1| hypothetical protein PHAVU_003G160800g [Phaseolus vulgaris]
Length=875

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/678 (47%), Positives = 432/678 (64%), Gaps = 11/678 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  13    RDGSHYSLSTGILPSLGAKSNRRIKLRRFILSPYDRRYRIWETFLVVLVVYTAWVSPFEF  72

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L + DNIV+ FF VDIVLTFFVAYID TT L +  RK IA +Y  TW   
Sbjct  73    GFLK-KPQAPLSISDNIVNGFFFVDIVLTFFVAYIDKTTYLFVDDRKDIAWKYARTWLAF  131

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV S IP E V  +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  132   DVISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  188

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +A RY    K W+G    N  E SL  RY++++YWS+TT+T
Sbjct  189   KLISVTLFAVHCAACFYYLIAARYHDPAKTWIGVAMGNFLEHSLWSRYVTSIYWSITTLT  248

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN+ EM F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF
Sbjct  249   TVGYGDLHPVNSREMTFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNF  308

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+ +  +E L QQ  ++ LPK I  SI HHLF  +++KVYL
Sbjct  309   AHRNQLPPRLQDQMLAHLCLKHRTDSEGLQQQETLDSLPKAIRSSISHHLFYSLIDKVYL  368

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQVV  
Sbjct  369   FHGVSDDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLVIFQNGVEQVVGE  428

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+FGE+G LC +PQ FT RTK LSQLL+L  T+ L  LQ    D   ++ N LQH 
Sbjct  429   AKTGDLFGEIGVLCYKPQLFTVRTKRLSQLLRLNRTTFLNILQANVGDGTIIMTNLLQHL  488

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K+L D  +  +  EI      G  ++ +++    A G+   L++LLK G+DPN  D+  +
Sbjct  489   KELNDPIMEGVLAEIETMLARGRMDLPVSVCFAAARGDDFLLHQLLKRGMDPNESDNNRR  548

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAAS G E CV++LL +G + ++KD++GN ALW+AI     S+  +L    +    
Sbjct  549   TALHIAASHGKENCVLLLLDYGADPNIKDLDGNVALWEAIVGGHESVSKVLEENGANLQC  608

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKD-RHGSTAIQAAMEENQADMIKLLVMNG  552
                G   C A + N   +++E+ ++G  +       G+TA+  A+ +   +++K L+ +G
Sbjct  609   GDVGQFACTAVEQNKLKLLKEIRRYGGDITLPSINGGTTALHVAVSDGNVEIVKYLLDHG  668

Query  551   AEIDDAVKLNLAPLDLTE  498
             A ID   K      DL +
Sbjct  669   ASIDKPDKHGWTATDLAD  686



>ref|XP_003526425.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=879

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/835 (41%), Positives = 488/835 (58%), Gaps = 74/835 (9%)
 Frame = -2

Query  2474  LPPLGSSQPTHTSSQGL---VISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             LP LG++    +    L   ++SP + RYR W T++VLLV Y+AWVCPFE  FL    D 
Sbjct  48    LPSLGATAAGRSQRYKLRSYIVSPYNPRYRLWNTFLVLLVFYTAWVCPFEFGFLNDPSD-  106

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              L + DN+V+ FFA+DIVLTFFVAY++ +T LL+   K IA+RYL TWF  DV +T+P E
Sbjct  107   PLSIADNVVNFFFAIDIVLTFFVAYLNKSTYLLVDEPKLIASRYLRTWFAFDVLATVPSE  166

Query  2123  FVAFLFTGKHHLGVCYSVLGM---LRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVT  1953
             F       +H L   +   GM   LR WRLRRVS  F RLEKD  ++YFWVRC++L+ VT
Sbjct  167   F------ARHVLPPPFKQYGMFNILRLWRLRRVSAMFARLEKDRNYNYFWVRCSKLICVT  220

Query  1952  LLLVHCAGCLYYFLA-DRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
             L  VH A C++YFLA DR P     WL  + +  + S+  RY+++MYWS+ T++TVGYGD
Sbjct  221   LFSVHFAACIFYFLALDRDP--SSTWLSLVSDDAQSSVWKRYVTSMYWSIVTLSTVGYGD  278

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH V+T EM+F +FYMLFNLGLTAY+IGNMTNLVV GT RT ++R+++Q A++F  RN L
Sbjct  279   LHPVSTKEMVFDVFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTVQGATSFARRNQL  338

Query  1598  PARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             P RL+EQ+LA++ ++++   E L QQ +IE LPK I  SI H+LF P+V+KVYLF GVS 
Sbjct  339   PIRLEEQMLAHLFMKYRTDLEGLQQQEIIETLPKAIRSSIAHYLFYPLVDKVYLFHGVSS  398

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV +M+AEY PP+EDVI+QNE+P D YI V+G  E+I      EQVV    SGD+
Sbjct  399   DLLFQLVTEMRAEYFPPKEDVILQNEAPTDFYIFVTGAAELIIRNNGMEQVVGEAGSGDI  458

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
              GE+G LC RPQ FT RTK LSQ+L+L  T+ +  +     D   ++ NFLQH ++ +  
Sbjct  459   VGEIGVLCYRPQMFTIRTKRLSQILRLNRTTFINLVHSNIGDGAIVMNNFLQHLQESRYP  518

Query  1064  klgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              +  +  E       G  +M I     V   +   L+ LLK G DPN  D  GKT LHIA
Sbjct  519   GMDVILAETEAMLARGKMDMPITTCFAVTRNDDLLLHRLLKRGSDPNELDRSGKTALHIA  578

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL  711
             ASKG+E CV +LL++G + + KDM+G+  LW+A+  +  S+  IL    +      AG L
Sbjct  579   ASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKILIDNGADISFADAGHL  638

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
              C A + N+  +++E+++ G+ V    ++G+TA+  A+ E   +MI  LV  GA+ID   
Sbjct  639   ACSAVEQNNMELLKEIIQCGMDVTQPKKNGATALHTAVVEGNTEMINFLVDQGADIDMQD  698

Query  530   KLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSS--------SMPQQCS  375
                  P  L E  +  E+ +                +K+D+++          ++PQ+ S
Sbjct  699   VNGWTPRVLAEQSESEEIKNIFHDIKDSRKPGVIPISKNDNRSGRFQIDPSMLTIPQE-S  757

Query  374   IRVSIYRGH------------------------------PATRRETQ--------CPE--  315
             + +  Y G                                +TRR           CPE  
Sbjct  758   MLLPPYDGRRRSSSSFDNSIFGMMSTANRAKRDLQASESSSTRRSVNGLARVTLSCPEKG  817

Query  314   --PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  156
                G+L+ LP+T+ EL+ I   K  FD + + +    GA ++ I+++RD D L I
Sbjct  818   EHAGKLVLLPKTLEELLDIGARK--FDISATKILTTNGAEVEDINLVRDGDHLII  870



>ref|XP_003569453.1| PREDICTED: potassium channel AKT1 isoform X1 [Brachypodium distachyon]
Length=898

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/854 (41%), Positives = 492/854 (58%), Gaps = 72/854 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  37    RDGSHYSLSSGILPSLGARSNRRVKLRRFIISPYDRRYRLWETFLIVLVVYSAWVSPFEF  96

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+       L   DN+V+ FFAVDI+LTFFVAY++  T LL    K+IA RY ++WF++
Sbjct  97    GFIRIPTG-GLAATDNVVNAFFAVDIILTFFVAYLNRLTYLLEDDPKRIAWRYTTSWFVL  155

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +   K      Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA
Sbjct  156   DVASTIPSEIARKMLPSKLR---TYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCA  212

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +ADRYPH    W+G+   +   + L IRY++++YWS+TT+T
Sbjct  213   KLICVTLFAVHCAACFYYLIADRYPHPRDTWIGNTMPDFHYQGLWIRYVTSIYWSITTLT  272

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGD HA N  EMIF IFYM FNLGLTAY+IGNMTNLVV GT RT ++R++IQAA++F
Sbjct  273   TVGYGDYHAENIREMIFNIFYMFFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTIQAATSF  332

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI  +LFL +V+KVYL
Sbjct  333   ALRNQLPTRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSIAQYLFLTLVQKVYL  392

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE ++ +   EQVV  
Sbjct  393   FDGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVEFVELQNGVEQVVGV  452

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ--  1089
               SGD+ GE+G LC RPQ FT RT++L QLL++  T+ L  +Q    D   ++ N +Q  
Sbjct  453   AKSGDVVGEIGVLCYRPQLFTVRTRSLCQLLRMNRTTFLSIVQSNVGDGTIIMNNLIQLL  512

Query  1088  -HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                K    +      IE     G  ++ I L   V  G+   L +LLK GLDPN  D+ G
Sbjct  513   KDQKDNSVMVGVLKEIENMLARGRLDLPITLCFAVTRGDDLLLQQLLKRGLDPNETDNDG  572

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +T LHIAASKG+E+C+ +LL +G + + +D EG   LW+A+ AK  ++  +L    +   
Sbjct  573   RTALHIAASKGNEQCIRLLLDYGADPNARDPEGKVPLWEAVYAKHDAVVQLLLEGGADLS  632

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + N++ +++E+L+H   V+   + G+T +  A+ +    M++LL+ +G
Sbjct  633   LGDTGLYACIAVEENNTELLEEILRHDGDVNRPAKDGNTPLHRAVCDGNVQMVELLLEHG  692

Query  551   AEIDDA----------------------VKLNLAPLDLT---------------------  501
             A+ID                         K   AP   T                     
Sbjct  693   ADIDKQDSNGWTPRALADQQGHEEIQLLFKQRKAPRKYTSNGRVTPMLIGRFSSDPSMPN  752

Query  500   ----------EVLQKRELGHRIAMPNTILHEAASKWA--KDDHQNSSSMPQQCSIRVSIY  357
                       +VL ++ L  +++  N++    +S       DH  S  +    S      
Sbjct  753   VIREDSELPRKVLTQKLLKRKVSFQNSLFGVISSTHPHRDTDHILSRGLAATGSPNYHQA  812

Query  356   RGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  189
             R +   R    CPE     G+L+ LP+++  L+ +  +K  FD T + +   EGA ID +
Sbjct  813   RQNSLIRVTISCPEKGNAAGKLVILPQSMKGLLELGAKK--FDFTPAKVLTTEGAEIDEV  870

Query  188   DVIRDNDKLFIVAD  147
             ++IRD D + + +D
Sbjct  871   ELIRDGDHIVLASD  884



>ref|XP_010533190.1| PREDICTED: potassium channel AKT1 [Tarenaya hassleriana]
Length=888

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/865 (40%), Positives = 496/865 (57%), Gaps = 86/865 (10%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  +ISP D RYR WE ++V+LV Y+AWV P
Sbjct  22    RESSHFSL---STGILPSLGARSNRRVKLKRFLISPYDRRYRIWEAFLVVLVIYTAWVSP  78

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  +    L ++DNIV+ FFA+DI+LTFFV+Y+D +T LL+  RKKIA +YL +W
Sbjct  79    FEFGFLR-RPRRPLSIMDNIVNGFFAIDIILTFFVSYLDKSTYLLVDERKKIAFKYLRSW  137

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F++D  STIP E +AF  + +      Y +  MLR WRLRRVS  F RLEKD  F+YFWV
Sbjct  138   FILDFISTIPSE-LAFKISSQF-----YGLFNMLRLWRLRRVSAMFARLEKDRNFNYFWV  191

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VT+  VHCA C YY +A R  +    W+GS N    EES+ +RY+++MYWS+T
Sbjct  192   RCAKLICVTVFAVHCAACFYYLIAARNHNPANTWIGSSNGNFLEESIWMRYVTSMYWSIT  251

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EM F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAA
Sbjct  252   TLTTVGYGDLHPVNTKEMTFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAA  311

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RN LP RL++Q++A++CL+F+  +E L QQ  ++ LPK I  S+ H LF  +V+K
Sbjct  312   SNFARRNRLPPRLQDQMVAHLCLKFRTDSEGLQQQETLDALPKAIRSSVSHFLFYSLVDK  371

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
              YLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V++I  +  +EQV
Sbjct  372   AYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLIVLKNGSEQV  431

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    +GD+ GE+G LC RPQ +T RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  432   VDEARAGDIIGEIGVLCYRPQLYTVRTKRLCQLLRMNRTNFLNIIQANVGDGTVIMNNLL  491

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             +  K++ D  + ++ +E       G  ++ +NL       +   L++LLK G DPN  D+
Sbjct  492   ERLKQMDDPMIKNVLVETEHMLARGKMDLPLNLCFAALREDDLLLHQLLKNGHDPNESDN  551

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL H  + + +D EGN  LW+A+      +   L    + 
Sbjct  552   NGRTPLHIAASKGSLNCVLLLLDHHADPNCRDNEGNVPLWEAMQGWHEKVAKALLENGAT  611

Query  737   SDPYVAGDLLCKAAKMNDSSVMQE---------------------------------LLK  657
              +    G   C AA+ N   +++E                                 LLK
Sbjct  612   IEAGDVGHFACTAAEQNKLDLLKEIVRYGGDVTRPRITGTSALHSAVCEENIEIVKFLLK  671

Query  656   HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA---PLDLTEVLQK  486
              G  V+ +D HG T    A ++   ++  L        ++   +  +   P+  + +   
Sbjct  672   QGADVNKQDMHGWTPKDLAEQQGHEEIKALFRARQEAEEEKTHIESSASVPIPKSSI---  728

Query  485   RELGHRIAMPNT---------ILHEAASKWAKDD----------HQNSS-----SMPQQC  378
             R LG   + PN           + E+  +   +           HQN       ++ +  
Sbjct  729   RFLGRFTSEPNIRPASRDVSFRIPESRPRRKTNTFHNSLFGILAHQNGQKNSLFTVDEAS  788

Query  377   SIRVSIYRGHPATRRET-QCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
             S  V    G   T R T  CPE     G+L+ LP ++ EL+ +   K G    ++ +T++
Sbjct  789   STNVKARGGDVGTARVTVSCPEKGDVSGKLVLLPGSLQELLELGSSKFGI--VNAKVTNK  846

Query  212   EGAIIDSIDVIRDNDKLFIVADWNS  138
             + A ID I+VIRD D L   + + S
Sbjct  847   DDAEIDDIEVIRDGDHLVFASRYES  871



>ref|XP_004287371.1| PREDICTED: potassium channel AKT1-like [Fragaria vesca subsp. 
vesca]
Length=893

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/664 (47%), Positives = 433/664 (65%), Gaps = 12/664 (2%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQG-LVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
             D S   LS  ILP LG+         G  ++SP D RYR WET++V+LV Y+AWV PFE 
Sbjct  19    DGSHYSLSTGILPSLGARSSNRRVKLGRFIVSPYDRRYRIWETFLVVLVIYTAWVSPFEF  78

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L ++DNIV+ FFA+DIVLTFFVAY+D  T LL+  +K+IA +Y STW + 
Sbjct  79    GFLK-KPQGPLAIIDNIVNGFFAIDIVLTFFVAYLDKATYLLVDDQKQIAWKYASTWLIF  137

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +          Y    MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  138   DVISTIPSELARKISPKPFR---SYGFFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  194

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VH AGC YY LA RY      W+G    +   +S+ IRY++++YWS+TT+T
Sbjct  195   KLICVTLFAVHSAGCFYYLLAARYRDPSNTWIGKSMEDFLHQSIWIRYVTSVYWSITTLT  254

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VNT EMIF IFYMLFNLGLT+Y+IGNMTNLVV GT RT +FR++IQAAS+F
Sbjct  255   TVGYGDLHPVNTREMIFDIFYMLFNLGLTSYLIGNMTNLVVHGTSRTRKFRDTIQAASSF  314

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+F+  AE L QQ  ++ LPK I  SI H+LF  +V+KVYL
Sbjct  315   AQRNQLPVRLQDQMLAHLCLKFRTDAEGLQQQETLDSLPKAIRSSISHYLFYSLVDKVYL  374

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++MKAEY PP+ED+I+QNE+P D YI+V+G  +++  +   EQV+  
Sbjct  375   FRGVSNDLLFQLVSEMKAEYFPPKEDIILQNEAPTDFYILVTGAADLVVLKNGAEQVIGE  434

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH-  1086
               +GD+ GE+G LC RPQ FT RTK LSQLL+L  T  L  +Q    D   ++ N L+  
Sbjct  435   AKTGDLIGEIGVLCYRPQLFTVRTKRLSQLLRLNRTKFLSIVQANVGDGTIIMNNLLERL  494

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              +  KD  +  + +E  +    G  ++ ++L      G+   L++LL+ GLDPN  D+ G
Sbjct  495   KETSKDPYMEGVLLETENMLARGRLDLPLSLCFAAMRGDDLLLHQLLRRGLDPNESDNNG  554

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +T LHIAAS+G E CV++LL +G   + +D EGN  LW+AI     +I  +L    +  +
Sbjct  555   RTALHIAASQGSENCVLLLLDYGALPNSRDSEGNVPLWEAIQKDHETIAKLLVDNGATLN  614

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + N   +++E+++HG  V +   +G+TA+  A+ E+  +++K LV  G
Sbjct  615   AGDVGHFACIATEENRLDLLKEIVRHGGDVTTPRGNGTTALHVAVSEDNIEIVKFLVEKG  674

Query  551   AEID  540
             A+ID
Sbjct  675   ADID  678



>ref|XP_010656397.1| PREDICTED: potassium channel AKT1-like isoform X2 [Vitis vinifera]
Length=853

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/666 (48%), Positives = 432/666 (65%), Gaps = 12/666 (2%)
 Frame = -2

Query  2471  PPLGSSQPTHTSSQGLVISPMDSRYRC--WETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             P + +   + TSS  L+I   D    C  WET++VLLV Y+AWV PFE  FL+ K +  L
Sbjct  17    PEVTAESSSGTSSYHLMIVVTDETDYCRTWETFLVLLVFYTAWVSPFEFGFLK-KPEAPL  75

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
              + DN+V+ FFAVDIVLTFFVAY+D TT LL+ + K+IA +Y STW   DV STIP E  
Sbjct  76    SITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIPSELA  135

Query  2117  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLVH  1938
               +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+L+ VT+  VH
Sbjct  136   RKITPSPFQ---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRCAKLICVTVFAVH  192

Query  1937  CAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAVN  1764
             CA C YY LA RY    K W+G+   N  E+SL IRY++A+YWS+TT+TTVGYGDLH  N
Sbjct  193   CAACFYYLLAARYHDPQKTWIGASMNNFLEQSLWIRYVTAIYWSITTLTTVGYGDLHPEN  252

Query  1763  TLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLK  1584
             T EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAAS+F  RN LP RL+
Sbjct  253   TREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRRFRDTIQAASSFAQRNQLPVRLQ  312

Query  1583  EQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLL  1410
             +Q+LA++CL+F+  +E L QQ  ++ LPK I  SI H LF  +++KVYLF+GVS ++L  
Sbjct  313   DQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLLDKVYLFRGVSNDLLFQ  372

Query  1409  LVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVG  1230
             LV++MKAEY PP+ED+I+QNE+P D YI+VSG ++++  +   EQVV    +GD+ GE+G
Sbjct  373   LVSEMKAEYFPPKEDLILQNEAPTDFYIVVSGALDLLVLKNGTEQVVGEAKTGDLCGEIG  432

Query  1229  ALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdL  1050
              LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ N LQH K LKD  +  +
Sbjct  433   VLCYRPQLFTVRTKRLCQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGV  492

Query  1049  FIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGH  876
              +E  +      M + L    AT  G+   L++LLK GLDPN  DS G+T LHIAASKG 
Sbjct  493   LVETENMLARGRMDLPLSLCFATLRGDDLLLHQLLKRGLDPNESDSNGRTALHIAASKGS  552

Query  875   EECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAA  696
             E CV++LL +G   + +D EG   LW+A+     S+  +L    +  +    G   C AA
Sbjct  553   ESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLLVDNGANINSGDVGHFACTAA  612

Query  695   KMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLA  516
             ++ + +++++++ +G  V   +  G+TA+ AA+ E   +M+K L+  GA+ID        
Sbjct  613   ELKNLNLLKQIVHYGGDVTQPNNTGNTALHAAVCEENIEMVKFLLDQGADIDRTNDHGWT  672

Query  515   PLDLTE  498
             P DL +
Sbjct  673   PRDLAD  678



>gb|KDP33617.1| hypothetical protein JCGZ_07188 [Jatropha curcas]
Length=889

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/674 (47%), Positives = 446/674 (66%), Gaps = 19/674 (3%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKF-----ILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVA  2361
             +E E FS    S F     ILP LG++  +      +  ++SP+DSRYR WET++V LV 
Sbjct  26    KEMEQFSRDDRSHFSLTGEILPSLGATARSGRRIILRRFIVSPLDSRYRTWETFLVFLVF  85

Query  2360  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  2181
             Y+AW  PFE  FLE    T +  +DN+V+ FFAVDIVLTFFVAY+D +T LL+  R KIA
Sbjct  86    YTAWASPFEFGFLEKPAGT-IAAIDNVVNAFFAVDIVLTFFVAYLDKSTYLLVDDRNKIA  144

Query  2180  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDI  2001
              RY  TW ++DV STIP E +  +   +      Y    MLR WRLRRVS FF+RLEKD 
Sbjct  145   LRYAKTWLILDVISTIPSELIRSMLPNRLQ---SYGYFSMLRLWRLRRVSKFFSRLEKDR  201

Query  2000  RFSYFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYIS  1827
              +SYFW+RC +L+ VT+ +++ AGC YY LA  Y  Q   W+GS+  +  +E L IRY++
Sbjct  202   NYSYFWIRCLKLICVTIFVINIAGCFYYRLATSYHDQSNTWIGSVWKDYHKERLGIRYVT  261

Query  1826  AMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEF  1647
             ++YWS+TT+TT GYGDLHAVN  EMIF++FYM+F+LGLTAY+IGNMTNLVV  T RT +F
Sbjct  262   SLYWSITTLTTTGYGDLHAVNEREMIFVMFYMMFDLGLTAYLIGNMTNLVVHATSRTRQF  321

Query  1646  RNSIQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHL  1473
             R++IQAAS+F  RNHLP RL+EQ+LA++ LR++  +E L+QQ  I+ LPK I  SI  +L
Sbjct  322   RDTIQAASSFAQRNHLPLRLQEQMLAHLSLRYRTDSEGLHQQETIDALPKAIRSSIASYL  381

Query  1472  FLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDN  1293
             F  +V+KVYLF+GVS ++L  LVA+MKAEY PP+EDVI+QNE+P D+YI+V+G VE+I  
Sbjct  382   FYSLVDKVYLFRGVSNDLLFQLVAEMKAEYFPPKEDVILQNEAPTDMYILVTGAVELIVQ  441

Query  1292  EMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNI  1113
                 EQVV    +GD+ GEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D  
Sbjct  442   RNGIEQVVGEAKTGDVVGEVGLLCYRPQMFTARTKRLSQLLRLNRTAFLNIVQANVGDGT  501

Query  1112  TMIKNFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGL  939
              ++ N LQ+ K+LKD  +  +  +       G  ++ ++L      G+   L++LLK GL
Sbjct  502   IIMNNLLQYLKELKDPMMEGVLTDTEHMLARGRMDLPLSLCFAAMRGDDLLLHQLLKRGL  561

Query  938   DPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSI  759
             DPN  D+ G+T LHIAAS G E CV++LL++G + + KD EGN  LW+A+     S+  +
Sbjct  562   DPNELDNNGRTALHIAASSGSEHCVVLLLEYGADPNKKDSEGNIPLWEALMGNHESVIKL  621

Query  758   LY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQA  582
             L  + A++S   V+   L  A + N+  +++E++ +G  V  +   G+TA+  A+     
Sbjct  622   LVDNGATLSCGDVSQYALA-ATEQNNLDLLKEIVNYGGDVTLRTSTGTTALHVAISGGNT  680

Query  581   DMIKLLVMNGAEID  540
             +++K L+  GA++D
Sbjct  681   EIVKFLLEQGADVD  694



>ref|XP_011085715.1| PREDICTED: potassium channel AKT1-like isoform X1 [Sesamum indicum]
Length=886

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/853 (41%), Positives = 487/853 (57%), Gaps = 78/853 (9%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             +S  ILP LG++       +  +ISP D RYR WET++++LV Y+AWV PFE  F   + 
Sbjct  39    VSSGILPALGANSSRRIKLRPSIISPRDPRYRAWETFLIVLVFYTAWVSPFEFGFNMGR-  97

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L ++DN+V+ FFA+DI+LTFFVAY+D  T LL+ + K IA RY  TW + DV STIP
Sbjct  98    NRILSILDNVVNGFFAIDIILTFFVAYLDKATYLLVDNPKLIAVRYARTWLIFDVISTIP  157

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y  L MLR WRLRRVS  F RLEKD  +SYF VR A++  V L
Sbjct  158   SELARKILPSNVE---SYGYLSMLRLWRLRRVSAMFQRLEKDKNYSYFMVRVAKVTCVVL  214

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               +HCAGCL+Y LADRYP     W+GS   N  + SL  RY+ ++YWS+ T TT GYGDL
Sbjct  215   FEIHCAGCLFYLLADRYPDPKNTWIGSSIENFHDLSLWDRYVISIYWSIVTATTTGYGDL  274

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H VNT EMIF IFYMLFNLGLT+YIIGNMTNL+V+ T +T +FR +I AAS+F  RN LP
Sbjct  275   HPVNTGEMIFDIFYMLFNLGLTSYIIGNMTNLIVQTTFKTRKFRETINAASSFAKRNQLP  334

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL+EQ+LA++ LR++  +E L QQ  ++ LPK I  SI H LF  +V+KVYLF+GVS +
Sbjct  335   PRLQEQMLAHLSLRYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLVDKVYLFQGVSND  394

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PPREDVI+QNE+P D YI+V+G VE+I       QVV    +GD+ 
Sbjct  395   LLFQLVSEMKAEYFPPREDVILQNEAPTDFYILVNGAVEIISYTNGTAQVVGDCKTGDVC  454

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK LSQLL+L  T+ L  LQ    D   ++ N LQH K   D  
Sbjct  455   GEIGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNILQTNVGDGAIIMNNLLQHLKAQNDPV  514

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             + ++  +       G  ++ ++L   V+  +   LN LL+ GL+PN  DS G++ LH+AA
Sbjct  515   MQEILTDTEHMLAHGRMDVPLSLCFAVSREDDLLLNHLLRRGLEPNELDSNGRSALHLAA  574

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             +KG+ ECV++LL +G + + +D EGN  LWDA+  K   +   L    +       G   
Sbjct  575   AKGNLECVLLLLDYGADPNRRDSEGNVPLWDALLGKHEPVIKALVDNGATLSSGDVGQFA  634

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C AA+ ND  +++++ K G  V   +  G+TA+  A+ E   ++IK L+  GA+ID    
Sbjct  635   CFAAEQNDLDLLKQITKFGGDVTLLNGLGTTALHTAISEENIEIIKFLIEQGADIDKPDV  694

Query  527   LNLAPLDLTE---------VLQKRELGH-----------------RIAMP---------N  453
                 P  L +         + Q ++  H                 + A+P          
Sbjct  695   HGWTPRALADYQGHEAINALFQTKQESHNSGKAHQRSTSISTSEVQAALPYYLKKYPSEP  754

Query  452   TILH----------------EAASKWAKDDHQNS-------SSMPQQCSIRVSIYRGHPA  342
             TI H                +  + WA  + QNS            Q     +  R  P 
Sbjct  755   TIPHFKPDDKTQNARDMGVPDHKTGWAASNSQNSLAAILTTGRKQNQGERMFASPRPDPC  814

Query  341   TRRETQ-----CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  189
              +R        C E     G L+ LPE++ EL+ +  +K GF AT   ++++ GA+I+ +
Sbjct  815   MQRAPARVFVCCAERADVEGFLVPLPESLQELLDLGDKKFGFHAT-KVVSEDGGALIEDL  873

Query  188   DVIRDNDKLFIVA  150
              +IRD D++F+ +
Sbjct  874   ALIRDGDRIFLAS  886



>gb|KHN27401.1| Potassium channel AKT1 [Glycine soja]
Length=882

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/678 (47%), Positives = 436/678 (64%), Gaps = 22/678 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D RYR WET++V+LV Y+AWV PFE 
Sbjct  17    RDGSHYSLSTGILPSLGAKSNRRLKLKPFIISPYDRRYRIWETFLVILVVYTAWVSPFEF  76

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL+ K    L + DNIV+ FF VDIVLTFFVAYID +T L++  RK+IA +Y  TW   
Sbjct  77    GFLK-KPQAPLSITDNIVNGFFFVDIVLTFFVAYIDKSTYLIVDDRKQIAWKYARTWLAF  135

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV S IP E V  +          Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  136   DVISIIPSELVQKISPSPLQ---SYGLFNMLRLWRLRRVSALFSRLEKDKNYNYFWVRCA  192

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +A RY    K W+G+   N  E SL  RY++++YWS+TT+T
Sbjct  193   KLIAVTLFAVHCAACFYYLIAARYHDPKKTWIGATMDNFLERSLWSRYVTSIYWSITTLT  252

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VN+ EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAASNF
Sbjct  253   TVGYGDLHPVNSREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASNF  312

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF  +++KVYL
Sbjct  313   AQRNQLPHRLQDQMLAHLCLKYRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLIDKVYL  372

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V           VV  
Sbjct  373   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAV-----------VVGE  421

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  422   AKTGDLCGEIGVLCYKPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  481

Query  1082  kklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGK  909
             K++ D  +  + ++I +    G  ++ +++    A G+   L++LLK G+DPN  D+  +
Sbjct  482   KEINDPIMEGVLVDIENMLARGRMDLPVSVCFAAARGDDLLLHQLLKRGMDPNESDNNRR  541

Query  908   TPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDP  729
             T LHIAAS+G E CV +LL +G + +++D+EGN  LW+AI     S+  +L    +    
Sbjct  542   TALHIAASQGKENCVSLLLDYGADPNIRDLEGNVPLWEAIVEGHESMSKLLSENGANLQC  601

Query  728   YVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRH-GSTAIQAAMEENQADMIKLLVMNG  552
                G   C A + N  ++++E++++G  +   + + G+TA+  A+ E   +++K L+ +G
Sbjct  602   GDVGQFACNAVEQNSLNLLKEIMRYGGDITLPNSNTGTTALHVAVSEGNVEIVKFLLDHG  661

Query  551   AEIDDAVKLNLAPLDLTE  498
             A ID   K    P DL +
Sbjct  662   ASIDKPDKHGWTPRDLAD  679



>gb|EYU28414.1| hypothetical protein MIMGU_mgv1a001164mg [Erythranthe guttata]
Length=874

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/837 (41%), Positives = 490/837 (59%), Gaps = 68/837 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  ++SP D RYR W+ ++V LV Y+AWV PFE  FL+ K 
Sbjct  42    LSTGILPSLGARSNRRVRLRSSIVSPYDRRYRGWQNFLVALVVYTAWVSPFEFGFLD-KP  100

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DN+V+ FFA+DI+LTFFVAY+D +T LL+   KKIA +Y ++W  +D+ STIP
Sbjct  101   TGPLSITDNVVNGFFAIDIILTFFVAYLDRSTYLLVDDPKKIARKYATSWLALDIISTIP  160

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y    MLR WRLRRV   F RLEKD  F+YFWVRCARL+ VTL
Sbjct  161   SELARKISPKPLR---TYGFFNMLRLWRLRRVGALFARLEKDRNFNYFWVRCARLVCVTL  217

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC YY LA  YP+  K W+G+   + RE+SL IRY++++YWS+TT+TTVGYGDL
Sbjct  218   FAVHCAGCFYYLLAAHYPNPAKTWIGAAMNDFREQSLWIRYVTSIYWSITTLTTVGYGDL  277

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA N  EMIF IFYMLFNLGLTAY+IGNMTNLVV GT +T +FR++IQAAS+F  RN LP
Sbjct  278   HAENMREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSKTRQFRDTIQAASSFAQRNQLP  337

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
              RL++Q+L+++CL+F+  +E L QQ  ++ LPK I  SI H LF  +V+KVYLF+GVS +
Sbjct  338   GRLQDQMLSHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLVDKVYLFRGVSND  397

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   E+ +    +G + 
Sbjct  398   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDILVQKNGVEEPMGEAKTGKIC  457

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK LSQLL+L  T+ +  ++    D   ++ N LQH K++ D  
Sbjct  458   GEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFMNIVKANVGDGTIIMNNLLQHLKEINDPI  517

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E  +    G  ++ + L      G+   L+ LLK GLD N  DS G+T LHIAA
Sbjct  518   MEGVLLETENMLARGRMDLPLTLCFAAHRGDDLLLHHLLKRGLDSNESDSNGRTALHIAA  577

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDL  711
             SKG E CV++LL    + + +D EG+  LW+A+  +   +  +L  + A +++  +A   
Sbjct  578   SKGSENCVLLLLDFDADANSRDSEGSVPLWEAMLGRHQPVIKLLSDNGAKLTNGDIA-LF  636

Query  710   LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAV  531
              C AA+ N+  +++E++ HG  V     +G T++  A+ E   +++K L+  GA ID   
Sbjct  637   SCIAAEQNNLELLKEIVSHGGDVTQPKSNGCTSLHMAVCEGNIEIVKFLLDQGANIDKGD  696

Query  530   KLNLAPLDLTEVL---QKRELGHRIAMPNTILHEAASKWAKDDH--------QNSSSMPQ  384
             +      DL E     + +EL      P   +  A +    ++         ++ ++M  
Sbjct  697   ENGWTATDLAEQQGHDEIKELFDSYKGPTKYIEPAPADAISEERGVRFFGRFKSETTMLP  756

Query  383   QCSIRVSIYR-------------------GHPAT--------------------RRETQC  321
               S   S +R                   G  A+                    R    C
Sbjct  757   AVSKESSFHRRRTNNFYNSLFGIMSAAQTGETASTETVENSTTTGATVSKAYGARVTVSC  816

Query  320   PE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  162
             P+     G+L+ LP++  EL+ I  +K GF    + +  + GA ID I+++RD D L
Sbjct  817   PDRGDFAGKLVLLPKSFKELLEIGAKKYGF--FPAKILIKNGASIDDIELVRDGDHL  871



>ref|XP_011019759.1| PREDICTED: potassium channel AKT1 isoform X2 [Populus euphratica]
Length=881

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/837 (41%), Positives = 489/837 (58%), Gaps = 58/837 (7%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             +D S   L+  ILP LG++  ++     +  ++SP D RYR W T++V LV Y+AWV PF
Sbjct  47    DDASRFSLTDEILPSLGATARSNRRVLLRRFIVSPFDHRYRFWVTFLVFLVFYTAWVSPF  106

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E  +L SK    L + DN+V+ FFA+DI+LTFFVAY+D  + LL+  RKKIA RY  TW 
Sbjct  107   EFGYL-SKPSGGLAIADNVVNGFFAIDIILTFFVAYLDKNSYLLVDDRKKIAWRYARTWL  165

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             ++DV STIP E V  +   K      Y    MLR WRLRRVS FF+RLEKD +++YF VR
Sbjct  166   VLDVISTIPSELVREILPHKFE---SYGYFSMLRLWRLRRVSLFFSRLEKDRKYNYFAVR  222

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
              ++L+ VTL +VH AGCL+Y +A  Y    K W+GS+  +   ESL +RY+ A+YWS+TT
Sbjct  223   FSKLICVTLFVVHMAGCLFYRIAAYYKDPSKTWIGSVWEDFHNESLWVRYVKALYWSITT  282

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             +TT GYGDLHAVN  EM+F++FYM+F+LGLT+Y+IGN+TNLVV  T RT +FR++IQA S
Sbjct  283   LTTTGYGDLHAVNHNEMVFVMFYMMFDLGLTSYLIGNITNLVVHATFRTRQFRDTIQAVS  342

Query  1622  NFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             +F  RNHLP RL+EQ+LA++ L+F+  +E L+QQ  IE LPK I  SI ++LF  +V++V
Sbjct  343   SFAQRNHLPVRLQEQMLAHLSLKFRTDSEGLHQQETIESLPKAIRSSISNYLFYSLVDRV  402

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLF+GVS ++L  LV +MKAEY PPREDVI+QNE+P D+YI+V+G VE+I      EQVV
Sbjct  403   YLFRGVSNDLLFQLVTEMKAEYFPPREDVILQNEAPTDLYILVTGAVELIMRRNGIEQVV  462

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
                 +GD+ G +G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQ
Sbjct  463   GEAVTGDVVGAIGLLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQSNVGDGTIIMNNLLQ  522

Query  1088  HHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             H K+    ++  +  +       G  ++ + L      G+   L +LLK G DPN  D  
Sbjct  523   HLKESNFPEMEGILTDTEHMLTQGRMDLPLTLCFAAMRGDDLLLRQLLKQGSDPNELDDN  582

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+T LHIAAS G+E CV++LL++G + ++KD EGN  +W+A+     ++  +L    +  
Sbjct  583   GRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLLSENGAAI  642

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                  G     A + N+  +++E+ ++G  V      G+TA+  A+     +M+K ++  
Sbjct  643   TSGDVGQFALTAVEQNNIDLLEEIARYGGDVTLPATCGTTALHTAISAGNTEMVKFILEQ  702

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELG---------HRIAMPNTILHEAASKWAK-----  417
             GA++D        P  L +   + E+          ++  +P T  H +     K     
Sbjct  703   GADVDKPDLHGWTPRALADHQGQEEIQCLFENWAAENKKTVPTTPKHLSVPYGGKSIAKY  762

Query  416   -------------------------DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEP  312
                                      D+ QNS       +        +PA R    CP+ 
Sbjct  763   NSEPTIAPFSPSLHHNVAPPRRRRADNFQNSLVGMMSVASTGFPSSNYPA-RVTLSCPDK  821

Query  311   ----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
                 G+L+ LP++  EL+ I   K G  AT   +   EGA I+ I+++RD D L +V
Sbjct  822   GEVGGKLVVLPKSFQELLDIGARKFGCIAT--KILTREGAEIEDIELVRDGDHLVLV  876



>ref|XP_010474523.1| PREDICTED: potassium channel AKT1-like [Camelina sativa]
Length=1253

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/724 (44%), Positives = 449/724 (62%), Gaps = 21/724 (3%)
 Frame = -2

Query  2519  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E   FSL   S  ILP LG+        +  V+SP D +YR WE ++V+LV Y++WV P
Sbjct  23    RESSHFSL---STGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVVLVVYTSWVSP  79

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL  K    L + DNIV+ FFA+DIV+TFFV Y+D +T L++  RK IA +YL +W
Sbjct  80    FEFGFLR-KPRPPLSITDNIVNAFFAMDIVMTFFVGYLDKSTYLIVDDRKLIAFKYLRSW  138

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             FL+D+ STIP E  A   + +      Y +  MLR WRLRRV   F RLEKD  F+YFWV
Sbjct  139   FLLDLVSTIPSE-AAMRISSQ-----SYGLFNMLRLWRLRRVGALFARLEKDRSFNYFWV  192

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNVR--EESLKIRYISAMYWSMT  1806
             RCA+L+ VTL  VHCA C YY +A R     K W+G+ N    EESL +RY+++MYWS+T
Sbjct  193   RCAKLVCVTLFAVHCAACFYYLIAARNHDPAKTWIGASNKNFLEESLWMRYVTSMYWSIT  252

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+TTVGYGDLH VNT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAA
Sbjct  253   TLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAA  312

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++K
Sbjct  313   SNFAHRNHLPVRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDK  372

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
              YLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  ++ID +   E +
Sbjct  373   AYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLIDVDSGTETI  432

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N L
Sbjct  433   VKEVKAGDIVGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLL  492

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             Q+ K + D  + ++ +E  +    G  ++ +NL       +   L++LLK GLDPN  D+
Sbjct  493   QYLKDMNDPVMTNVLLETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDN  552

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+TPLHIAASKG   CV++LL++  + + +D EG+  LW+A+      +  +L    S 
Sbjct  553   NGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVLLENGST  612

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
              D    G   C AA+  +  +++E++ HG  V      G++A+  A+ E   +M+K L+ 
Sbjct  613   IDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLD  672

Query  557   NGAEIDDAVKLNLAPLDLTE-----VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSS  393
              GA+++          DL E     +       HR  +P  +  +  +        +S  
Sbjct  673   QGADVNKQDMHGWTARDLAEQQGDTIQAASNFAHRNHLPVRLQDQMLAHLCLKYRTDSEG  732

Query  392   MPQQ  381
             + QQ
Sbjct  733   LQQQ  736


 Score =   290 bits (741),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 188/555 (34%), Positives = 292/555 (53%), Gaps = 57/555 (10%)
 Frame = -2

Query  1643  NSIQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLF  1470
             ++IQAASNF  RNHLP RL++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF
Sbjct  696   DTIQAASNFAHRNHLPVRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLF  755

Query  1469  LPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNE  1290
               +++K YLF+GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G  ++ID +
Sbjct  756   YSLMDKAYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLIDVD  815

Query  1289  MENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNIT  1110
                E +V  + +GD+ GE+G LC RPQ FT RTK L QLL++  T+ L  +Q    D   
Sbjct  816   SGTETIVKEVKAGDIVGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTI  875

Query  1109  MIKNFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLD  936
             ++ N LQ+ K + D  + ++ +E  +    G  ++ +NL       +   L++LLK GLD
Sbjct  876   IMNNLLQYLKDMNDPVMTNVLLETENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLD  935

Query  935   PNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSIL  756
             PN  D+ G+TPLHIAASKG   CV++LL++  + + +D EG+  LW+A+      +  +L
Sbjct  936   PNESDNNGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVL  995

Query  755   YHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADM  576
                 S  D    G   C AA+  +  +++E++ HG  V      G++A+  A+ E   +M
Sbjct  996   LENGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEM  1055

Query  575   IKLLVMNGAEIDDAVKLNLAPLDLTE-----------------------------VLQK-  486
             +K L+  GA+++          DL E                             +L+  
Sbjct  1056  VKYLLDQGADVNKQDMHGWTARDLAEQQGHEDIKALFREKLHQRRVYIETSSSVPILKSG  1115

Query  485   -RELGHRIAMPNT----------ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSI  360
              R LG   + PN            + E  ++   ++  NS        S+P+     V  
Sbjct  1116  IRFLGRFTSEPNIRPAASREVSFRIRETRARRKTNNFDNSLFGILANQSVPKNGLATVDE  1175

Query  359   YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
              R     R    C E     G+L+ LP +  EL+ +   K G  A    ++ +  A ID 
Sbjct  1176  GRTGNPVRVTISCTEKDDVAGKLVLLPGSFKELLELGSNKFGIVAA-KVISKDNNAEIDD  1234

Query  191   IDVIRDNDKLFIVAD  147
             +DVIRD D L   +D
Sbjct  1235  VDVIRDGDHLIFASD  1249



>ref|XP_011026492.1| PREDICTED: potassium channel AKT1-like [Populus euphratica]
Length=897

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/686 (46%), Positives = 438/686 (64%), Gaps = 12/686 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             +D S   L+  ILP LG++  ++     +  ++SP D RYR W+T++V LV Y+AWV PF
Sbjct  40    DDASHFSLTGEILPSLGATARSNRRVILRRYILSPFDPRYRLWDTFLVFLVFYTAWVSPF  99

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E  +L SK    L + DN+V+ FFA+DIVLTFFVAY+D ++ LL+ +RKKIA RY  +W 
Sbjct  100   EFGYL-SKPSGGLAIADNVVNGFFAIDIVLTFFVAYLDKSSYLLVDNRKKIAWRYTKSWL  158

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             ++DV STIP E +  +   K      Y    MLR WRLRRVS FF+RLEKD  ++YF VR
Sbjct  159   VLDVISTIPSELIREILPDKLQ---SYGYFSMLRLWRLRRVSKFFSRLEKDRNYNYFVVR  215

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
             C +L+ VTL +VH AGC YY +A  Y    K W+GS+  +   ESL IRY+ ++YWS TT
Sbjct  216   CVKLICVTLFVVHMAGCFYYRIAVNYKDPSKTWIGSVWEDFHGESLWIRYVKSLYWSTTT  275

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             ++T GYGDLHAVN  EMIF++FYM+FNLGLT+Y+IGNMTNLVV  T RT +FR++IQA S
Sbjct  276   LSTTGYGDLHAVNPQEMIFVMFYMMFNLGLTSYLIGNMTNLVVHATFRTRQFRDTIQAVS  335

Query  1622  NFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             +F  RN LP RL+EQ+LA++CL+++  +E L+QQ  I  LPK I  SI ++LF  +V+KV
Sbjct  336   SFAQRNRLPIRLQEQMLAHLCLKYRTDSEGLHQQETIGSLPKAIRSSISNYLFYSLVDKV  395

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLF+GVS ++L  LV +MKAEY PPREDVI+QNE+P D+YI+V+G VE+       EQVV
Sbjct  396   YLFRGVSNDLLFQLVTEMKAEYFPPREDVILQNEAPTDLYILVTGAVELSVRRNGIEQVV  455

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
                 +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQ
Sbjct  456   GEAATGDVIGEIGLLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQSNVGDGTVIMNNLLQ  515

Query  1088  H--HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             H       +++      E+       ++ + L      G+   L++LLK G DPN  D  
Sbjct  516   HLKELNDPEMEGILQHTELMLTQDRMDLPLTLCIAAMRGDDLLLHQLLKQGSDPNESDEN  575

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+T LHIAAS G+E CV++LL++G + ++KD EGN  LW+A+     S+F +L    +  
Sbjct  576   GRTALHIAASNGNEHCVVLLLEYGVDPNIKDSEGNVPLWEALQGNHKSVFKLLSDNGATI  635

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                  G     AA  N+  +++E++K+G  V    R G+TAI  A+ E   +M+  ++  
Sbjct  636   TSGDVGQFAYTAAGQNNVDLLKEIVKYGGDVTLPARCGTTAIHTAISEGNTEMVTFILDQ  695

Query  554   GAEIDDAVKLNLAPLDLTEVLQKREL  477
             GA++D        P DL +   + E+
Sbjct  696   GADVDKPDLHGWTPRDLADHQGQEEI  721



>ref|XP_008809499.1| PREDICTED: potassium channel AKT1-like isoform X2 [Phoenix dactylifera]
Length=896

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/682 (46%), Positives = 442/682 (65%), Gaps = 19/682 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP + RYR WET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSLSSGILPSLGAMSNRRVKLRRFIVSPYERRYRYWETFLIILVIYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL  K +  L ++DNIV+ FFA+DI+LTFFVA+ID  T LLI   K+IA +Y+++WF++
Sbjct  87    GFL-VKENGALAMIDNIVNGFFAIDIILTFFVAFIDRATYLLIDDPKQIAWKYMTSWFVL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +   K      Y    MLR WRLRRVS  F RLEKD  F+YFWVRC 
Sbjct  146   DVVSTIPTELARKILPPKVR---SYGFFNMLRLWRLRRVSALFARLEKDRNFNYFWVRCV  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY +  K W+G    +  E SL +RY+++MYWS+TT+T
Sbjct  203   KLICVTLFAVHCAGCFYYLLAARYHNPSKTWIGVYMPDFHERSLWVRYVTSMYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV  T RT ++R++IQAA+ F
Sbjct  263   TVGYGDLHAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHRTGRTRKYRDTIQAATGF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYL
Sbjct  323   AQRNQLPVRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYNLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS ++L  LV++M+AEY PPREDVI+QNE+P D Y++V+G  E+ID++   EQ++  
Sbjct  383   FRGVSNDLLFQLVSEMRAEYFPPREDVILQNEAPTDFYVLVTGTAELIDHKNGIEQILRV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH-  1086
               +GD+ GE+G LC RPQ FT RTK+L QLL+L  T+ L  +Q    D  T++ N LQ+ 
Sbjct  443   ARAGDLVGEIGVLCYRPQLFTVRTKSLCQLLRLNRTTFLSTVQSNVGDGTTIMNNLLQYL  502

Query  1085  --HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
                ++   ++     IE     G  ++ + L   V  G+   L++LL+ GLDPN  D+ G
Sbjct  503   KEQEEDPVMEGVLREIENMLTWGRLDLPLTLCFAVIRGDDLLLHQLLRRGLDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASIS  735
              T LHIAAS+G E C+ +LL +G N + +D EG+  LW+AI  K  +   +L  + A++S
Sbjct  563   HTALHIAASQGSEHCIRLLLDYGANPNCRDSEGSVPLWEAILGKHDAAAKLLRDNGANLS  622

Query  734   DPYVAGDL---LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLL  564
                 AGD+    C AA+ N   ++++++++G       + G+TA+  A+ E    +++ L
Sbjct  623   ----AGDMGLFACIAAEQNSLELLKDVIRYGGDATLPKKDGNTALHLAVCEGNHRIVEFL  678

Query  563   VMNGAEIDDAVKLNLAPLDLTE  498
             +  GA ID        P +L E
Sbjct  679   LKQGANIDKPNCHGWTPRNLAE  700



>ref|XP_011019758.1| PREDICTED: potassium channel AKT1 isoform X1 [Populus euphratica]
Length=894

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/849 (40%), Positives = 495/849 (58%), Gaps = 69/849 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  2337
             +D S   L+  ILP LG++  ++     +  ++SP D RYR W T++V LV Y+AWV PF
Sbjct  47    DDASRFSLTDEILPSLGATARSNRRVLLRRFIVSPFDHRYRFWVTFLVFLVFYTAWVSPF  106

Query  2336  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  2157
             E  +L SK    L + DN+V+ FFA+DI+LTFFVAY+D  + LL+  RKKIA RY  TW 
Sbjct  107   EFGYL-SKPSGGLAIADNVVNGFFAIDIILTFFVAYLDKNSYLLVDDRKKIAWRYARTWL  165

Query  2156  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVR  1977
             ++DV STIP E V  +   K      Y    MLR WRLRRVS FF+RLEKD +++YF VR
Sbjct  166   VLDVISTIPSELVREILPHKFE---SYGYFSMLRLWRLRRVSLFFSRLEKDRKYNYFAVR  222

Query  1976  CARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTT  1803
              ++L+ VTL +VH AGCL+Y +A  Y    K W+GS+  +   ESL +RY+ A+YWS+TT
Sbjct  223   FSKLICVTLFVVHMAGCLFYRIAAYYKDPSKTWIGSVWEDFHNESLWVRYVKALYWSITT  282

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             +TT GYGDLHAVN  EM+F++FYM+F+LGLT+Y+IGN+TNLVV  T RT +FR++IQA S
Sbjct  283   LTTTGYGDLHAVNHNEMVFVMFYMMFDLGLTSYLIGNITNLVVHATFRTRQFRDTIQAVS  342

Query  1622  NFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             +F  RNHLP RL+EQ+LA++ L+F+  +E L+QQ  IE LPK I  SI ++LF  +V++V
Sbjct  343   SFAQRNHLPVRLQEQMLAHLSLKFRTDSEGLHQQETIESLPKAIRSSISNYLFYSLVDRV  402

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLF+GVS ++L  LV +MKAEY PPREDVI+QNE+P D+YI+V+G VE+I      EQVV
Sbjct  403   YLFRGVSNDLLFQLVTEMKAEYFPPREDVILQNEAPTDLYILVTGAVELIMRRNGIEQVV  462

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
                 +GD+ G +G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQ
Sbjct  463   GEAVTGDVVGAIGLLCYRPQLFTVRTKRLSQLLRLNRTAFLNIVQSNVGDGTIIMNNLLQ  522

Query  1088  HHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             H K+    ++  +  +       G  ++ + L      G+   L +LLK G DPN  D  
Sbjct  523   HLKESNFPEMEGILTDTEHMLTQGRMDLPLTLCFAAMRGDDLLLRQLLKQGSDPNELDDN  582

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASIS  735
             G+T LHIAAS G+E CV++LL++G + ++KD EGN  +W+A+     ++  +L    +  
Sbjct  583   GRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLLSENGAAI  642

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                  G     A + N+  +++E+ ++G  V      G+TA+  A+     +M+K ++  
Sbjct  643   TSGDVGQFALTAVEQNNIDLLEEIARYGGDVTLPATCGTTALHTAISAGNTEMVKFILEQ  702

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELG---------HRIAMPNTILHEAASKWAK-----  417
             GA++D        P  L +   + E+          ++  +P T  H +     K     
Sbjct  703   GADVDKPDLHGWTPRALADHQGQEEIQCLFENWAAENKKTVPTTPKHLSVPYGGKSIAKY  762

Query  416   -------------------------DDHQNS-------SSMPQQCSIRV-SIYRGHPAT-  339
                                      D+ QNS       +S  +   I   + + G P++ 
Sbjct  763   NSEPTIAPFSPSLHHNVAPPRRRRADNFQNSLVGMMSVASTGENGMISSPARFTGFPSSN  822

Query  338   ---RRETQCPEP----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVI  180
                R    CP+     G+L+ LP++  EL+ I   K G  AT   +   EGA I+ I+++
Sbjct  823   YPARVTLSCPDKGEVGGKLVVLPKSFQELLDIGARKFGCIAT--KILTREGAEIEDIELV  880

Query  179   RDNDKLFIV  153
             RD D L +V
Sbjct  881   RDGDHLVLV  889



>ref|XP_011077973.1| PREDICTED: potassium channel AKT1-like [Sesamum indicum]
Length=886

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/670 (47%), Positives = 432/670 (64%), Gaps = 10/670 (1%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
              S  ILP LG+        +  ++SP D RYR W+ ++V+LV Y+AWV PFE  FL+ K 
Sbjct  39    FSTGILPSLGARSNRRVKLRSFIVSPYDRRYRVWQNYLVVLVIYTAWVSPFEFGFLD-KP  97

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L + DN+V+ FFA+DI+LTFFVAY+D TT LL+  RK+IA +Y S+W   DV STIP
Sbjct  98    ARPLAITDNVVNGFFAIDIILTFFVAYLDKTTYLLVDDRKQIAWKYASSWLAFDVISTIP  157

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRVS  F RLEKD  F+YFWVRC +L+ VTL
Sbjct  158   SELARKISPKPLQ---TYGLFNMLRLWRLRRVSALFARLEKDRHFNYFWVRCVKLICVTL  214

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC  Y LA  YP   K W+G+   N +E+SL IRY+++MYWS+TT+TTVGYGDL
Sbjct  215   FAVHCAGCFNYLLAAHYPDPDKTWIGAAITNFKEKSLWIRYVTSMYWSITTLTTVGYGDL  274

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT +T +FR++IQAAS+F  RN LP
Sbjct  275   HAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSKTRQFRDTIQAASSFAQRNQLP  334

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             ARL++Q+L+++CL+F+  +E L QQ  ++ LPK I  SI H LF  +V+KVYLF+GVS +
Sbjct  335   ARLQDQMLSHLCLKFRTNSEGLQQQETLDSLPKAIRSSISHFLFYSLVDKVYLFRGVSND  394

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+VSG V+++  +   EQVV    +G++ 
Sbjct  395   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVSGTVDLLVLKNGVEQVVGEAKTGELC  454

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK LSQLL+L  T+    +Q    D   ++ N LQH K+LKD  
Sbjct  455   GEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFFNIVQANVGDGTIIMNNLLQHLKELKDPI  514

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E  +    G  ++ ++L      G+   L+ LLK GLDPN  D+ G+T LHIAA
Sbjct  515   MEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHHLLKRGLDPNESDNNGRTALHIAA  574

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG   CV++LL  G + + +D EG+  LW+A+  +  ++  +L    +       G   
Sbjct  575   SKGSANCVLLLLDFGADANSRDSEGSVPLWEAMLGRHEAVVKLLSDNGAKLTTGDVGLFS  634

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C AA+ N+  +++E++  G  V     +  TA+  A+ E   +++K L+  GA I+   +
Sbjct  635   CTAAEQNNLELLKEIVSFGGDVTKPKNNCCTALHVAVCEGNIEIVKFLLDQGANIELGDE  694

Query  527   LNLAPLDLTE  498
                   DL E
Sbjct  695   NGWTARDLAE  704



>ref|XP_009386140.1| PREDICTED: potassium channel AKT1 [Musa acuminata subsp. malaccensis]
Length=891

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/682 (46%), Positives = 440/682 (65%), Gaps = 19/682 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D RYR WET++++LV YSAWV PFE 
Sbjct  28    RDGSHYSLSSGILPSLGARSNRRVKLRSFIVSPYDRRYRAWETFLIILVIYSAWVSPFEF  87

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FLE    + L +VDNIV+ FFA+DI+LTFFVAY+D  T LL+  RKKIA RYL +WF++
Sbjct  88    GFLEDSRGS-LALVDNIVNAFFAIDIMLTFFVAYLDKATYLLVDDRKKIAWRYLHSWFIL  146

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +   K      Y    MLR WRLRRVS  F RLEKD  F+YFWVRCA
Sbjct  147   DVASTIPSEIARKMLPPKIR---SYGFFNMLRLWRLRRVSALFARLEKDRNFNYFWVRCA  203

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VT+  +HCAGC Y+ LA ++    + W+G+   +  E+SL I+Y+++MYWS+TT+T
Sbjct  204   KLICVTVFAIHCAGCFYFLLAAKHHDPSQTWIGASMPDFHEQSLWIQYVTSMYWSITTLT  263

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA N  EMIF  FYMLFNLGLTAY+IGNMTNLVV GTRRT ++R++IQAA+ F
Sbjct  264   TVGYGDLHAENIGEMIFNTFYMLFNLGLTAYLIGNMTNLVVHGTRRTRKYRDTIQAATGF  323

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RNHLP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYL
Sbjct  324   AQRNHLPERLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYSLVQKVYL  383

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS+++L  LV++MK EY PP EDVI+QNE+P D YI+V+G +E+I+++ E E +V  
Sbjct  384   FQGVSQDLLFQLVSEMKGEYFPPGEDVILQNEAPTDFYILVTGTLEVINHKDEKE-IVQV  442

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
                GD+ GE+G LC RPQ FT RT++L QLL+L  T     +Q    D   +I NFLQH 
Sbjct  443   AKKGDVLGEIGVLCYRPQLFTVRTRSLCQLLRLNRTVFHSIIQSNIGDGTIIINNFLQHL  502

Query  1082  kklkdlklgdLFIEIGDE---DGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             K+  D  L +  +   +     G  ++ + L   V   +   L +LLK  LDPN  D+ G
Sbjct  503   KEQVDDPLMEGLLRETESMLTHGRLDLPLTLCFAVIREDDLLLRQLLKRELDPNESDNNG  562

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG+E CV +LL  G + + +D EG+  LW+AI  +   +  +L    +   
Sbjct  563   HTALHIAASKGNEHCVCLLLDKGADPNRRDSEGSVPLWEAILGRHEQVAKVLRENGA---  619

Query  731   PYVAGDL---LCKAAKMNDSSVMQELLKHGLHVD-SKDRHGSTAIQAAMEENQADMIKLL  564
               ++GD+    C AA+ N   ++++++++G  V  +  R G+TA+  A+ +    +++ L
Sbjct  620   QLLSGDMGLFACTAAEQNSLELLEDIIRYGGDVTAAAKRDGNTALHRAVCDGNLQLVEFL  679

Query  563   VMNGAEIDDAVKLNLAPLDLTE  498
             + + A++D        P  L +
Sbjct  680   LEHRADMDKPDHQGWTPRRLAD  701



>gb|KFK32558.1| hypothetical protein AALP_AA6G258700 [Arabis alpina]
Length=885

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/680 (46%), Positives = 432/680 (64%), Gaps = 12/680 (2%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTH--TSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             D   S   LSK +LP LG++  +    + +  +ISP D RYR WET++V LV Y+AW  P
Sbjct  35    DGTMSQYSLSKGLLPSLGATSRSSRDVNLRRFIISPFDPRYRAWETFLVFLVLYTAWASP  94

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K    L ++DNIV+ FFAVDI+LTFF+A++D  T LL+   K+IA RY+STW
Sbjct  95    FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFLAFLDKATYLLVDDHKRIAWRYVSTW  153

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
             F  DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFWV
Sbjct  154   FAFDVISTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  210

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMT  1806
             RC +LL VTL ++HC  C  Y +A  YP   K +  L   N ++  L ++Y +AMYWS+T
Sbjct  211   RCTKLLLVTLFVIHCGACFLYSIASHYPDPSKTFMALTDENWKQSPLAVQYNTAMYWSIT  270

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T +T GYGD+H VN+ EM FI+ YM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQAA
Sbjct  271   TFSTTGYGDIHGVNSKEMTFILCYMVFNLGLSAYIIGNMTNLVVHVTSRTRKFRDTIQAA  330

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S F  RN+LP RL++Q++A++CLR++  +E L QQ +IE LPK I  SI H+LF  VV+K
Sbjct  331   SGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIESLPKAIRSSISHYLFYEVVDK  390

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             +YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQV
Sbjct  391   IYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQV  450

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V     G++FGEVG LC RPQ FT RTK LSQLL+L  T+LL  +Q    D   ++ N L
Sbjct  451   VNEAQRGNVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTTLLNLVQANVGDGAIIMNNLL  510

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K+ +D  +  +  +       G  ++ ++L    A G+   L++LL+ G  PN  D 
Sbjct  511   QHLKESEDPVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNEMDK  570

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG   CV++LL+HG + ++KD EGN  LW+AI  +   I  +L    + 
Sbjct  571   DGRTALHIAASKGSHYCVVLLLEHGADPNIKDSEGNVPLWEAIIGRHGGIAKLLAENGAK  630

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                   G   C A + N    +++++K+G  +   D +G+TA+  A+ E   +M+K L+ 
Sbjct  631   MSSDTVGYFSCLAVEKNSLDALKDIIKYGGDITLPDGNGTTALHRAVSEGHLEMVKFLLD  690

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA++D        P  L E
Sbjct  691   RGADLDMPDSYGWTPRGLAE  710



>ref|NP_194976.1| putative potassium channel AKT5 [Arabidopsis thaliana]
 sp|Q9SCX5.2|AKT5_ARATH RecName: Full=Probable potassium channel AKT5 [Arabidopsis thaliana]
 emb|CAA22577.2| potassium channel-protein [Arabidopsis thaliana]
 emb|CAB79967.1| potassium channel-protein [Arabidopsis thaliana]
 gb|AEE86069.1| putative potassium channel AKT5 [Arabidopsis thaliana]
Length=880

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/842 (41%), Positives = 489/842 (58%), Gaps = 71/842 (8%)
 Frame = -2

Query  2489  LSKFILPPLG----SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL  2322
              SK +LPPLG    +    H   +  ++SP D RYR W+ ++V+LV Y+AW  PFE  FL
Sbjct  44    FSKGLLPPLGVGATARSSRHIKLRCFIVSPFDPRYRAWDWFLVILVLYTAWASPFEFGFL  103

Query  2321  ESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVA  2142
             ++     L ++DN+V+ FFAVDIVLTFFVA++D  T LL+   K+IA RY STW + DV 
Sbjct  104   QTP-RAPLSILDNVVNGFFAVDIVLTFFVAFLDKATYLLVDDPKRIAWRYTSTWLIFDVV  162

Query  2141  STIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLL  1962
             ST+P+E    L    H+    Y +  MLR WRL RVS  F RLEKD +++YFW+RC +LL
Sbjct  163   STVPYELFGSLL---HNTIQGYGIFSMLRLWRLHRVSKCFARLEKDRKYNYFWIRCTKLL  219

Query  1961  FVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVG  1788
              V+L +VHC  C  Y +A  YP     +  L   N +++SL IRY++AMYWS+TT +T G
Sbjct  220   LVSLFVVHCGACFCYSIAAHYPDPSMTFMALAEANWKQKSLLIRYVTAMYWSITTFSTTG  279

Query  1787  YGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSR  1608
             YGD+H  N  E  FI+FYM+FNLGL AYIIGNMTNLVV  T RT  FR++IQAAS F  R
Sbjct  280   YGDIHGNNAEERAFILFYMIFNLGLLAYIIGNMTNLVVHVTSRTRNFRDTIQAASAFAQR  339

Query  1607  NHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             N+LP  L+EQ++A++ LR++  +E L QQ +I+ LPK I  SI H+LF  VV+K YLF G
Sbjct  340   NNLPLGLQEQMVAHLSLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDKTYLFHG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +S ++L  LV++MKAEY PP+EDVI++NE+P D YI+V+G V++I      +QVV    +
Sbjct  400   ISNDLLFQLVSEMKAEYFPPKEDVILRNEAPSDFYIMVTGAVDIIARVNGVDQVVGEAQT  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             G +FGEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K  
Sbjct  460   GHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNLVQANVGDGAIIMNNLLQHLKDS  519

Query  1073  kdlklgdLF--IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
              D  +  +    E+    G  ++ ++L    A G+   L++LLK G +PN  D  G+T L
Sbjct  520   TDPVMKGILAETELMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDKNGRTAL  579

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG + CV++LL+HG + +++D EG+  LW+AI  +      +L    +       
Sbjct  580   HIAASKGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHEENAKLLSENGATLSFDTV  639

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             G   C A   N+ + +++++K+G  +   D +G+TA+  A+ E   ++++ L+  GA++D
Sbjct  640   GYFSCLAVGQNNLNALKDIVKYGGDISLSDVNGTTALHRAVSEGNLEIVQFLLEKGADMD  699

Query  539   ---------------------DAVKLNLAPLDLTEVLQ------KRELGH----------  471
                                   A+  N  P++   +L       K  + H          
Sbjct  700   KPDVYGWTARALAEHQGHEDIKALFYNQRPVERKTILVSGTPEIKPLMKHSSEPVMTHHH  759

Query  470   -RIAMPNTILHEAASKWAK-DDHQNS---------SSMPQQCSIRVSIYRG----HPA-T  339
              R AMP   L  A S+  K  + +NS         +      S R  I  G    +PA  
Sbjct  760   SREAMPP--LARAVSQRRKLSNFKNSLFGIMSAAKTGDEGGASTRTGISEGVGGVYPARV  817

Query  338   RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
                 +    G+++KLP+++ ELI I  +KLGF AT   +   EGA ID I +IRD D L 
Sbjct  818   TISGEASSSGKVVKLPDSLEELIEIGEKKLGFVAT--KILSREGAEIDDIRIIRDGDFLL  875

Query  158   IV  153
             ++
Sbjct  876   LL  877



>gb|AFW83426.1| hypothetical protein ZEAMMB73_660957 [Zea mays]
Length=913

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/891 (39%), Positives = 494/891 (55%), Gaps = 123/891 (14%)
 Frame = -2

Query  2507  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  2328
             D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE  
Sbjct  28    DGSHYSISSGILPSLGARSNRRVKLRPFIVSPYDRRYRCWETFLIILVVYSAWVSPFEFG  87

Query  2327  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  2148
             F++ K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++D
Sbjct  88    FIQ-KPTGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFVLD  146

Query  2147  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCAR  1968
             VASTIP EF   +          Y    MLR WRLRRVS+ F RLEKD  F+YFWVRCA+
Sbjct  147   VASTIPSEFARKILPPDLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRCAK  203

Query  1967  LLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTT  1794
             L+ VTL  VHC+ C YY LAD YP     W+G+   +  +  L IRY+ ++YWS+TT+TT
Sbjct  204   LICVTLFAVHCSACFYYLLADMYPTPTDTWIGNSMPDFHQRGLWIRYVVSVYWSITTLTT  263

Query  1793  VGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEF-----------  1647
             VGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT ++           
Sbjct  264   VGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYVSRFSPFCLVL  323

Query  1646  --------------------------RNSIQAASNFVSRNHLPARLKEQILAYMCLRFK-  1548
                                       R++IQAA++F  RN LP+RL++Q+++++CL+F+ 
Sbjct  324   ADTNLYKGHIEVAPNTLLFLLCFGRKRDTIQAATSFALRNQLPSRLQDQMISHLCLKFRT  383

Query  1547  -AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPR  1371
              +E L QQ  ++ LPK I  SI  +LF  +V+KVYLF+GVS +++  LV++MKAEY PPR
Sbjct  384   DSEGLQQQETLDVLPKAIRSSISQYLFFNLVQKVYLFEGVSNDLIFQLVSEMKAEYFPPR  443

Query  1370  EDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRt  1191
             EDVI+QNE+P D YI+V+G             +V    +GD+ GE+G LC RPQ FT RT
Sbjct  444   EDVILQNEAPTDFYILVTGSA-----------MVGVAKAGDVVGEIGVLCYRPQLFTVRT  492

Query  1190  ktlsqllklkttslLEALQMKREDNITMIKN---FLQHHkklkdlklgdLFIEIGDEDGD  1020
             K+L QLL++  T+ L  +Q    D   ++ N    L+       +      IE     G 
Sbjct  493   KSLCQLLRMNRTAFLSLVQSNVADGTIIMNNLIRLLKQQNDNSVMMGVLKEIENMLARGR  552

Query  1019  PNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGC  840
              ++ + L   V  G+   L++LLK GLDPN  D+ G T LHIAASKG E+CV +LL+HG 
Sbjct  553   LDLPVTLCFAVNKGDDFMLHQLLKRGLDPNESDNNGHTALHIAASKGDEQCVKLLLEHGA  612

Query  839   NIHLKDMEGNTALWDAIAAKEHSIFSILYH-WASISDPYVAGDLLCKAAKMNDSSVMQEL  663
             + + +D EG   LW+A+  K++ +  +L    A +S   VA    C A + ND  +++ +
Sbjct  613   DPNARDSEGKVPLWEALCEKQNPVVELLVQSGAGLSSGDVA-LYACVAVEENDPELLENI  671

Query  662   LKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD------------------  537
             +++G +V+S  + G+T +  A+ +    M++LL+ +GA+ID                   
Sbjct  672   IRYGGNVNSSMKDGTTPLHRAVCDGNVQMVELLLEHGADIDKQDNNGWSARALADQQGHD  731

Query  536   ----------------AVKLNLAPLDL---------------------TEVLQKRELGHR  468
                             A K  +AP+ +                      +V+ ++ L  R
Sbjct  732   DIQSLFRSRKAHRQQHASKGRVAPVPIWRFNSEPTMPKMKHEEDAELRGKVVPQKLLRKR  791

Query  467   IAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLI  300
             ++  N++    +S  A+ D     S     +       G    R    CPE     G+L+
Sbjct  792   VSFQNSLFGVISSSHARQDTGRLLSKGLAGTGSPGCSHGS-LVRVTIGCPEKGNAAGKLV  850

Query  299   KLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
              LP ++ EL+ +   K GF  T    T   GA ID +++IRD D + +V+D
Sbjct  851   LLPRSMTELLELGARKFGFKPTKVLTTG--GAEIDEVELIRDGDHVVLVSD  899



>ref|XP_006364280.1| PREDICTED: potassium channel AKT1-like [Solanum tuberosum]
Length=847

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/855 (40%), Positives = 482/855 (56%), Gaps = 73/855 (9%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             D+  S   ++  ILP LG+     T  +  +ISP + RYR W  ++VLLV Y+AW  PF+
Sbjct  2     DDKSSHYSITSAILPSLGAHTNCKTKLRRYIISPSNPRYRAWNAYLVLLVFYTAWASPFQ  61

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+      + ++DNI + FFA+DIVLTFFVAY+D +   +I   K+IA RY  + FL
Sbjct  62    FGFLDRPRGV-IPILDNIANSFFAIDIVLTFFVAYLDKSACSMIDDPKRIALRYTKSGFL  120

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV STIP E +        +    Y    +LR WRLRRVS  F RLEK+ + SYF VR 
Sbjct  121   FDVISTIPSELIR---KSTPYFLQSYEYFSILRLWRLRRVSAMFARLEKNRKISYFGVRV  177

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTM  1800
              +L+ VTL  VHCAGC YYFLA R     K WL     N  + S+   Y+  MYWS+TT+
Sbjct  178   LKLICVTLFAVHCAGCFYYFLAARKQDTSKTWLSLAIGNHHDRSIWDLYVMCMYWSITTL  237

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             TT GYGDLHAV T EMIF +FYMLF+LGLTAY+IGNMTNLVV GT +T +FR++IQAAS+
Sbjct  238   TTTGYGDLHAVATEEMIFTMFYMLFDLGLTAYLIGNMTNLVVHGTSKTRKFRDTIQAASS  297

Query  1619  FVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             F  RN LP RL+EQ++A++ LR +  +E L QQ  +E LPK I   I H+LF P+V+KVY
Sbjct  298   FAQRNKLPVRLEEQMIAHLRLRHRTDSEGLQQQETLETLPKAIRSGISHYLFYPLVDKVY  357

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LF GVS ++L  LV++MKAEY PP+EDVI+QNE+P D+YI+V+G V++I ++   +QV+ 
Sbjct  358   LFHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDLYILVTGAVDLISHKNGMDQVIG  417

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
              L  GD+ GEVG LCCRPQ F  RTK +SQLL+L  +S    ++    D   ++ N LQH
Sbjct  418   ELKMGDVCGEVGVLCCRPQLFNVRTKKVSQLLRLDRSSFFNIVKTNIGDGTIIMNNLLQH  477

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              K+ +D  +  +  +I      G  +M ++L      G+   L +LLK G+DPN  DS G
Sbjct  478   LKERRDPMMTAILADIEHMLTQGRMDMPLSLCFAANRGDDLLLRQLLKKGMDPNESDSNG  537

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASIS  735
             +T LHIAASKG  EC+++LL  G + + KD EGN  LWDAI  K  ++  +L  + A+IS
Sbjct  538   RTVLHIAASKGSVECILLLLDFGAHPNRKDSEGNVPLWDAIVGKHEAVVKLLVDNGATIS  597

Query  734   DPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMN  555
                V G   C A +     +++E++K+G  V   +  G+TAI  A+ E   +++K L+  
Sbjct  598   SGDV-GQFACFAVEQGSLDLLKEIIKYGGDVTLLNSLGTTAIHTAISEENVEIVKFLLEQ  656

Query  554   GAEIDDAVKLNLAPLDLTEVLQKRELGHRI------------------------------  465
             G +ID A      P  L E     E+                                  
Sbjct  657   GTDIDKADVHGWTPRALAEYQGHGEIKELFNLMQPTSKETNVCPPEAPFAPYLMKYQSDP  716

Query  464   AMPNTILHEAASKWAKDD-----------------------HQNSSSMPQQCSIRVSIYR  354
             A+P  I  E A +    +                       H      P+  S +++  R
Sbjct  717   AIPLFIHEETARETGSSNGRLRRRASFFQNSLIGFVAARQRHHEGGGGPEYSSTKIANSR  776

Query  353   GHPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  186
                 +R   +C E      R + LP++I EL+ I  EK G   + + +  E+GA+I+ I+
Sbjct  777   --IPSRITIRCLEKAHIGRRAVLLPDSINELLDIGAEKFG--VSLAKVLTEDGALIEDIE  832

Query  185   VIRDNDKLFIVADWN  141
             VIRD D L +    N
Sbjct  833   VIRDGDHLVLATSEN  847



>emb|CAB64728.1| putative potassium channel [Arabidopsis thaliana]
Length=880

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/842 (40%), Positives = 488/842 (58%), Gaps = 71/842 (8%)
 Frame = -2

Query  2489  LSKFILPPLG----SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL  2322
              SK +LPPLG    +    H   +  ++SP D RYR W+ ++V+LV Y+AW  PFE  FL
Sbjct  44    FSKGLLPPLGVGATARSSRHIKLRCFIVSPFDPRYRAWDWFLVILVLYTAWASPFEFGFL  103

Query  2321  ESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVA  2142
             ++     L ++DN+V+ FFAVDI LTFFVA++D  T LL+   K+IA RY STW + DV 
Sbjct  104   QTP-RAPLSILDNVVNGFFAVDIFLTFFVAFLDKATYLLVDDPKRIAWRYTSTWLIFDVV  162

Query  2141  STIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLL  1962
             ST+P+E    L    H+    Y +  MLR WRL RVS  F RLEKD +++YFW+RC +LL
Sbjct  163   STVPYELFGSLL---HNTIQGYGIFSMLRLWRLHRVSKCFARLEKDRKYNYFWIRCTKLL  219

Query  1961  FVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVG  1788
              V+L +VHC  C  Y +A  YP     +  L   N +++SL IRY++AMYWS+TT +T G
Sbjct  220   LVSLFVVHCGACFCYSIAAHYPDPSMTFMALAEANWKQKSLLIRYVTAMYWSITTFSTTG  279

Query  1787  YGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSR  1608
             YGD+H  N  E  FI+FYM+FNLGL AYIIGNMTNLVV  T RT  FR++IQAAS F  R
Sbjct  280   YGDIHGNNAEERAFILFYMIFNLGLLAYIIGNMTNLVVHVTSRTRNFRDTIQAASAFAQR  339

Query  1607  NHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             N+LP  L+EQ++A++ LR++  +E L QQ +I+ LPK I  SI H+LF  VV+K YLF G
Sbjct  340   NNLPLGLQEQMVAHLSLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDKTYLFHG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +S ++L  LV++MKAEY PP+EDVI++NE+P D YI+V+G V++I      +QVV    +
Sbjct  400   ISNDLLFQLVSEMKAEYFPPKEDVILRNEAPSDFYIMVTGAVDIIARVNGVDQVVGEAQT  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             G +FGEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K  
Sbjct  460   GHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNLVQANVGDGAIIMNNLLQHLKDS  519

Query  1073  kdlklgdLF--IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
              D  +  +    E+    G  ++ ++L    A G+   L++LLK G +PN  D  G+T L
Sbjct  520   TDPVMKGILAETELMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDKNGRTAL  579

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG + CV++LL+HG + +++D EG+  LW+AI  +      +L    +       
Sbjct  580   HIAASKGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHEENAKLLSENGATLSFDTV  639

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             G   C A   N+ + +++++K+G  +   D +G+TA+  A+ E   ++++ L+  GA++D
Sbjct  640   GYFSCLAVGQNNLNALKDIVKYGGDISLSDVNGTTALHRAVSEGNLEIVQFLLEKGADMD  699

Query  539   ---------------------DAVKLNLAPLDLTEVLQ------KRELGH----------  471
                                   A+  N  P++   +L       K  + H          
Sbjct  700   KPDVYGWTARALAEHQGHEDIKALFYNQRPVERKTILVSGTPEIKPLMKHSSEPVMTHHH  759

Query  470   -RIAMPNTILHEAASKWAK-DDHQNS---------SSMPQQCSIRVSIYRG----HPA-T  339
              R AMP   L  A S+  K  + +NS         +      S R  I  G    +PA  
Sbjct  760   SREAMPP--LARAVSQRRKLSNFKNSLFGIMSAAKTGDEGGASTRTGISEGVGGVYPARV  817

Query  338   RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  159
                 +    G+++KLP+++ ELI I  +KLGF AT   +   EGA ID I +IRD D L 
Sbjct  818   TISGEASSSGKVVKLPDSLEELIEIGEKKLGFVAT--KILSREGAEIDDIRIIRDGDFLL  875

Query  158   IV  153
             ++
Sbjct  876   LL  877



>ref|XP_011093723.1| PREDICTED: potassium channel AKT1-like [Sesamum indicum]
Length=887

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/670 (47%), Positives = 434/670 (65%), Gaps = 10/670 (1%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  ++SP D RYR WET++V+LV Y+AWV PFE+ FL+ K 
Sbjct  38    LSTGILPSLGARSNRRVKLRSFIVSPYDRRYRAWETFLVVLVIYTAWVSPFELGFLD-KP  96

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L + DN+V+ FFA+DIVLTFFVAY+D  T LL+ + K+IA +Y ++W   DV STIP
Sbjct  97    EGPLAITDNVVNGFFAIDIVLTFFVAYLDRNTYLLVDNPKQIAWKYATSWLAFDVISTIP  156

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRV   F RLEKD  F+YFWVRCA+L+ VTL
Sbjct  157   SELARKISPKPLR---TYGLFNMLRLWRLRRVGALFARLEKDRNFNYFWVRCAKLICVTL  213

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC YY LA  Y      W+G+   +  + SL  RY++++YWS+TT+TTVGYGDL
Sbjct  214   FAVHCAGCFYYLLAAHYREPENTWIGASMHDFLQRSLWARYVTSIYWSITTLTTVGYGDL  273

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT +T  FR++IQAAS+F  RN LP
Sbjct  274   HAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSKTRHFRDTIQAASSFAQRNQLP  333

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             ARL++Q+L+++CL+F+  +E L QQ  ++ LPK I  SI H LF  +V+KVYLF+GVS +
Sbjct  334   ARLQDQMLSHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLVDKVYLFRGVSND  393

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V++++ +   EQVV    +G++ 
Sbjct  394   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLELKNGVEQVVGEAKTGELC  453

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K+LKD  
Sbjct  454   GEIGVLCYRPQLFTARTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKELKDPI  513

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E  +    G  ++ + L      G+   L+ LLK GLDPN  D+ GKT LHIAA
Sbjct  514   MEGVLLETENMLARGRMDLPLTLCFAALRGDDLLLHHLLKRGLDPNESDNNGKTALHIAA  573

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG+E CV++LL  G + + +D EG+  LW+++     S+  +L    +       G   
Sbjct  574   SKGNENCVLLLLDFGADPNSRDSEGSVPLWESMLGGHKSVIKLLSDNGAKLTSGDIGLFS  633

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C A + N   +++E+++ G +V     +G TA+  A+ E   +++K L+  GA ID A +
Sbjct  634   CTATEQNSLDLLKEIVRRGGNVTQPKNNGCTALHIAVCEGNIEIVKFLLDQGANIDKADE  693

Query  527   LNLAPLDLTE  498
                   DL E
Sbjct  694   NGWTARDLAE  703



>ref|XP_010423759.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=887

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/680 (46%), Positives = 426/680 (63%), Gaps = 12/680 (2%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  P
Sbjct  36    DGTMSQYSLSKGLLPPLGASARSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWASP  95

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY STW
Sbjct  96    FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTSTW  154

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFWV
Sbjct  155   LAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  211

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMT  1806
             RC +LL VTL ++HC  C  Y +A  YP   K +  L   N ++  + +RY +AMYWS+T
Sbjct  212   RCTKLLLVTLFVIHCGACFLYSIASHYPDPSKTFIALTDENWKQSPIAVRYNTAMYWSIT  271

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T +T GYGD+H VN+ EM FII YM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQAA
Sbjct  272   TFSTTGYGDIHGVNSREMTFIICYMVFNLGLSAYIIGNMTNLVVHVTGRTRKFRDTIQAA  331

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S F  RN+LP RL++Q++A++CLR++  +E L QQ +IE LPK I  SI H+LF  VV+K
Sbjct  332   SGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIESLPKAIRSSISHYLFYEVVDK  391

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             +YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQV
Sbjct  392   IYLFHGISNDVLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQV  451

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V     G +FGEVG LC RPQ FT RTK LSQLL+L  T LL  +Q    D   ++ N L
Sbjct  452   VSEAQRGSVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNLL  511

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K  +D  +  +  +       G  ++ ++L    A G+   L++LL+ G  PN  D 
Sbjct  512   QHLKDSEDPVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNEMDK  571

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG   C ++LL++G + +++D EGN  LW+AI  +   I  +L    + 
Sbjct  572   DGRTALHIAASKGSHYCAVLLLENGADPNIRDSEGNVPLWEAIIGRHSGIAKLLAENGAK  631

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                       C A + N   ++++++K+G  V   D +G+TA+  A+ E   +++K L+ 
Sbjct  632   LSLDSVSYFACLAVERNSLDILKDIIKYGGDVTLPDGNGTTALHRAVSEEHLEIVKFLLD  691

Query  557   NGAEIDDAVKLNLAPLDLTE  498
              GA++D        P  L E
Sbjct  692   QGADLDRPDSYGWTPRGLAE  711



>ref|XP_008809491.1| PREDICTED: potassium channel AKT1-like isoform X1 [Phoenix dactylifera]
Length=897

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/684 (46%), Positives = 443/684 (65%), Gaps = 22/684 (3%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP + RYR WET++++LV YSAWV PFE 
Sbjct  27    RDGSHYSLSSGILPSLGAMSNRRVKLRRFIVSPYERRYRYWETFLIILVIYSAWVSPFEF  86

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL  K +  L ++DNIV+ FFA+DI+LTFFVA+ID  T LLI   K+IA +Y+++WF++
Sbjct  87    GFL-VKENGALAMIDNIVNGFFAIDIILTFFVAFIDRATYLLIDDPKQIAWKYMTSWFVL  145

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DV STIP E    +   K      Y    MLR WRLRRVS  F RLEKD  F+YFWVRC 
Sbjct  146   DVVSTIPTELARKILPPKVR---SYGFFNMLRLWRLRRVSALFARLEKDRNFNYFWVRCV  202

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY +  K W+G    +  E SL +RY+++MYWS+TT+T
Sbjct  203   KLICVTLFAVHCAGCFYYLLAARYHNPSKTWIGVYMPDFHERSLWVRYVTSMYWSITTLT  262

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV  T RT ++R++IQAA+ F
Sbjct  263   TVGYGDLHAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHRTGRTRKYRDTIQAATGF  322

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI H+LF  +V+KVYL
Sbjct  323   AQRNQLPVRLQDQMISHLSLKFRTDSEGLQQQETLDALPKAIRSSISHYLFYNLVQKVYL  382

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMID--NEMENEQVV  1269
             F+GVS ++L  LV++M+AEY PPREDVI+QNE+P D Y++V+G  E+ID  N +E +Q++
Sbjct  383   FRGVSNDLLFQLVSEMRAEYFPPREDVILQNEAPTDFYVLVTGTAELIDHKNGIE-QQIL  441

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
                 +GD+ GE+G LC RPQ FT RTK+L QLL+L  T+ L  +Q    D  T++ N LQ
Sbjct  442   RVARAGDLVGEIGVLCYRPQLFTVRTKSLCQLLRLNRTTFLSTVQSNVGDGTTIMNNLLQ  501

Query  1088  H---HkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             +    ++   ++     IE     G  ++ + L   V  G+   L++LL+ GLDPN  D+
Sbjct  502   YLKEQEEDPVMEGVLREIENMLTWGRLDLPLTLCFAVIRGDDLLLHQLLRRGLDPNESDN  561

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWAS  741
              G T LHIAAS+G E C+ +LL +G N + +D EG+  LW+AI  K  +   +L  + A+
Sbjct  562   NGHTALHIAASQGSEHCIRLLLDYGANPNCRDSEGSVPLWEAILGKHDAAAKLLRDNGAN  621

Query  740   ISDPYVAGDL---LCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIK  570
             +S    AGD+    C AA+ N   ++++++++G       + G+TA+  A+ E    +++
Sbjct  622   LS----AGDMGLFACIAAEQNSLELLKDVIRYGGDATLPKKDGNTALHLAVCEGNHRIVE  677

Query  569   LLVMNGAEIDDAVKLNLAPLDLTE  498
              L+  GA ID        P +L E
Sbjct  678   FLLKQGANIDKPNCHGWTPRNLAE  701



>gb|KCW82789.1| hypothetical protein EUGRSUZ_C04163 [Eucalyptus grandis]
Length=892

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/861 (40%), Positives = 484/861 (56%), Gaps = 99/861 (11%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             L+  ILP LG+        +  ++S +D RYR WE ++VLLV Y+AW  PFE  FL+ K 
Sbjct  34    LATGILPSLGARSNRAVQLRSFIVSSLDRRYRIWENFLVLLVVYTAWASPFEFGFLK-KP  92

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L ++DN+V+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY ++WF +DV STIP
Sbjct  93    KPPLSIIDNVVNGFFAIDIVLTFFVAYLDKATYLLVDDPKKIAWRYTTSWFALDVISTIP  152

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFV--  1956
              E    +    H     Y +  MLR WRLRRVS  F+RLEKD  ++YF +RCA+LL V  
Sbjct  153   SELAQKI---SHSPLGGYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFVLRCAKLLCVSI  209

Query  1955  --------------------------------TLLLVHCAGCLYYFLADRYPHQGKNWLG  1872
                                             T+  VHCAGC YY LA R     + W+G
Sbjct  210   ESVFGNTILIKKQWPSLRLLVSHENSHSFLQVTVFAVHCAGCFYYLLAARNHDPAETWMG  269

Query  1871  SLNVREESLKIRYISAMYWSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGN  1692
                + ++ L IRY++++YWS+TT+TTVGYGDLH VN  EM+F IF+MLFNLGLTAY+IGN
Sbjct  270   KA-ILQDGLGIRYVTSLYWSITTLTTVGYGDLHPVNVREMLFDIFFMLFNLGLTAYLIGN  328

Query  1691  MTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLI  1518
             MTNLVV GT RT +FR++IQAAS+F  RN LP RL++Q+LA++CL+++  +E L Q+  +
Sbjct  329   MTNLVVHGTSRTRKFRDTIQAASSFGQRNQLPPRLQDQMLAHLCLKYRTDSEGLRQKETL  388

Query  1517  EQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPD  1338
             + LPK I  SI H+LF  +V++VYLF+G+S ++L  LV++MK EY PP EDVI+QNE+P 
Sbjct  389   DSLPKAIRSSILHYLFYNIVDRVYLFRGISNDLLFQLVSEMKDEYFPPNEDVILQNEAPT  448

Query  1337  DVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkt  1158
             D YI+V+G V            V    SGD+ GE+G LC RPQ FT RTK LSQLL+L  
Sbjct  449   DFYILVTGAVP-----------VGEAKSGDICGEIGILCYRPQLFTVRTKRLSQLLRLNR  497

Query  1157  tslLEALQMKREDNITMIKNFLQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVA  984
             T+    +Q   ED   ++ N LQH K LKD  +  + I+  +    G  ++ ++L     
Sbjct  498   TTFFNIIQSNVEDGTIIMNNLLQHLKDLKDPTMESILIDAENMLAHGQLDLPLSLCFATL  557

Query  983   TGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTA  804
              G+   L++LL+ GLDPN  D+ G+TPLHIAASKG E C ++LL +G + + +D EGN  
Sbjct  558   RGDNLMLSQLLRRGLDPNESDNSGRTPLHIAASKGSENCALLLLDYGADPNSRDSEGNVP  617

Query  803   LWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRH  624
             LW+AI      +  +L    +       G   C AA+ N+  +++E+ ++G  V     +
Sbjct  618   LWEAIKGGSEPVVKLLAENGANLVSGDVGQFSCTAAEQNNLDLLKEISRYGGDVTLPKSN  677

Query  623   GSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELG------HRIA  462
             G+TA+  A+ E+  +++K L+  GA+I+        P DL +     E+G          
Sbjct  678   GTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTPRDLADQQGHEEIGILFQSIKETE  737

Query  461   MPNTILHE----AASKWAKDDHQNSSSMPQ--------------------QCSIRVSI--  360
             M   I  E     AS+    D     S P+                    +  + +SI  
Sbjct  738   MLPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFHNSLFGIMSAARDGEGDVLLSINH  797

Query  359   -------YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDE  213
                    +   PA R    CPE     G+L+ LPE   EL+ +A +K G   T   +  +
Sbjct  798   NKSANKSFVARPAIRVVVSCPEVGDVEGKLMLLPENFQELLEMARKKFGL--TLLKVLTK  855

Query  212   EGAIIDSIDVIRDNDKLFIVA  150
              GA ID + VIRD D L  ++
Sbjct  856   NGAEIDDVAVIRDGDHLVFLS  876



>dbj|BAE99592.1| K+ transporter [Arabidopsis thaliana]
Length=779

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/775 (42%), Positives = 457/775 (59%), Gaps = 64/775 (8%)
 Frame = -2

Query  2300  LYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEF  2121
             L + DNIV+ FFA+DI++TFFV Y+D +T L++  RK+IA +YL +WFL+D+ STIP E 
Sbjct  11    LSITDNIVNAFFAIDIIMTFFVGYLDKSTYLIVDDRKQIAFKYLRSWFLLDLVSTIPSE-  69

Query  2120  VAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLV  1941
              A   + +      Y +  MLR WRLRRV   F RLEKD  F+YFWVRCA+L+ VTL  V
Sbjct  70    AAMRISSQ-----SYGLFNMLRLWRLRRVGALFARLEKDRNFNYFWVRCAKLVCVTLFAV  124

Query  1940  HCAGCLYYFLADRYPHQGKNWLGS--LNVREESLKIRYISAMYWSMTTMTTVGYGDLHAV  1767
             HCA C YY +A R  +  K W+G+   N  EESL +RY+++MYWS+TT+TTVGYGDLH V
Sbjct  125   HCAACFYYLIAARNSNPAKTWIGANVANFLEESLWMRYVTSMYWSITTLTTVGYGDLHPV  184

Query  1766  NTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARL  1587
             NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  FR++IQAASNF  RNHLP RL
Sbjct  185   NTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNFRDTIQAASNFAHRNHLPPRL  244

Query  1586  KEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILL  1413
             ++Q+LA++CL+++  +E L QQ  ++ LPK I  SI H LF  +++KVYLF+GVS ++L 
Sbjct  245   QDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFLFYSLMDKVYLFRGVSNDLLF  304

Query  1412  LLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEV  1233
              LV++MKAEY PP+EDVI+QNE+P D YI+V+G  +++D +   E +V  + +GD+ GE+
Sbjct  305   QLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVDVDTGTESIVREVKAGDIIGEI  364

Query  1232  GALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgd  1053
             G LC RPQ FT RTK L QLL++  T+ L  +Q    D   ++ N LQH K++ D  + +
Sbjct  365   GVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGTIIMNNLLQHLKEMNDPVMTN  424

Query  1052  LFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASKG  879
             + +EI +    G  ++ +NL       +   L++LLK GLDPN  D+ G+TPLHIAASKG
Sbjct  425   VLLEIENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGLDPNESDNNGRTPLHIAASKG  484

Query  878   HEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKA  699
                CV++LL++  + + +D EG+  LW+A+      +  +L    S  D    G   C A
Sbjct  485   TLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTA  544

Query  698   AKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNL  519
             A+  +  +++E++ HG  V      G++A+  A+ E   +M+K L+  GA+++       
Sbjct  545   AEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGW  604

Query  518   APLDLTE-----------------------------VLQK--RELGHRIAMPNT------  450
              P DL E                             +L+   R LG   + PN       
Sbjct  605   TPRDLAEQQGHEDIKALFREKLHERRVHIETSSSVPILKTGIRFLGRFTSEPNIRPASRE  664

Query  449   ---ILHEAASKWAKDDHQNS-------SSMPQQCSIRVSIYRGHPATRRETQCPE----P  312
                 + E  ++   ++  NS        S+P+     V   R     R    C E     
Sbjct  665   VSFRIRETRARRKTNNFDNSLFGILANQSVPKNGLATVDEGRTGNPVRVTISCAEKDDIA  724

Query  311   GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  147
             G+L+ LP +  EL+ +   K G  AT   +  +  A ID +DVIRD D L    D
Sbjct  725   GKLVLLPGSFKELLELGSNKFGIVAT-KVMNKDNNAEIDDVDVIRDGDHLIFATD  778



>ref|XP_006450501.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
 gb|ESR63741.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
Length=887

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/856 (40%), Positives = 491/856 (57%), Gaps = 76/856 (9%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPT--HTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
              +E+ S   +S  ILP LG +  +    + +  +ISP + RYR WET++V LV Y+AW C
Sbjct  37    REEEGSQISISDGILPSLGVTARSCRRITLRRFIISPFEPRYRLWETFLVFLVFYTAWAC  96

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FL ++    L + DN+V+  FA+DI+LTFF+AY+D  T LL+   KKIA RY  T
Sbjct  97    PFEFGFL-NQPSRPLAITDNVVNAIFAIDIILTFFLAYLDKATHLLVDDPKKIAWRYAKT  155

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVC---YSVLGMLRFWRLRRVSNFFTRLEKDIRFS  1992
             W   DV STIP E       G+  L      Y    MLR WRLRRVS  F RLEKD  +S
Sbjct  156   WLTFDVISTIPSE------AGRKFLPSALQAYGYFNMLRLWRLRRVSRLFARLEKDRNYS  209

Query  1991  YFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMY  1818
             Y  VR ++L  VTL  VHCA C +Y LA+ Y      W+G    + +++SL +RY++++Y
Sbjct  210   YIRVRYSKLACVTLFAVHCAACTFYLLAEHYRDPKGTWIGQTLGDFKQQSLWVRYVTSIY  269

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+ T+TT GYGD+H VNT E IF IF+M FNLGLT+Y++GNM NLVV GT RT +FR++
Sbjct  270   WSIATLTTTGYGDIHPVNTRERIFDIFFMFFNLGLTSYLLGNMNNLVVHGTARTRKFRDT  329

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLP  1464
             IQAAS+F  RN LP RL++Q+LA++CLR +  +E L QQ +IE LPK I  SI H LF  
Sbjct  330   IQAASSFARRNQLPVRLQDQMLAHLCLRHRTDSEGLQQQEIIESLPKAIQSSISHFLFYS  389

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
             +V++VYLF+GVS ++L  LV +MKAEY PP+EDVI+QNE+P D+YI+V+G +E+I  +  
Sbjct  390   LVDQVYLFRGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDLYILVTGAMELITRKGG  449

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              EQVV     GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++
Sbjct  450   IEQVVGEAKPGDVVGELGLLCYKPQLFTVRTKRLSQLLRLNRTAFLSLVQANVGDGTIIM  509

Query  1103  KNFLQHHkklkdlklgdLFIEIGDE--DGDPNMSINLFTVVATGNATFLNELLKAGLDPN  930
              N LQH K L D  +  +  +   +   G  ++ ++L      G+   L++LL+ G DPN
Sbjct  510   NNLLQHLKDLGDPMMEGISTDTEQKLARGRMDLPLSLSFAAVRGDGLLLHQLLRRGSDPN  569

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D+ G+T LHIAAS+GHE CV++LL++G +++++D EG+  LW+A+  K   +  IL  
Sbjct  570   ELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRILAE  629

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHG-------------LHV-----------  642
               ++      G   C A + ND  ++++++ +G             LHV           
Sbjct  630   NGALISSSDVGHFACTAIEQNDLLLLEKIVHYGGDVTQLTSNGTTPLHVAISEGNIEIVK  689

Query  641   ---------DSKDRHGSTAIQAAMEENQADMIKLLVMN----GAEIDDAVKLNLAPLDLT  501
                      D  D HG T    A  + Q D+  LL M      A +    K   AP    
Sbjct  690   FLIDQGSDIDKPDIHGWTPRALADHQGQEDIQILLQMKPEPKKAPVLTVPKKQQAPNPRK  749

Query  500   EVLQKRELGHR--------IAMPNTILHEAASKWAKDDHQNS------SSMPQQCSIRVS  363
              +++      +         A+P   L    S+   +   NS      ++   + SI   
Sbjct  750   HLVKYSSEPSKPPYTPEVVSAVPEINLLNRHSRRRPNTFHNSLFGIVSAANTGEHSINFP  809

Query  362   IYRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIID  195
                 +P  R    CPE     G+L+ LP+++ EL+SIA  K GF  T S +  +EGA ID
Sbjct  810   TVSSYPP-RVTISCPEKGQVSGKLVLLPKSLQELLSIASTKFGF--TPSKILSKEGAEID  866

Query  194   SIDVIRDNDKLFIVAD  147
              + +IRD+D LFIV+D
Sbjct  867   DVGLIRDDDHLFIVSD  882



>ref|XP_010472568.1| PREDICTED: potassium channel AKT6-like [Camelina sativa]
Length=889

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/859 (40%), Positives = 479/859 (56%), Gaps = 76/859 (9%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  P
Sbjct  36    DGTMSQYSLSKGLLPPLGASALSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWASP  95

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY STW
Sbjct  96    FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTSTW  154

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
                DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFWV
Sbjct  155   LAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  211

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMT  1806
             RC +LL VTL ++HC  C  Y +A  YP   K +  L   N ++  + +RY +AMYWS+T
Sbjct  212   RCTKLLLVTLFVIHCGACFLYSIASHYPDPSKTFIALTDENWKQSPIAVRYNTAMYWSIT  271

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T +T GYGD+H VN+ EM FI+ YM+FNLGL AYIIGNMTNLVV  T RT +FR++IQAA
Sbjct  272   TFSTTGYGDIHGVNSREMTFILCYMVFNLGLLAYIIGNMTNLVVHVTGRTRKFRDTIQAA  331

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S F  RN+LP RL++Q++A++CLR++  +E L QQ +I+ LPK I  SI H+LF  VV+K
Sbjct  332   SGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDK  391

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             +YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQV
Sbjct  392   IYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQV  451

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V  +  G +FGEVG LC RPQ FT RTK LSQLL+L  T LL  +Q    D   ++ N L
Sbjct  452   VSEVQRGSVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNLL  511

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH    +D  +  +  +       G  ++ ++L      G+   L++LL+ G  PN  D 
Sbjct  512   QHLNDSEDPVMKGILADTEHMLAQGKMDLPLSLCFAADRGDDLLLHQLLRRGSSPNEIDK  571

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG   C ++LL++G + +++D EGN  LW+AI  +   I  +L    + 
Sbjct  572   DGRTALHIAASKGSHYCAVLLLENGADPNIRDSEGNVPLWEAIIGRHSGIAKLLAENGAK  631

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
                       C A + N   +++++LK+G  V   D +G+TA+  A+ E   +++K L+ 
Sbjct  632   LSLDSVSYFACLAVERNSLDILKDILKYGGDVTLPDGNGTTALHRAVSEEHLEIVKFLLD  691

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKREL-----GHR---------IAMPNT-ILHEAASKW  423
              GA++D        P  L E     ++      HR           +P   +  +   K+
Sbjct  692   QGADLDRPDSYGWTPRGLAEHQGHEDIKTLFHDHRPVEKKPKPVPGIPQVPVTGKPLMKY  751

Query  422   AKDDHQNSSSMP--------------QQCSIRVSIYRGHPATRRETQCPEPGRLIKLP--  291
             + +   +S  MP              +  + R S++    A        EP R   +P  
Sbjct  752   SSEPTMHSGEMPLVREGGQVVVSQRRKLNNFRNSLFGFISAANTADDGGEPSRSPAVPIG  811

Query  290   -------------------------------ETIAELISIAGEKLGFDATDSSLTDEEGA  204
                                             ++ EL+ I  +K+GF  T   +   EGA
Sbjct  812   GGGGGGGSMFYPARVTISSPENNGGKVILLPNSMEELLEIGEKKMGFVPT--KVLTREGA  869

Query  203   IIDSIDVIRDNDKLFIVAD  147
              ID I +IRD D L +  D
Sbjct  870   EIDDITLIRDGDFLILSRD  888



>ref|XP_010325113.1| PREDICTED: potassium channel AKT1-like [Solanum lycopersicum]
Length=862

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/856 (40%), Positives = 484/856 (57%), Gaps = 75/856 (9%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             D+  S   ++  ILP LG+     T  +  +ISP + RYR W  ++VLLV Y+AW  PF+
Sbjct  17    DDKSSHYSITSAILPSLGAHTNCKTKLRPYIISPSNPRYRAWNAYLVLLVFYTAWASPFQ  76

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+      + ++DNI + FFA+DIVLTFFVAY+D +   +I   K+IA RY  + FL
Sbjct  77    FGFLDRPRGI-IPILDNIANSFFAIDIVLTFFVAYLDKSACSMIDDPKRIALRYTKSGFL  135

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV STIP E +        +    Y    +LR WRLRRVS  F RLEK+ + SYF VR 
Sbjct  136   FDVISTIPSELMR---KSMPYFLQSYEYFSILRLWRLRRVSAMFARLEKNRKISYFGVRV  192

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSLNV---REESLKIRYISAMYWSMTT  1803
              +L+ VTL  VHCAGC YYFLA R   + K WL SL +    + S+   Y+  MYWS+TT
Sbjct  193   LKLICVTLFAVHCAGCFYYFLAARKQDRSKTWL-SLAIGDHHDRSISDLYVMCMYWSITT  251

Query  1802  MTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAAS  1623
             +TT GYGDLHAV T EMIF + YMLF+LGLTAY+IGNMTNLVV GT +T +FR++IQAAS
Sbjct  252   LTTTGYGDLHAVATEEMIFTMLYMLFDLGLTAYLIGNMTNLVVHGTSKTRKFRDTIQAAS  311

Query  1622  NFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKV  1449
             +F  RN LP RL+EQ++A++ LR +  +E L QQ  +E LPK I   I H+LF P+V+KV
Sbjct  312   SFAQRNKLPVRLEEQMIAHLRLRHRTDSEGLQQQETLETLPKAIRSGISHYLFYPLVDKV  371

Query  1448  YLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVV  1269
             YLF GVS ++L  LV++MKAEY PP+EDVI+QNE+P D+YI+V+G V+++ ++   +QVV
Sbjct  372   YLFHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDLYILVAGAVDLVSHKNGMDQVV  431

Query  1268  WTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQ  1089
               L  GD+ GEVG LCCRPQ F  RTK +SQLL+L  +S    ++    D   ++ N LQ
Sbjct  432   GELKMGDVCGEVGVLCCRPQLFNVRTKKVSQLLRLDRSSFFNIVKTNIGDGTIIMNNLLQ  491

Query  1088  HHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSK  915
             H K+ +D  +  +  +I      G  +M ++L      G+   L +LLK G+DPN  DS 
Sbjct  492   HLKERRDPMMTAILADIEHMLTQGRMDMPLSLCFAANRGDDLLLRQLLKKGMDPNESDSS  551

Query  914   GKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASI  738
             G+T LHIAASKG  EC+++LL  G + + KD EGN  LWDA+  K  ++  +L  + A I
Sbjct  552   GRTVLHIAASKGSVECILLLLDFGAHPNRKDSEGNVPLWDAMVGKHEAVIKLLVDNGAKI  611

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVM  558
             S   V G     A +     +++E++K+G  V   +  G+TA+  A+ E  A+++K L+ 
Sbjct  612   SSGDV-GQFASFAVEQGSLDLLKEIIKYGGDVTLLNSLGTTALHTAISEENAEIVKFLLE  670

Query  557   NGAEIDDAVKLNLAPLDLTEVLQKRELGHRI-----------------------------  465
              GA+ID A      P  L E    +E+                                 
Sbjct  671   QGADIDKADVHGWTPRALAEFQGHKEIKELFNLMQPASKETNVCPPEAPCAPYLMKYQSD  730

Query  464   -AMPNTILHEAASK-----------------------WAKDDHQNSSSMPQQCSIRVSIY  357
              A+P  I  E A +                        A+  H      P   S +++  
Sbjct  731   PAIPLFIPEETARETGSSNGRLRRRASFFQNSLIGFVAARQRHHEGGGGPDYSSTKIANS  790

Query  356   RGHPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  189
             R    +R   +C E      R + LP++I EL+ +  EK G     + +  E+GA+I+ I
Sbjct  791   R--IPSRITIRCLEKAHIGKRAVLLPDSIKELLDMGAEKFGISL--AKVLTEDGALIEDI  846

Query  188   DVIRDNDKLFIVADWN  141
             +VIRD D L +    N
Sbjct  847   EVIRDGDHLILATSEN  862



>gb|ADK93728.1| inward-rectifying potassium channel [Puccinellia tenuiflora]
Length=897

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/867 (40%), Positives = 489/867 (56%), Gaps = 89/867 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  +ISP D +YR WE ++++LV YSAWV PFE 
Sbjct  34    RDGSQYSLSSGILPSLGARSNRRAKLRRFIISPYDRKYRLWEIFLIVLVVYSAWVSPFEF  93

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+       L   DN V+  FAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++
Sbjct  94    GFIRIPTGA-LAATDNAVNAIFAVDIILTFFVAYLDRLTYLLEDDLKRIAWRYTTSWFIL  152

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP E    +   K      Y    MLR WRLRRVS+ F RLEKD  F+YFWVR A
Sbjct  153   DVASTIPSEIARRMLPSKLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRYA  209

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY +ADRYP+  + W+GS   +  ++ L +RY++++YWS+TT+T
Sbjct  210   KLICVTLFAVHCAACFYYLIADRYPNPKETWIGSTMEDFHQQGLWVRYVTSVYWSITTLT  269

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGD HA N  EMIF +FYM FNLGL AY+IGNMTNLVV GT RT  +R++IQAAS+F
Sbjct  270   TVGYGDYHAENIREMIFNVFYMFFNLGLIAYLIGNMTNLVVHGTNRTRTYRDTIQAASSF  329

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+F+  +E L QQ  ++ LPK I  SI H+LFL +V+ +YL
Sbjct  330   AIRNQLPHRLQDQMISHLSLKFRTDSEGLQQQETLDVLPKAIRSSISHYLFLHLVQNIYL  389

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMEN------  1281
             FKGVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG VE++  E++N      
Sbjct  390   FKGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSVELL--ELQNGAEHGA  447

Query  1280  EQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
             EQVV    SGD+ GE+G LC RPQ FT RTK+L QLL++  T+ L  +Q    D   ++ 
Sbjct  448   EQVVGVAKSGDVVGEIGVLCYRPQLFTVRTKSLCQLLRMNRTAFLSIVQSNVGDGTIIMN  507

Query  1100  NFLQ---HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPN  930
             N +Q     K    +      IE     G  ++ I L   V  G+   +++LLK  LDPN
Sbjct  508   NLIQLLKDQKDNGVMVSVLKEIENMLARGRLDLPITLSFAVTRGDDHLVHQLLKRNLDPN  567

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D  G+T LHIAAS G+E+CV +LL +G + + +D EG   LW+A+ AK  ++  +L  
Sbjct  568   ESDQDGRTALHIAASTGNEQCVKLLLDYGADPNARDSEGKVPLWEAMYAKHDTVVQLLVK  627

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLK--HGLHVDSKDRHGSTAIQAAMEENQADM  576
               +       G   C A + N+  +++E+L   H  ++ SKD  G+  +  A+ +   +M
Sbjct  628   GGADLSLGDTGLYCCLAIEQNNIELLEEILNRIHDANMPSKD--GNIPLHRAVCDGNVEM  685

Query  575   IKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL----------------GHRIAM-----  459
             + LL+ + A+ID        P  L E     E+                G    M     
Sbjct  686   VALLLKHRADIDKMDSNGWTPRALAEQQGHEEIQALFKPLTPPIKYISNGRATPMLLGRF  745

Query  458   ----------------PNTILHEAASKWAKDDHQN------SSSMPQ------QCSIRVS  363
                             P+ +L +   +  K   QN      SSS P       Q   R  
Sbjct  746   SSDPSMRNVIREDTELPSKVLPQKLGR-RKVSFQNSLFGVISSSHPHPHRDTDQLLSRGL  804

Query  362   IYRGHPATRRE---------TQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSL  222
                G P+ R++           CPE     G+L  LP ++ EL+ +  +K  FD   + +
Sbjct  805   AATGAPSYRQDHHKPLVRVIISCPEKGNTAGKLAVLPRSMQELLQLGAKK--FDMMPTKV  862

Query  221   TDEEGAIIDSIDVIRDNDKLFIVA-DW  144
                EGA +D +++IRD D L + + DW
Sbjct  863   LTIEGAEVDEVELIRDGDHLVLASNDW  889



>ref|XP_008394035.1| PREDICTED: potassium channel AKT1-like isoform X1 [Malus domestica]
Length=891

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/855 (39%), Positives = 496/855 (58%), Gaps = 82/855 (10%)
 Frame = -2

Query  2489  LSKFILPPLGSS---QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLE  2319
             LS  ILP LG++   +P H   +  +ISP +  Y+ W+++++LLV Y+AWVCPFE  FL+
Sbjct  42    LSNGILPSLGATARNRPKHKLHR-FIISPFNYYYKLWQSFLILLVFYTAWVCPFEFGFLD  100

Query  2318  SKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAS  2139
              +    L + DN+V+  FA+DIVLTFF+AY+D TT LLI + K IA RY  TW   D+ S
Sbjct  101   -RAKGPLAIADNVVNALFAIDIVLTFFIAYLDKTTYLLIDNHKIIALRYAKTWLAFDIIS  159

Query  2138  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLF  1959
             TIP+E    +          Y    +LRFWRLRR S   +RLEKD  +SYFWVR  +L+F
Sbjct  160   TIPWELAQRVLPPPLE---TYGYFNILRFWRLRRFSAMISRLEKDRNYSYFWVRYCKLIF  216

Query  1958  VTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGY  1785
             VTLL VHCAGC +YFLA  YP+  + W G +  N ++ SL  RY+++MYWS+ T+TT GY
Sbjct  217   VTLLTVHCAGCFFYFLAVHYPNPRRTWFGLIVENFQQLSLWDRYVTSMYWSIITLTTTGY  276

Query  1784  GDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRN  1605
             GD H VN+ EM F IFYMLFN+GL AY+IGNMTNL+V GT RT +FR+SIQAA++F  RN
Sbjct  277   GDFHPVNSQEMTFNIFYMLFNVGLQAYLIGNMTNLIVHGTARTRQFRDSIQAATSFAHRN  336

Query  1604  HLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
              +P  L EQ+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF P+V+ VYLF+GV
Sbjct  337   QIPDHLHEQMLAHLCLKYRTNSEGLQQQEALDALPKAIRCSISHYLFYPLVDSVYLFQGV  396

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             SR++L  LV++MKAEY PP+EDVI+QNE+P D+YI+ +G VE+I +      VV    +G
Sbjct  397   SRDLLFQLVSEMKAEYFPPKEDVILQNEAPTDMYIVATGSVELIMHRNGATPVVHEAKTG  456

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             D+ GE+G LC RPQ  T RTK LSQLL+L  T+ L  +Q    D   ++ NFL+H K++K
Sbjct  457   DVVGEIGVLCYRPQMVTVRTKGLSQLLRLNRTAFLNLVQANVGDGTIIMNNFLKHLKEMK  516

Query  1070  dlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             +     +  +I      G  ++ ++L      G+   L+ LL+ G DPN  D+ G+T +H
Sbjct  517   NPLAEGILRDIEHVLASGKMDLPLSLCFAAQRGDDLLLHRLLRRGSDPNEMDNNGRTAMH  576

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAAS G+E C ++LL++  + +++D EGN  +W+AI+ K  S+  +L    +  +    G
Sbjct  577   IAASNGNEHCALLLLEYEADPNIQDSEGNVPIWEAISGKHESLIKLLLDNGAKINSGNVG  636

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
             +  C A + N+  ++++++ +   V     +G+ A+  A+ E   +M+K L+  GAE D 
Sbjct  637   NFACAAVEQNNLELLKDIVTYNGDVTLPKSNGTAALHTAVCEGNVEMVKFLLEQGAEADK  696

Query  536   AVKLNLAPLDLTEVLQKREL----GHR------------IAMPNTILHEAASK-------  426
                    P  L E     E+     H+            + MP  ++     K       
Sbjct  697   PDGYGWTPRALAEHQGHEEIMELFQHKWESNKPTKKPTVVPMPKDLIPSRPGKFRSEPTL  756

Query  425   --WAKDDHQNSSSMPQQCSIRV-SIYR---------------------------------  354
               +A+D   + S M  + + R+  I+R                                 
Sbjct  757   PPYARDGRPSYSDMTSENTRRMDKIFRNSLFGFMSAANTNTGEKDRDIVASTGSLARSTS  816

Query  353   --GHPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                +PA R    CP+ G    +L+ LP+++ +L+ +  +K  F AT   +  E+GA ++ 
Sbjct  817   RNSYPA-RVTLSCPKKGQTAAKLVLLPDSLQQLLDLGAKKFQFTAT--KVLTEDGAEVED  873

Query  191   IDVIRDNDKLFIVAD  147
             ++++RD D L +  D
Sbjct  874   VELVRDGDHLVLAGD  888



>gb|EYU27297.1| hypothetical protein MIMGU_mgv1a022010mg [Erythranthe guttata]
Length=900

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/671 (47%), Positives = 436/671 (65%), Gaps = 11/671 (2%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             LS  ILP LG+        +  +ISP D RYR WE ++V+LV Y+AW  PFE  FL+ K 
Sbjct  40    LSTGILPSLGARSNRRIKLRSFIISPYDRRYRAWEAFLVILVIYTAWASPFEFGFLD-KP  98

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
                L ++DNIV+ FFAVDI+LTFFVA++D +T LL+ + KKIA +Y ++W   DV STIP
Sbjct  99    RGPLSIMDNIVNGFFAVDIILTFFVAFLDRSTYLLVDNPKKIAWKYTTSWLAFDVISTIP  158

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRV   F RLEKD  F+YFWVRCA+L+ VTL
Sbjct  159   SELAQKISPKPLR---TYGLFNMLRLWRLRRVGALFARLEKDRNFNYFWVRCAKLICVTL  215

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
               VHCAGC YY LA  Y +    W+G+   +  ++SL +RY++++YWS+TT+TTVGYGDL
Sbjct  216   FAVHCAGCFYYLLAAHYRNPQNTWIGASMHDFLQQSLWVRYVTSIYWSITTLTTVGYGDL  275

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             HA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT +T +FR++IQAAS+F  RN LP
Sbjct  276   HAENTREMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSKTRQFRDTIQAASSFAQRNQLP  335

Query  1595  ARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
             ARL++Q+L+++CL+F+  +E L QQ  ++ LPK I  SI H LF  +V+KVYLF+GVS +
Sbjct  336   ARLQDQMLSHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHFLFYSLVDKVYLFRGVSND  395

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++M+AEY PP+EDVI+QNE+P D YI+ +G VE++  +   EQVV    +GD+ 
Sbjct  396   LLFQLVSEMRAEYFPPKEDVILQNEAPTDFYILATGAVELLVMKNGVEQVVGEAKTGDLC  455

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH K+ KD  
Sbjct  456   GEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKETKDPI  515

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             +  + +E       G  ++ + L      G+   L+ LLK GLD N  D+ GKT LHIAA
Sbjct  516   MEGVLMETETMLARGRMDLPLTLCFAALRGDDLLLHHLLKRGLDANESDNIGKTALHIAA  575

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             S+G+E CV++LL  G + + +D EG+  LW+A+     S+  +L    +       G   
Sbjct  576   SQGNENCVLLLLDAGADPNSRDSEGSVPLWEAMLGGHKSVIKLLSDNGAKITGGDVGLFS  635

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGST-AIQAAMEENQADMIKLLVMNGAEIDDAV  531
             C AA+ N+  +++E+++HG +V     +GST A+  A+ E   +++K L+  GA+I+   
Sbjct  636   CTAAEQNNLDLLKEIVRHGGNVGQPKNNGSTSALHIAVSEGNFEVVKYLLDQGADIEAPD  695

Query  530   KLNLAPLDLTE  498
                 AP +L E
Sbjct  696   DNGWAPRELAE  706



>ref|XP_010429557.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=888

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/681 (46%), Positives = 424/681 (62%), Gaps = 12/681 (2%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
              D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  
Sbjct  35    RDGTMSQYSLSKGLLPPLGASARSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWAS  94

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY ST
Sbjct  95    PFEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTST  153

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             W   DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFW
Sbjct  154   WLAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFW  210

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSM  1809
             VRC +LL VTL ++HC  C  Y +A  YP   K +  L   N ++  + IRY +AMYWS+
Sbjct  211   VRCTKLLLVTLFVIHCGACFLYSIASHYPDPSKTFIALTDENWKQSPIAIRYNTAMYWSI  270

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT +T GYGD+H VN+ EM FI+ YM+FNLGL AYIIGNMTNLVV  T RT +FR++IQA
Sbjct  271   TTFSTTGYGDIHGVNSREMTFILCYMVFNLGLLAYIIGNMTNLVVHVTGRTRKFRDTIQA  330

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS F  RN+LP RL++Q++A++CLR++  +E L QQ +IE LPK I  SI H+LF  VV+
Sbjct  331   ASGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIESLPKAIRSSISHYLFYEVVD  390

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             K+YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQ
Sbjct  391   KIYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQ  450

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV     G +FGEVG LC RPQ FT RTK LSQLL+L  T LL  +Q    D   ++ N 
Sbjct  451   VVCEARRGSVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNL  510

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             LQ  K  +D  +  +  +       G  ++ ++L    A G+   LN+LL+ G  PN  D
Sbjct  511   LQRLKDSEDPVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLNQLLRRGSSPNEMD  570

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
               G+T LHIAASKG   CV++LL++G + +++D EGN  LW+AI      I  +L    +
Sbjct  571   KDGRTALHIAASKGSHYCVVLLLENGADPNIRDSEGNVPLWEAIIGGHSGIAKLLAENGA  630

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
                        C A + N   ++++++K+G  V   D +G+TA+  A+ E   +++K L+
Sbjct  631   KLSLDSVSYFACLAVERNSLDILKDIIKYGGDVTLPDGNGTTALHRAVSEEHLEIVKFLL  690

Query  560   MNGAEIDDAVKLNLAPLDLTE  498
               GA++D        P  L E
Sbjct  691   DQGADLDRPDSYGWTPRGLAE  711



>ref|XP_006483310.1| PREDICTED: potassium channel AKT6-like [Citrus sinensis]
 gb|KDO61656.1| hypothetical protein CISIN_1g002728mg [Citrus sinensis]
Length=887

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/857 (41%), Positives = 492/857 (57%), Gaps = 78/857 (9%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPT--HTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
              +E+ S   +S  ILP LG +  +    + +  +ISP + RYR WET++V LV Y+AW C
Sbjct  37    REEEGSQISISDGILPSLGVTARSCRRITLRRFIISPFEPRYRLWETFLVFLVFYTAWAC  96

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FL ++    L + DN+V+  FA+DI+LTFF+AY+D  T LL+   KKIA RY  T
Sbjct  97    PFEFGFL-NQPSRPLAITDNVVNAIFAIDIILTFFLAYLDKATHLLVDDPKKIAWRYAKT  155

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVC---YSVLGMLRFWRLRRVSNFFTRLEKDIRFS  1992
             W   DV STIP E       G+  L      Y    MLR WRLRRVS  F RLEKD  +S
Sbjct  156   WLTFDVISTIPSE------AGRKFLPSALQAYGYFNMLRLWRLRRVSRLFARLEKDRNYS  209

Query  1991  YFWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMY  1818
             Y  VR ++L  VTL  VHCA C +Y LA+ Y      W+G    + +++SL +RY++++Y
Sbjct  210   YIRVRYSKLACVTLFAVHCAACTFYLLAEHYRDPKGTWIGQTLGDFKQQSLWVRYVTSIY  269

Query  1817  WSMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNS  1638
             WS+ T+TT GYGD+H VNT E IF IF+M FNLGLT+Y++GNM NLVV GT RT +FR++
Sbjct  270   WSIATLTTTGYGDIHPVNTRERIFDIFFMFFNLGLTSYLLGNMNNLVVHGTARTRKFRDT  329

Query  1637  IQAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLP  1464
             IQAAS+F  RN LP RL++Q+LA++CLR +  +E L QQ +IE LPK I  SI H LF  
Sbjct  330   IQAASSFARRNQLPVRLQDQMLAHLCLRHRTDSEGLQQQEIIESLPKAIQSSISHFLFYS  389

Query  1463  VVEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEME  1284
             +V++VYLF+GVS ++L  LV +MKAEY PP+EDVI+QNE+P D+YI+V+G +E+I  +  
Sbjct  390   LVDQVYLFRGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDLYILVTGAMELITRKGG  449

Query  1283  NEQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMI  1104
              EQVV     GD+ GE+G LC +PQ FT RTK LSQLL+L  T+ L  +Q    D   ++
Sbjct  450   IEQVVGEAKPGDVVGELGLLCYKPQLFTVRTKRLSQLLRLNRTAFLSLVQANVGDGTIIM  509

Query  1103  KNFLQHHkklkdlklgdLFIEIGDE--DGDPNMSINLFTVVATGNATFLNELLKAGLDPN  930
              N LQH K L D  +  +  +   +   G  ++ ++L      G+   L++LL+ G DPN
Sbjct  510   NNLLQHLKDLGDPMMEGISTDTEQKLARGRMDLPLSLSFAAVRGDGLLLHQLLRRGSDPN  569

Query  929   IGDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYH  750
               D+ G+T LHIAAS+GHE CV++LL++G +++++D EG+  LW+A+  K   +  IL  
Sbjct  570   ELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRILAE  629

Query  749   WASISDPYVAGDLLCKAAKMNDSSVMQELLKHG-------------LHV-----------  642
               ++      G   C A + ND  ++++++ +G             LHV           
Sbjct  630   NGALISSSDVGHFACTAIEQNDLLLLEKIVHYGGDVTQLTSNGTTPLHVAISEGNIEIVK  689

Query  641   ---------DSKDRHGSTAIQAAMEENQADMIKLLVMN----GAEIDDAVKLNLAPLDLT  501
                      D  D HG T    A  + Q D+  LL M      A +    K   AP +  
Sbjct  690   FLIDQGSDIDKPDIHGWTPRALADHQGQEDIQILLQMKPEPKKAPVLTVPKKQQAP-NPR  748

Query  500   EVLQKRELGHRI---------AMPNTILHEAASKWAKDDHQNS------SSMPQQCSIRV  366
             + L K      I         A+P   L    S+   +   NS      ++   + SI  
Sbjct  749   KHLVKYSSEPSIPPYTPEVVSAVPEINLLNRHSRRRPNTFHNSLFGIVSAANTGEHSINF  808

Query  365   SIYRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAII  198
                  +P  R    CPE     G+L+ LP+++ EL+SIA  K GF  T S +  +EGA I
Sbjct  809   PTVSSYPP-RVTISCPEKGQVSGKLVLLPKSLQELLSIASTKFGF--TPSKILSKEGAEI  865

Query  197   DSIDVIRDNDKLFIVAD  147
             D + +IRD+D LFIV+D
Sbjct  866   DDVGLIRDDDHLFIVSD  882



>gb|KHN07100.1| Potassium channel AKT1 [Glycine soja]
Length=880

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/836 (41%), Positives = 486/836 (58%), Gaps = 75/836 (9%)
 Frame = -2

Query  2474  LPPLGSSQPTHTSSQGL---VISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             LP LG++    +    L   ++SP + RYR W T++VLLV Y+AWVCPFE  FL    D 
Sbjct  48    LPSLGATAAGRSQRYKLRSYIVSPYNPRYRLWNTFLVLLVFYTAWVCPFEFGFLNDPSD-  106

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              L + DN+V+ FFA+DIVLTFFVAY++ +T LL+   K IA+RYL TWF  DV +T+P E
Sbjct  107   PLSIADNVVNFFFAIDIVLTFFVAYLNKSTYLLVDEPKLIASRYLRTWFAFDVLATVPSE  166

Query  2123  FVAFLFTGKHHLGVCYSVLGM---LRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVT  1953
             F       +H L   +   GM   LR WRLRRVS  F RLEKD  ++YFWVRC++L+ VT
Sbjct  167   F------ARHVLPPPFKQYGMFNILRLWRLRRVSAMFARLEKDRNYNYFWVRCSKLICVT  220

Query  1952  LLLVHCAGCLYYFLA-DRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
             L  VH A C++YFLA DR P     WL  + +  + S+  RY+++MYWS+ T++TVGYGD
Sbjct  221   LFSVHFAACIFYFLALDRDP--SSTWLSLVSDDAQSSVWKRYVTSMYWSIVTLSTVGYGD  278

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH V+T EM+F +FYMLFNLGLTAY+IGNMTNLVV GT RT ++R+++Q A++F  RN L
Sbjct  279   LHPVSTKEMVFDVFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKYRDTVQGATSFARRNQL  338

Query  1598  PARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             P RL+EQ+LA++ ++++   E L QQ +IE LPK I  SI H+LF P+V+KVYLF GVS 
Sbjct  339   PIRLEEQMLAHLFMKYRTDLEGLQQQEIIETLPKAIRSSIAHYLFYPLVDKVYLFHGVSS  398

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLN-SGD  1248
             ++L  LV +M+AEY PP+EDVI+QNE+P D YI V+G          +   ++ L+ SGD
Sbjct  399   DLLFQLVTEMRAEYFPPKEDVILQNEAPTDFYIFVTGAAVRNYPLFISIHFIYALSGSGD  458

Query  1247  MFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkd  1068
             + GE+G LC RPQ FT RTK LSQ+L+L  T+ +  +     D   ++ NFLQH ++ + 
Sbjct  459   IVGEIGVLCYRPQMFTIRTKRLSQILRLNRTTFINLVHSNIGDGAIVMNNFLQHLQESRY  518

Query  1067  lklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
               +  +  E       G  +M I     V   +   L+ LLK G DPN  D  GKT LHI
Sbjct  519   PGMDVILAETEAMLARGKMDMPITTCFAVTRNDDLLLHRLLKRGSDPNELDRSGKTALHI  578

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AASKG+E CV +LL++G + + KDM+G+  LW+A+  +  S+  IL    +      AG 
Sbjct  579   AASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKILIDNGADISFADAGH  638

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
             L C A + N+  +++E+++ G+ V    ++G+TA+  A+ E   +MI  LV  GA+ID  
Sbjct  639   LACSAVEQNNMELLKEIIQCGMDVTQPKKNGATALHTAVVEGNTEMINFLVDQGADIDMQ  698

Query  533   VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSS--------SMPQQC  378
                   P  L E  +  E+ +                +K+D+++          ++PQ+ 
Sbjct  699   DVNGWTPRVLAEQSESEEIKNIFHDIKDSRKPGVIPISKNDNRSGRFQIDPSMLTIPQE-  757

Query  377   SIRVSIYRGH------------------------------PATRRETQ--------CPE-  315
             S+ +  Y G                                +TRR           CPE 
Sbjct  758   SMLLPPYDGRRRSSSSFDNSIFGMMSTANRAKRDLQASESSSTRRSVNGLARVTLSCPEK  817

Query  314   ---PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  156
                 G+L+ LP+T+ EL+ I   K  FD + + +    GA ++ I+++RD D L I
Sbjct  818   GEHAGKLVLLPKTLEELLDIGARK--FDISATKILTTNGAEVEDINLVRDGDHLII  871



>ref|XP_003545498.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/847 (40%), Positives = 490/847 (58%), Gaps = 71/847 (8%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVC  2343
             ED S   L+  +LP LG++   + S +      ++SP + RY+ W  ++++LV Y+AW+C
Sbjct  37    EDGSQYSLTGILLPSLGATAVRNDSGRPKLRRYIVSPYNRRYKLWNKFLLILVFYTAWMC  96

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FLE  +   + + DN+V+ FFA+DIVLTFFVAY+D +T LL+   K IA RY  +
Sbjct  97    PFEFGFLEKSMGA-VAITDNVVNGFFAIDIVLTFFVAYLDKSTYLLVDDHKLIALRYAKS  155

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             W ++DV +TIP+E V  +      +   YS   +LR WRL RVS  F RLEKD ++SYF 
Sbjct  156   WLILDVIATIPYEVVILILPPSLKI---YSYFNILRLWRLHRVSAMFARLEKDRKYSYFL  212

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMT  1806
             VRC +   VTL  +H A C +YFLA R  +    WLG + +  +++L  +Y+ A+YWS+ 
Sbjct  213   VRCCKFTCVTLFSLHAAACFFYFLAAR-DNPESTWLGLVPDAIDQNLWGKYVVAIYWSIV  271

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+++VGYGDLH VNT EM+F IFYMLFNLGLT+Y+IGNMTN+VV+ T RT  +R+++Q+A
Sbjct  272   TLSSVGYGDLHPVNTKEMVFDIFYMLFNLGLTSYLIGNMTNMVVQWTERTKRYRDTVQSA  331

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL+EQ+ A++ ++++   E L  Q +I+ LPK I  SI H+LF  +V+K
Sbjct  332   SNFARRNHLPNRLQEQMFAHLLMKYRTDLEGLQHQEIIDFLPKAIQSSISHYLFFSIVDK  391

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF GVS ++L  LV +MKAEY PP+EDVI+QNE+P D YI ++G  ++I ++   EQV
Sbjct  392   VYLFHGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYIFITGAADLIIHKNGIEQV  451

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V     GD+ GE G LC RPQ FT RTK LSQ+L+L  T+ L  +     D   +I NFL
Sbjct  452   VGEAKPGDVVGETGVLCYRPQVFTVRTKRLSQILRLNRTTFLNLVHSNVGDGTMIINNFL  511

Query  1091  Q--HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             Q  H  +   +K      E     G  ++ I+L    + G+   L +LLK G DPN  D 
Sbjct  512   QNLHESEDPLMKGILAETEAMLARGKMDLPISLLFAASRGDDMLLQQLLKKGSDPNEPDK  571

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWAS  741
              GKT LHI ASKG + CV +LL+HG N ++KD++GN  LW+AI     S+  +L  + A 
Sbjct  572   NGKTALHITASKGRDHCVALLLEHGANPNIKDLDGNVPLWEAIKGGHDSVMKLLIDNGAD  631

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
             IS   V G L C   + N+  +++ +++ G  V     +G+TA+ AA+ E   +++K L+
Sbjct  632   ISSGDV-GSLACVGVEQNNLELLKHIVQCGGDVTQSTSNGTTALHAAVCEGNVEIVKFLL  690

Query  560   MNGAEIDDAVKLNLAPLDLT------EVLQK-RELGHRI---AMPNTILHE---------  438
              +GA+ID        P  L       E++   +++GH+    A+P T   E         
Sbjct  691   EHGADIDKQDGSGWTPRFLADQQCHEEIINVFKKVGHKKTPHAIPTTSFFERYQSEPTIP  750

Query  437   ---AASK-------WAKDDHQNSSSMP-------------------QQCSIRVSIYRGHP  345
                  SK       W  D+HQ     P                      S    I R   
Sbjct  751   GIPQGSKPPNEEPTWF-DNHQRRRVSPFHNSFFGIMSNANYDKKDSTTASQSSHISREEL  809

Query  344   ATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
               R    CP+ G    +LI LP+++ EL+ I  EK  FD + + +  +EGA I+ I VIR
Sbjct  810   LARVTLSCPKKGEHAKKLIFLPKSLEELLHIGAEK--FDYSATRILSKEGAEIEDIYVIR  867

Query  176   DNDKLFI  156
             D D L +
Sbjct  868   DGDLLIL  874



>gb|EEC71181.1| hypothetical protein OsI_03064 [Oryza sativa Indica Group]
Length=894

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/678 (46%), Positives = 425/678 (63%), Gaps = 39/678 (6%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   +S  ILP LG+        +  +ISP D RYR WET++++LV YSAWV PFE 
Sbjct  51    RDGSHYSISSAILPSLGARSNRRIKLRRFIISPYDRRYRIWETFLIVLVVYSAWVSPFEF  110

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              F+  K    L   DN+V+ FFAVDI+LTFFVAY+D  + +L    KKIA RY +TW ++
Sbjct  111   GFI-PKPTGALATADNVVNAFFAVDIILTFFVAYLDKMSYMLEDDPKKIAWRYSTTWLVL  169

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             DVASTIP EF   +   K      Y    MLR WRLRRVS+ F+RLEKD  F+YFWVRCA
Sbjct  170   DVASTIPSEFARRILPSKLR---SYGFFNMLRLWRLRRVSSLFSRLEKDRHFNYFWVRCA  226

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCA C YY LADRYP     W+G+   +  E SL IRY++++YWS+TT+T
Sbjct  227   KLICVTLFAVHCAACFYYLLADRYPVPTSTWIGNYMADFHERSLWIRYVTSVYWSITTLT  286

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLHA NT EMIF IFYMLFNLGLTAY+IGNMTNLVV GT RT  +R++IQAA++F
Sbjct  287   TVGYGDLHAENTREMIFNIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNYRDTIQAATSF  346

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+++++ L+++  +E L QQ +++ LPK I  SI  +LF  +V+ VYL
Sbjct  347   GVRNQLPPRLQDQMISHISLKYRTDSEGLQQQEILDSLPKAIKSSISQYLFFHLVQNVYL  406

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F+GVS +++  LV++MKAEY PPREDVI+QNE+P D YI+VSG V           V+  
Sbjct  407   FQGVSNDLIFQLVSEMKAEYFPPREDVILQNEAPTDFYILVSGSV-----------VIQV  455

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKN---FL  1092
               SG++ GE+G LC RPQ FT RT++L QLL+L  T+ L  +Q    D   ++ N   FL
Sbjct  456   ATSGEVVGEIGVLCYRPQLFTVRTRSLCQLLRLNRTAFLSIVQSNVGDGTIIMNNLIQFL  515

Query  1091  QHHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
             +  K+   +      IEI                   G+   L++LLK G+DPN  D+ G
Sbjct  516   KEQKENSVMAGVVKEIEI-----------------TRGDDFLLHQLLKRGMDPNESDNDG  558

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
              T LHIAASKG+E+CV +LL++G + + +D EG   LW+A+  K  ++  +L    +   
Sbjct  559   HTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLLVEGGADLS  618

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                 G   C A + +D+ ++ +++ +G  V+   R G+TA+  A+ +    M +LL+ +G
Sbjct  619   SGDTGLYACIAVEESDTELLNDIIHYGGDVNRARRDGTTALHRAVCDGNVQMAELLLEHG  678

Query  551   AEIDDAVKLNLAPLDLTE  498
             A+ID        P  L E
Sbjct  679   ADIDKQDGNGWTPRALAE  696



>ref|XP_006296292.1| hypothetical protein CARUB_v10025462mg [Capsella rubella]
 gb|EOA29190.1| hypothetical protein CARUB_v10025462mg [Capsella rubella]
Length=889

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/857 (40%), Positives = 479/857 (56%), Gaps = 73/857 (9%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
              D   S   LSK +LP LG++  +      +  ++SP D RYR WET++V LV Y+AW  
Sbjct  38    RDGTMSQYSLSKGLLPSLGANSRSSRDVILRRFIVSPFDPRYRGWETFLVFLVLYTAWAS  97

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   K+IA RY ST
Sbjct  98    PFEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKRIAWRYAST  156

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             W L DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFW
Sbjct  157   WLLFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFW  213

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSM  1809
             VRC +LL VTL ++HC  C  Y +A  YP   K +  L   N ++  + IRY +AMYWS+
Sbjct  214   VRCTKLLLVTLFVIHCGACFLYSIAAHYPDPSKTFMALTDENWKQSPIAIRYNTAMYWSI  273

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT +T GYGD+H VN+ EM FI+ YM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQA
Sbjct  274   TTFSTTGYGDIHGVNSREMTFILCYMVFNLGLSAYIIGNMTNLVVHVTGRTRKFRDTIQA  333

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS F  RN+LP RL++Q++A++CLR++  +E L QQ +I+ LPK I  SI H+LF  VV+
Sbjct  334   ASGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVD  393

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             K+YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQ
Sbjct  394   KIYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQ  453

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV     G +FGEVG LC RPQ FT RTK LSQLL+L  T LL  +Q    D   ++ N 
Sbjct  454   VVSEAQRGSVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNL  513

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             LQH K  +D  +  +  +       G  ++ ++L    A G+   L++LL+ G  PN  D
Sbjct  514   LQHLKDSEDQVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNETD  573

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
               G+T LHIAASKG   CV++LL+HG + +++D EGN  LW+AI  +   +  +L    +
Sbjct  574   KNGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHSGVAKLLAENGA  633

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
                        C A + N    +++++K+G  +   D +G+TA+  A+ E   +++K L+
Sbjct  634   KLCVDSVSYFACLAVEKNSLDALKDIVKYGGDITLPDGNGTTALHRAVSEGNLEIVKFLL  693

Query  560   MNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI--------------AMPNT-ILHEAASK  426
               GA++D        P  L E     ++                   +P   +  +   K
Sbjct  694   DRGADLDRPDSYGWTPRALAEHQGHEDIKTLFHNHMPVEKKPKPVQGIPQVPVTGKPLLK  753

Query  425   WAKDDHQNSSSMP--------------QQCSIRVSIYRGHPATRRETQCPEPGRLIKLP-  291
             ++ +   +S  MP              +  + R S++    A        EP R   +P 
Sbjct  754   YSSEPTMHSGEMPLVLDGGQVVVSQRRKLNNFRNSLFGFISAANTADDGGEPSRSPAVPT  813

Query  290   -------------------ETIAELI----------SIAGEKLGFDATDSSLTDEEGAII  198
                                ET  ++I           I  +K+GF  T   +   EGA I
Sbjct  814   GGGSTFYPARVTISSPENGETCGKVILLPNTMEELLEIGEKKIGFVPT--KVLTREGAEI  871

Query  197   DSIDVIRDNDKLFIVAD  147
             D I +IRD D L +  D
Sbjct  872   DDITLIRDGDFLLLARD  888



>ref|XP_006392345.1| hypothetical protein EUTSA_v10023251mg [Eutrema salsugineum]
 gb|ESQ29631.1| hypothetical protein EUTSA_v10023251mg [Eutrema salsugineum]
Length=889

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/668 (46%), Positives = 427/668 (64%), Gaps = 12/668 (2%)
 Frame = -2

Query  2477  ILPPLG-SSQPTHTSS-QGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             +LP LG +S+P+   + +  +ISP D RYR WET++V LV Y+AW  PFE  FL+ K   
Sbjct  50    LLPSLGATSRPSREVNLRRFIISPFDPRYRAWETFLVFLVLYTAWASPFEFGFLQ-KPRA  108

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              L ++DNIV+ FFAVDI+LTFF+A++D  T LL+   K+IA RY STW + DV ST P+E
Sbjct  109   PLSILDNIVNGFFAVDIILTFFLAFLDKATYLLVDDPKRIAWRYASTWLVFDVVSTFPYE  168

Query  2123  FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLL  1944
                 L    H     Y +  MLR WRLRRVSN F RLEKD R++YFWVRC +LL VTL +
Sbjct  169   SFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRRYNYFWVRCTKLLLVTLFV  225

Query  1943  VHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
             +HC  C  Y +A  YP   K +  L   N ++  L ++Y +AMYWS+TT +T GYGD+H 
Sbjct  226   IHCGACFLYSIAAHYPDPSKTFMALTDENWKQSPLAVQYNTAMYWSITTFSTTGYGDIHG  285

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN+ EM FI+ YM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQAAS F  RN+LP R
Sbjct  286   VNSREMTFILCYMVFNLGLSAYIIGNMTNLVVHVTSRTRKFRDTIQAASGFGQRNNLPVR  345

Query  1589  LKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
             L++Q++A++CLR++  +E L QQ +I+ LPK I  SI H+LF  VV+K+YLF G+S ++L
Sbjct  346   LQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDKIYLFHGISNDLL  405

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
               LV +MKAEY PP+EDVI+QNE+P D YI+V+G VE+I      EQVV    +G++FGE
Sbjct  406   FQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVEIIARVNGVEQVVKEAQTGNVFGE  465

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             VG LC RPQ FT RTK LSQLL+L  T+LL  +Q    D   ++ N LQH K  +D  + 
Sbjct  466   VGVLCYRPQLFTVRTKRLSQLLRLNRTALLNLVQANVGDGAIIMNNLLQHLKDSEDPVMK  525

Query  1055  dLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
              +  +       G  ++ ++L    A G+   L++LL+ G  PN  D  G+T LHIAASK
Sbjct  526   SILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGASPNEMDKNGRTALHIAASK  585

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCK  702
             G   CV++LL+HG + +++D EGN  LW+AI  +   I  +L    +           C 
Sbjct  586   GSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHGGIAKLLAENGAKLSLDSVSYFSCL  645

Query  701   AAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN  522
             A + N    +++++K+G  V   D +G+TA+  A+ E   +++K L+  GA++D      
Sbjct  646   AVEKNSLDALKDIIKYGGDVTIPDGNGATALHKAVSEGHLEIVKFLLDRGADLDMPDSYG  705

Query  521   LAPLDLTE  498
               P  L E
Sbjct  706   WTPRALAE  713



>gb|KCW79762.1| hypothetical protein EUGRSUZ_C011051, partial [Eucalyptus grandis]
Length=591

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/559 (53%), Positives = 387/559 (69%), Gaps = 10/559 (2%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  2331
              D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28    RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  2330  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  2151
              FL       L ++DN+V+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88    GFLRDP-AIALSIIDNVVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  2150  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCA  1971
             D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RLEKD  ++YFWVRCA
Sbjct  147   DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCA  203

Query  1970  RLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMT  1797
             +L+ VTL  VHCAGC YY LA RY    + W+G++  N  E+SL IRY++++YWS+TT+T
Sbjct  204   KLICVTLFAVHCAGCFYYLLAARYRDPKRTWIGAIMENFLEQSLWIRYVTSIYWSITTLT  263

Query  1796  TVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNF  1617
             TVGYGDLH VNT EM+F IFYMLFNLGLTAY+IGNMTNLVV GT RT +FR++IQAAS+F
Sbjct  264   TVGYGDLHPVNTREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSF  323

Query  1616  VSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYL  1443
               RN LP RL++Q+LA++CL+++  +E L QQ ++E LPK I  SI H+LF  +V+KVYL
Sbjct  324   SLRNQLPPRLQDQMLAHLCLKYRTNSEGLQQQEILESLPKAIRSSISHYLFYSLVDKVYL  383

Query  1442  FKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWT  1263
             F GVS ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G V+++  +   EQV+  
Sbjct  384   FHGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVMKNGTEQVIGE  443

Query  1262  LNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHH  1083
               +GD+ GE+G LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N LQH 
Sbjct  444   AKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHL  503

Query  1082  kklkdlklgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGK  909
             K LKD  +  + +E  +      M + L    AT  G+   LN+LLK GLDPN  D+ G+
Sbjct  504   KDLKDPTMEGVLLETENMLARGRMDLPLSLCFATMRGDDLLLNQLLKRGLDPNESDNSGR  563

Query  908   TPLHIAASKGHEECVMVLL  852
             T LHIAASKG E CV++LL
Sbjct  564   TSLHIAASKGSENCVLLLL  582



>emb|CDX75249.1| BnaA01g04530D [Brassica napus]
Length=876

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/843 (40%), Positives = 480/843 (57%), Gaps = 62/843 (7%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E  S    SK +LPPLG  S        +  ++SP D RYR W+ ++VLLV Y+AW  P
Sbjct  36    EETMSHYSFSKGLLPPLGVNSGSTRRVKLRFFIVSPFDPRYRAWDWFLVLLVGYTAWASP  95

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  +L++     L ++DN+V+ FFA+DIVLTFFVA++D  T LL+   K+IA RY+S+W
Sbjct  96    FEFGYLQTP-RAPLSIIDNVVNGFFAIDIVLTFFVAFLDKATYLLVDDPKRIAWRYVSSW  154

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV ST+P+E    L    H+    Y +  MLR WRLRR SN F RLEKD +++YFWV
Sbjct  155   LIFDVVSTVPYELFGSLL---HNTIQGYGIFSMLRLWRLRRASNCFARLEKDRKYNYFWV  211

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMT  1806
             RC +LL V L +VHC  C  Y +A  YP     +  L   N  ++SL IRY++AMYWS+T
Sbjct  212   RCTKLLLVALFVVHCGACFCYSIAAHYPDPSMTFMALAEPNWTQKSLLIRYVTAMYWSIT  271

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T +T GYGD+H  N  E  FI+FYM+FNLGL AYIIGNMTNLVV  T RT  FR++IQ A
Sbjct  272   TFSTTGYGDIHGNNASERAFILFYMIFNLGLLAYIIGNMTNLVVHVTSRTRNFRDTIQGA  331

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S F  RN LP RL+EQ++A++ LR++  +E L QQ +I+ LPK I  SI H+LF  VV+K
Sbjct  332   SAFAQRNKLPERLQEQMVAHLSLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDK  391

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             +YLF G+S ++L  LV++MKAEY PP+EDVI++NE+P D YI+V+G  E+I      +QV
Sbjct  392   IYLFHGISNDLLFQLVSEMKAEYFPPKEDVILRNEAPTDFYIMVTGAAEIIAPVNGVDQV  451

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V     G +FGEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N L
Sbjct  452   VGEAQPGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNLVQANVGDGAIIMNNLL  511

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K  +D  +  +  +       G  ++ ++L    A G+   L++LLK G +PN  D 
Sbjct  512   QHLKDSEDPVMKGILADTEQMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDK  571

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG   CV++LL+HG + ++KD EG+  LW+AI  +   I  +L+   + 
Sbjct  572   NGRTALHIAASKGCHYCVVLLLEHGADPNIKDSEGSVPLWEAIFGRHEEISKLLWDNGAK  631

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQ---------  585
               P       C A + +    +++++K+G      D +G+TA+  A+ E           
Sbjct  632   LSPDTVAHFSCLAVEQSSLDTLKDIVKYGGDTSLPDSNGTTALHRAVSEGNMEIVEFLLE  691

Query  584   --ADM---------------------IKLLVMNGAEIDDAVK-LNLAPLDLTEVLQKRE-  480
               ADM                     IK L  +   ++   K ++  P ++T +++    
Sbjct  692   HGADMDMPDVYGWTARGLAEHQGHEDIKALFHSQRPVEKKPKSVSGTPENVTPLMKHSSE  751

Query  479   ---LGHRIAMPNTILHEAASKWAKDDHQNS----------SSMPQQCSIRVSIYRGHPA-  342
                + HR       L   + +    + +NS              +  ++   +   +PA 
Sbjct  752   PVMIHHRSRESMPFLRGGSQRRKLSNFKNSLFGIMSAANTGDEGEASTLSEGVGGVYPAR  811

Query  341   TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  162
                  +    G+++KLP T+ ELI I  +KLGF AT   +   EGA ID I +IRD D L
Sbjct  812   VTISGEASSAGKVVKLPNTLEELIEIGEKKLGFVAT--QILTREGAHIDDISLIRDGDFL  869

Query  161   FIV  153
              ++
Sbjct  870   LLL  872



>ref|XP_009125933.1| PREDICTED: probable potassium channel AKT5 [Brassica rapa]
Length=876

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/843 (40%), Positives = 480/843 (57%), Gaps = 62/843 (7%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  2340
             +E  S    SK +LPPLG  S        +  ++SP D RYR W+ ++VLLV Y+AW  P
Sbjct  36    EETMSHYSFSKGLLPPLGVNSGSTRRVKLRFFIVSPFDPRYRAWDWFLVLLVGYTAWASP  95

Query  2339  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  2160
             FE  +L++     L ++DN+V+ FFA+DIVLTFFVA++D  T LL+   K+IA RY+S+W
Sbjct  96    FEFGYLQTP-RAPLSIIDNVVNGFFAIDIVLTFFVAFLDKATYLLVDDPKRIAWRYVSSW  154

Query  2159  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWV  1980
              + DV ST+P+E    L    H+    Y +  MLR WRLRR SN F RLEKD +++YFWV
Sbjct  155   LIFDVVSTVPYELFGSLL---HNTIQGYGIFSMLRLWRLRRASNCFARLEKDRKYNYFWV  211

Query  1979  RCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMT  1806
             RC +LL V L +VHC  C  Y +A  YP     +  L   N  ++SL IRY++AMYWS+T
Sbjct  212   RCTKLLLVALFVVHCGACFCYSIAAHYPDPSMTFMALAEPNWTQKSLLIRYVTAMYWSIT  271

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T +T GYGD+H  N  E  FI+FYM+FNLGL AYIIGNMTNLVV  T RT  FR++IQ A
Sbjct  272   TFSTTGYGDIHGNNASERAFILFYMIFNLGLLAYIIGNMTNLVVHVTSRTRNFRDTIQGA  331

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             S F  RN LP RL+EQ++A++ LR++  +E L QQ +I+ LPK I  SI H+LF  VV+K
Sbjct  332   SAFAQRNKLPERLQEQMVAHLSLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDK  391

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             +YLF G+S ++L  LV++MKAEY PP+EDVI++NE+P D YI+V+G  E+I      +QV
Sbjct  392   IYLFHGISNDLLFQLVSEMKAEYFPPKEDVILRNEAPTDFYIMVTGAAEIIAPVNGVDQV  451

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V     G +FGEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ N L
Sbjct  452   VGEAQPGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNLVQANVGDGAIIMNNLL  511

Query  1091  QHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             QH K  +D  +  +  +       G  ++ ++L    A G+   L++LLK G +PN  D 
Sbjct  512   QHLKDSEDPVMKGILADTEQMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDK  571

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASI  738
              G+T LHIAASKG   CV++LL+HG + ++KD EG+  LW+AI  +   I  +L+   + 
Sbjct  572   NGRTALHIAASKGCHYCVVLLLEHGADPNIKDSEGSVPLWEAIFGRHEEISKLLWDNGAK  631

Query  737   SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQ---------  585
               P       C A + +    +++++K+G      D +G+TA+  A+ E           
Sbjct  632   LSPDTVAHFSCLAVEQSSLDTLKDIVKYGGDTSLPDSNGTTALHRAVSEGNMEIVEFLLE  691

Query  584   --ADM---------------------IKLLVMNGAEIDDAVK-LNLAPLDLTEVLQKRE-  480
               ADM                     IK L  +   ++   K ++  P ++T +++    
Sbjct  692   HGADMDMPDVYGWTARGLAEHQGHEDIKALFHSQRPVEKKPKSVSGTPENVTPLMKHSSE  751

Query  479   ---LGHRIAMPNTILHEAASKWAKDDHQNS----------SSMPQQCSIRVSIYRGHPA-  342
                + HR       L   + +    + +NS              +  ++   +   +PA 
Sbjct  752   PVMIHHRSRESMPFLRGGSQRRKLSNFKNSLFGIMSAANTGDEGEASTLSEGVGGVYPAR  811

Query  341   TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  162
                  +    G+++KLP T+ ELI I  +KLGF AT   +   EGA ID I +IRD D L
Sbjct  812   VTISGEASSAGKVVKLPNTLEELIEIGEKKLGFVAT--QILTREGAHIDDIRLIRDGDFL  869

Query  161   FIV  153
              ++
Sbjct  870   LLL  872



>gb|ACX37089.1| potassium channel [Zygophyllum xanthoxylum]
Length=869

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/839 (39%), Positives = 476/839 (57%), Gaps = 69/839 (8%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  2310
             L+  I+PPLG+           ++SP D RYR W  ++V+LV Y+AWV PFE  FL +K 
Sbjct  30    LTSGIIPPLGARSNRRVPLNKFIVSPYDRRYRSWGVFLVVLVIYTAWVSPFEFGFL-TKP  88

Query  2309  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  2130
             +  L   DNIV+ FFA+DIVLTFFVAY+D  T  L+   KKIA RY S+W  +DV ST+P
Sbjct  89    EAPLSYTDNIVNAFFAIDIVLTFFVAYLDKKTYTLVDEPKKIARRYASSWLALDVISTVP  148

Query  2129  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTL  1950
              E    +          Y +  MLR WRLRRV   F RLEKD   SYFWVRCA+L+ VTL
Sbjct  149   SELALKILPPSVQ---SYGLFSMLRLWRLRRVGALFARLEKDRNCSYFWVRCAKLVSVTL  205

Query  1949  LLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDL  1776
              +VH + C +Y +A RY      W+GS+  N  E+S+   Y ++MYWS+TT+ TVGYGD+
Sbjct  206   FVVHSSACFFYLIAARYHDPKNTWIGSIMENFHEQSVWTSYTTSMYWSITTLATVGYGDI  265

Query  1775  HAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLP  1596
             H VN  EMI+ IFY+LFN+GLTAY+ GNMTNLVV GTR+T +FR++IQAA++FV RN LP
Sbjct  266   HPVNIWEMIYAIFYILFNIGLTAYLFGNMTNLVVHGTRQTRKFRDTIQAATSFVHRNQLP  325

Query  1595  ARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSRE  1422
               L++Q+LA++CL+F+   E L+QQ  I+ LPK I  SI H LF  +V++VYLF+GVS +
Sbjct  326   PSLQDQMLAHLCLKFRTDLEGLHQQETIDSLPKAIRSSISHFLFYSLVDQVYLFRGVSND  385

Query  1421  ILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMF  1242
             +L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G ++++  +  +EQV     +G++ 
Sbjct  386   LLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAMDLLVLKDGSEQVFREAKAGEIC  445

Query  1241  GEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlk  1062
             GE+G LC RPQ FT RTK L QLL++  T  +  +Q    D   ++ N LQ+ K+ KD  
Sbjct  446   GEIGVLCYRPQPFTVRTKRLCQLLRINRTRFMNIIQTNVGDGTIIMNNLLQYLKEQKDPV  505

Query  1061  lgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAA  888
             L ++ +E       G  ++ ++L      G+ + L++LLK GLD N  D+ G+T LHIAA
Sbjct  506   LENILLETETMLARGIMDLPLSLCFAANRGDDSLLHQLLKRGLDANESDNNGRTALHIAA  565

Query  887   SKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLL  708
             SKG E CV++LL +G + + +D EGN  LW+A++A    +  +L    +       G   
Sbjct  566   SKGSENCVLLLLDYGADPNSRDSEGNVPLWEAMSAGHEQVVKLLIENGARLSVGDVGQFA  625

Query  707   CKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVK  528
             C AA+ N+ ++++E+++    +      G+TA+  A+ E   D++K L+  GA++     
Sbjct  626   CSAAEANNLNLLKEIVRCEGDITLPKATGTTALHVAVSEANLDIVKYLLDQGADVSKPDV  685

Query  527   LNLAPLDLTE---------VLQKRELGHRIAMPNTILHEAASKWAK--DDHQNSSSMPQQ  381
                 P DL +         + + +     +A       +  +++       Q  S +PQ 
Sbjct  686   HGWTPRDLADQQGHEEIKAIFKSKREDKTLAAITIPEKQVGTRFFGRITSEQGISPVPQD  745

Query  380   CSIRVSIYRGHPATRR------------------------------------------ET  327
              ++  S +  +   RR                                            
Sbjct  746   GTVAESPWSQNRPKRRVKNFHNSLFGIMSTAHNVGKELFSAVEQSKGQSDRGSHNARVTI  805

Query  326   QCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  162
              CPE      +L+ LP +  EL+ I  +K G     + +  +E A ID I VIRD D L
Sbjct  806   SCPEKQEMSRKLVSLPGSFKELLDIGAKKFGI--FPAKVLSKERAEIDDIQVIRDGDHL  862



>ref|XP_008392136.1| PREDICTED: potassium channel AKT1 [Malus domestica]
Length=890

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/848 (39%), Positives = 483/848 (57%), Gaps = 78/848 (9%)
 Frame = -2

Query  2477  ILPPLGSSQPTHTSSQ--GLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             ILP LG++ P     +    +ISP +  Y+ W+++++LLV Y+AWVCPFE  FL+ +   
Sbjct  45    ILPSLGATAPNRPKHKFRRFIISPFNYYYKLWQSFLILLVFYTAWVCPFEFGFLD-RAKG  103

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              + + DN+V+  FA+DIVLTFFVAY+D TT LLI + K IA RY  TW   D+ STIP E
Sbjct  104   LIAIADNVVNALFAIDIVLTFFVAYLDKTTYLLIDNHKLIALRYAKTWLAFDIISTIPSE  163

Query  2123  FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLL  1944
                 +          Y    +LR WRLRRVS   +RLEKD  +SYFWVR  +L+FVTLL 
Sbjct  164   LAQRVLPPPLE---TYGYFNILRLWRLRRVSAMISRLEKDRNYSYFWVRYCKLIFVTLLT  220

Query  1943  VHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
             VHCAGC +YFLA  Y +  + W G +  N ++  L  RY+S+MYWS+ T+TT GYGD H 
Sbjct  221   VHCAGCFFYFLAAHYRNPRRTWFGLIEENFQQLPLWDRYVSSMYWSIITLTTTGYGDFHP  280

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN+ EM F IFYMLFNLGL AY+IGNMTNL+V GT RT +FR++IQAA++F  RN +P  
Sbjct  281   VNSQEMTFDIFYMLFNLGLQAYLIGNMTNLIVHGTARTRQFRDTIQAATSFARRNQIPDH  340

Query  1589  LKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
             L EQ+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF P+++ VYLF+GVSR++L
Sbjct  341   LHEQMLAHLCLKYRTNSEGLQQQEALDALPKAIRSSISHYLFYPLLDSVYLFQGVSRDLL  400

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
               LV++MKAEY PP+E VI+QNE+P D+YI+V+G VE+I +      VV    +GD+ GE
Sbjct  401   FQLVSEMKAEYFPPKEVVILQNEAPTDMYIVVTGSVELIMHRNGATPVVREAKTGDVVGE  460

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklg  1056
             +G LC RPQ  T RTK LSQLL+L  T+ L  +Q    D   ++ NFL+H K++K+    
Sbjct  461   IGVLCYRPQMVTVRTKGLSQLLRLNRTAFLNLVQANVGDGTIIMNNFLKHLKEMKNPLAE  520

Query  1055  dLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
              +  +I      G  ++ ++L      G+   L++LL+ G DPN  D  G+T +HIAAS 
Sbjct  521   GILRDIEHVLASGRMDLPLSLCFAAQRGDDMLLHQLLRRGSDPNEMDDNGRTAMHIAASN  580

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCK  702
             G+E C ++LL++  + +++D EGN  LW+AI+ K  S+  +L    +  +    G+  C 
Sbjct  581   GNEHCALLLLEYEADPNIQDSEGNVPLWEAISGKHESLIKLLLDNGAKINSGNVGNFACS  640

Query  701   AAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN  522
             A + N+  +++ ++K+   V     +G+TA+  A+ E   ++ K L+  GAE D      
Sbjct  641   AVEQNNLELLKYIVKYNGDVTLPKNNGTTALHTAVCEENVEIAKFLLEQGAEADKPDSYG  700

Query  521   LAPLDLT---------EVLQKRELGHR-------IAMPNTILHEAASK---------WAK  417
               P  L          E+ Q++    +       + MP   +     K         +A+
Sbjct  701   WTPRALAEHQGHDKIMELFQQKSESKKPSKKXTVVPMPEDPILSRPGKFRSEPTLPPYAR  760

Query  416   DDHQNSSSMPQQCSIRV-----------------------------------SIYRGHPA  342
             D    +S M  + ++R+                                   S  R    
Sbjct  761   DGRPFNSDMTSENTLRMDKSFRNSLFGFMSTANTNTGEKDRDNVTSTGSLTRSTSRNSYP  820

Query  341   TRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  174
              R    CPE G    +L+ LP+++ +L+ +  +K  F AT     D   A I+ I+++RD
Sbjct  821   ARVTLSCPEKGXTAAKLVLLPDSLQQLLDLGAKKFQFSATKVLTKDR--AEIEDIELVRD  878

Query  173   NDKLFIVA  150
              D L +V 
Sbjct  879   GDHLVLVG  886



>gb|ABR17684.1| unknown [Picea sitchensis]
Length=659

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/538 (54%), Positives = 382/538 (71%), Gaps = 17/538 (3%)
 Frame = -2

Query  2477  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  2298
             +LPPLGS   + T  +  +ISP D RYRCWET++++LV YSAWVCPFE+ F ++     L
Sbjct  62    MLPPLGSRWSSDTQLEKNIISPHDPRYRCWETFLIVLVGYSAWVCPFELGFSDAP-KGGL  120

Query  2297  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  2118
              +VD IVD FFA+D++LTFFVAY D  TQ+LI   +KIA RY+S  F++DV STIPFE +
Sbjct  121   LIVDTIVDAFFAIDVILTFFVAYCDDKTQILIDKPRKIALRYISRGFVLDVTSTIPFETL  180

Query  2117  AFLFTGKHH-LGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLLV  1941
              +L  GKH    + YS+L +L  WRLRRV   FTRLEKDIRFSYFW+RCARL+ VTL  V
Sbjct  181   IYLIRGKHAGFNIYYSLLNVLHLWRLRRVKTLFTRLEKDIRFSYFWIRCARLICVTLFAV  240

Query  1940  HCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHAV  1767
             HCAGCLYY LA  YP+Q   W+GS     +++S  IRYIS +YWS+TT++TVGYGD+HAV
Sbjct  241   HCAGCLYYLLAIWYPNQNNTWIGSRVPEFQQKSFWIRYISCIYWSITTLSTVGYGDIHAV  300

Query  1766  NTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPARL  1587
             NT EMIFIIFY+ FNLGLTAY+IGNMTNLVV+GT RTM+FRN I+AASNF +RN LP +L
Sbjct  301   NTREMIFIIFYVFFNLGLTAYLIGNMTNLVVQGTSRTMQFRNKIRAASNFGNRNDLPPKL  360

Query  1586  KEQILAYMCLRFKAESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREILLLL  1407
             KEQIL+YMCL+F+AE L QQ ++E+LPK+I  SI   LF+  VE VYLF+GVS E +L L
Sbjct  361   KEQILSYMCLKFRAEELQQQKVMEELPKSIRTSISRCLFIETVETVYLFQGVSTEFILDL  420

Query  1406  VADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGEVGA  1227
             V +M AEY PP+ED+++QNE+P D+Y++VSGEVEM+  E  NEQVV +L +G +FGE+G 
Sbjct  421   VTEMHAEYFPPKEDILLQNETPSDIYLLVSGEVEMLTCENGNEQVVESLRAGGLFGEIGV  480

Query  1226  LCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdlklgdLF  1047
             L  +PQ  T RTK LSQLL+L  + LL+ +Q +  +   +++NFLQH    K        
Sbjct  481   LYDKPQHLTVRTKKLSQLLRLSGSVLLDKMQTRPTEAKVILRNFLQHFNGSK--------  532

Query  1046  IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDP-NIGDSKGKTPLHIAASKGH  876
              ++G E+      ++ FT +       L+ + ++ L P +I ++    PL +   K H
Sbjct  533   -QLGIENWSNEYLLSHFTTLTANVPKTLSNISRSNLQPRSISEAP---PLRVIIYKNH  586


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = -2

Query  395  SMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTD  216
            S+ +   +RV IY+ HP+  +  Q    G+L+ LP+T+ +L+ +AG K GF      + +
Sbjct  571  SISEAPPLRVIIYKNHPS--KNKQYTGLGKLVILPDTVDQLLKMAGLKFGFHPV--KVLN  626

Query  215  EEGAIIDSIDVIRDNDKLFIV  153
            E+GA ID I+VIRDND LF+V
Sbjct  627  EDGAEIDEINVIRDNDPLFLV  647



>ref|NP_180131.3| potassium channel AKT6 [Arabidopsis thaliana]
 sp|Q8GXE6.2|AKT6_ARATH RecName: Full=Potassium channel AKT6; AltName: Full=Potassium 
channel SPIK; AltName: Full=Shaker pollen inward rectifier 
K(+) channel [Arabidopsis thaliana]
 gb|AAD31377.1| putative potassium transporter/channel [Arabidopsis thaliana]
 emb|CAC85283.1| shaker pollen inward rectifier K+ channel [Arabidopsis thaliana]
 gb|AEC07722.1| potassium channel AKT6 [Arabidopsis thaliana]
Length=888

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/671 (46%), Positives = 427/671 (64%), Gaps = 20/671 (3%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
              D   S   LSK +LP LG++  +         ++SP D RYR WET++V LV Y+AW  
Sbjct  39    RDGTMSQYSLSKGLLPSLGANNRSSRDVILPRFIVSPFDPRYRAWETFLVFLVLYTAWAS  98

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FL+ K    L ++DNIV+ FFAVDIVLTFFVA++D  T LL+   K+IA RY ST
Sbjct  99    PFEFGFLQ-KPRPPLSILDNIVNGFFAVDIVLTFFVAFLDKVTYLLVDDPKRIAWRYAST  157

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             W + DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD ++SYFW
Sbjct  158   WLIFDVVSTFPYEIFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFW  214

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSM  1809
             VRC++LL VTL ++HC  C  Y +A  YP   K +  L   N +E  + +RY +AMYWS+
Sbjct  215   VRCSKLLLVTLFVIHCGACFLYSIAAHYPDPSKTFMALTDENWKESPIAVRYNTAMYWSI  274

Query  1808  TTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQA  1629
             TT +T GYGD+H VN+ EM FI+FYM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQA
Sbjct  275   TTFSTTGYGDIHGVNSREMTFILFYMVFNLGLSAYIIGNMTNLVVHVTGRTRKFRDTIQA  334

Query  1628  ASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVE  1455
             AS F  RN+LP RL++Q++A++CLR++  +E L QQ +I+ LPK I  SI H+LF  VV+
Sbjct  335   ASGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVD  394

Query  1454  KVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQ  1275
             K+YLF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G V++I      EQ
Sbjct  395   KIYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQ  454

Query  1274  VVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNF  1095
             VV     G +FGEVG LC RPQ FT RTK LSQLL+L  T LL  +Q    D   ++ N 
Sbjct  455   VVSEAQRGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNL  514

Query  1094  LQHHkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGD  921
             LQH K  +D  +  +  +       G  ++ ++L    A G+   L++LL+ G  PN  D
Sbjct  515   LQHLKDSEDPVMKGVLADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNEMD  574

Query  920   SKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWAS  741
               G+T LHIAASKG   CV++LL+HG + +++D EGN  LW+AI  +   I  +L    +
Sbjct  575   KDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHREIAKLLAENGA  634

Query  740   I----SDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMI  573
                  S  Y +G     A + N    +++++K+G  V   D +G+TA+  A+ E   +++
Sbjct  635   KLSLDSVSYFSG----LAVEKNCLDALKDIIKYGGDVTLPDGNGTTALHRAVSEGHLEIV  690

Query  572   KLLVMNGAEID  540
             K L+  GA++D
Sbjct  691   KFLLDQGADLD  701



>ref|XP_006285898.1| hypothetical protein CARUB_v10007410mg [Capsella rubella]
 gb|EOA18796.1| hypothetical protein CARUB_v10007410mg [Capsella rubella]
Length=880

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/660 (46%), Positives = 422/660 (64%), Gaps = 14/660 (2%)
 Frame = -2

Query  2489  LSKFILPPLG----SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL  2322
              SK +LPPLG         H   +  +ISP D RYR W+ ++V+LV Y+AW  PFE  FL
Sbjct  44    FSKGLLPPLGVGATGRSSRHIKLRCFIISPFDPRYRAWDWFLVVLVLYTAWASPFEFGFL  103

Query  2321  ESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVA  2142
             ++     L ++DNIV+ FFAVDIVLTFFVA+++  T LL+   KKIA RY STW + DV 
Sbjct  104   QTP-RAPLSILDNIVNGFFAVDIVLTFFVAFLNKATYLLVDDPKKIAWRYTSTWLIFDVV  162

Query  2141  STIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLL  1962
             ST+P+E  A L    H     Y +  MLR WRLRRVSN F RLEKD +++YFW+RC +LL
Sbjct  163   STVPYEIFASLL---HKTIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYNYFWIRCTKLL  219

Query  1961  FVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVG  1788
              V L +VHC  C  Y +A  YP     +  L   N  ++SL IRYI+AMYWS+TT +T G
Sbjct  220   LVALFVVHCGACFNYSIAAHYPEPSMTFMALAEENWTKKSLLIRYITAMYWSITTFSTTG  279

Query  1787  YGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSR  1608
             YGD+H  N  E  FI+FYM+FNLGL AYIIGNMTNLVV  T RT++FR++IQAAS F  R
Sbjct  280   YGDIHGNNARERAFILFYMIFNLGLLAYIIGNMTNLVVHVTSRTIKFRDTIQAASAFAQR  339

Query  1607  NHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKG  1434
             N+LP  L+EQ++A++ LR++  +E L Q+ +I+ LPK I  SI H+LF  +V+K+YLF G
Sbjct  340   NNLPVGLQEQMVAHLSLRYRTDSEGLQQKEIIDSLPKAIRSSISHYLFYEIVDKIYLFHG  399

Query  1433  VSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNS  1254
             +S ++L  LV +MKAEY PP+EDVI++NE+P D YI+++G V++I      +QVV     
Sbjct  400   ISNDLLFQLVTEMKAEYFPPKEDVILRNEAPTDFYIMITGAVDIIARVNGVDQVVGEAQK  459

Query  1253  GDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkkl  1074
             G +FGEVG LC RPQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQH K  
Sbjct  460   GHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTSFLNLVQANVGDGAIIMNNLLQHLKDS  519

Query  1073  kdlklgdLF--IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPL  900
             +D  +  +    E+    G  ++ ++L    A G+   L++LLK G +PN  D+ G+T L
Sbjct  520   EDPVMKGILADTELMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDTNGRTAL  579

Query  899   HIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVA  720
             HIAASKG + CV++LL+HG + +++D EGN  LW+AI  +   I  +L    +       
Sbjct  580   HIAASKGKQYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHEEIAKLLSENGATLSFDTV  639

Query  719   GDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
             G   C A + N    ++++LK+G  +   D +G+TA+  A+ E   +++K L+  GA++D
Sbjct  640   GQFSCLAVEQNSLDTLKDILKYGGDISLPDVNGNTALHRAVSEGNMEIVKFLLEQGADMD  699



>ref|XP_006412470.1| hypothetical protein EUTSA_v10024374mg [Eutrema salsugineum]
 gb|ESQ53923.1| hypothetical protein EUTSA_v10024374mg [Eutrema salsugineum]
Length=875

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/840 (40%), Positives = 484/840 (58%), Gaps = 69/840 (8%)
 Frame = -2

Query  2489  LSKFILPPLG---SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLE  2319
              SK +LPPLG    S   H   +  ++SP D RYR W+ ++VLLV Y+AW  PFE  FL+
Sbjct  41    FSKGLLPPLGVNSRSTGRHVKLRCFIVSPFDPRYRAWDWFLVLLVLYTAWASPFEFGFLQ  100

Query  2318  SKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAS  2139
             +     L V+DN+V+ FFAVDIVLTFFVA++D  T LL+   K+IA RY STW + DV S
Sbjct  101   TP-RAPLSVLDNVVNGFFAVDIVLTFFVAFLDKATYLLVDDPKRIAWRYTSTWLIFDVVS  159

Query  2138  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLF  1959
             T+P+E  A L    H     Y +  MLR WRLRRVSN F RLEKD +++YFWVRC +LL 
Sbjct  160   TVPYELFASLL---HKTIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYNYFWVRCTKLLL  216

Query  1958  VTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTMTTVGY  1785
             V L ++HC  C  Y +A  YP   + +  L   N  + SL IRY++AMYWS+TT +T GY
Sbjct  217   VALFVIHCGACFCYSIAAHYPDPSQTFMALAEPNWTKVSLLIRYVTAMYWSITTFSTTGY  276

Query  1784  GDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRN  1605
             GD+H  N  E  FI+ YM+FNLGL AYIIGNMTNLVV  T RT+ FR++IQAAS F  RN
Sbjct  277   GDIHGNNAGERAFILCYMVFNLGLLAYIIGNMTNLVVHVTSRTVNFRDTIQAASAFAQRN  336

Query  1604  HLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
             +LP RL+EQ++A++ LR++  +E L QQ +I+ LPK I  SI H+LF  VV+K+YLF G+
Sbjct  337   NLPVRLQEQMVAHLSLRYRTDSEGLRQQEIIDSLPKAIRSSISHYLFYEVVDKIYLFHGI  396

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             S ++L  LV++MKAEY PP+EDV+++NE+P D YI+V+G VE+I +    +QVV    +G
Sbjct  397   SNDLLFQLVSEMKAEYFPPKEDVLLRNEAPTDFYIMVTGAVEIIASVNGVDQVVGEAQTG  456

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
              +FGEVG LC RPQ FT RTK LSQLL+L  TS L  +Q    D   ++ N LQH K  +
Sbjct  457   HVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTSFLNLVQANVGDGAIIMNNLLQHLKDSE  516

Query  1070  dlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             D  +  +  +       G  ++ ++L    A G+   L++LLK G +PN  D  G+T LH
Sbjct  517   DPVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLKRGSNPNETDKNGRTALH  576

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAASKG + CV++LL+HG + +++D EGN  LW+AI  +   I  +L    +       G
Sbjct  577   IAASKGSQYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHEEIAKLLSDNGATLSFDTVG  636

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID-  540
                C A + N    +++++K G  +   D +G+TA+  A+ E   ++++ L+  GA++D 
Sbjct  637   YFSCLAVEQNSLDALKDIVKFGGDISLPDSNGTTALHRAVSEGNMEIVEFLLEQGADMDM  696

Query  539   --------DAVKLNLAPLDLTEVLQKRELGHRIAMPNTI--------LHEAASKWAKDDH  408
                       +  +   +D+  +   +    +   P ++        L + +S+     H
Sbjct  697   PDVYGWTARGLAEHQGHVDIKALFDSQRPVEK--KPKSVSGTPDIKPLMKHSSEPVMTHH  754

Query  407   QNSSSMP---------QQCSIRVSIYRGHPATRRETQCPEPGRLIK---LPETIAELISI  264
             ++  +MP         +  + + S++    A     +   P R  +   + E     ++I
Sbjct  755   RSREAMPFVRAVSQRKKLSNFKNSLFGIMSAANTGDEGGAPPRSTRSQGVGEVYPARVTI  814

Query  263   AGE-----------------------KLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  153
             +GE                       KLGF AT   +   EGA ID I +IRD D L ++
Sbjct  815   SGEASSSGKLVKLPDSLEELIEIGEKKLGFVAT--KILTREGAQIDDIRLIRDGDFLLLL  872



>ref|XP_010432708.1| PREDICTED: probable potassium channel AKT5 [Camelina sativa]
Length=882

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/850 (40%), Positives = 493/850 (58%), Gaps = 68/850 (8%)
 Frame = -2

Query  2516  EDEDFSLGKLSKFILPPLGSSQPTHTSSQ----GLVISPMDSRYRCWETWMVLLVAYSAW  2349
             +D   S    SK +LPPLG      +  +      ++SP D RYR W+ ++V+LV Y+AW
Sbjct  36    KDGTMSHYSFSKGLLPPLGVGAAGRSGRRIKLRCFIVSPFDPRYRAWDWFLVVLVLYTAW  95

Query  2348  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  2169
               PFE  FL++     L ++DNIV+ FFAVDIVL+FFVA++D +T LL+   K+IA RY 
Sbjct  96    ASPFEFGFLQTP-RAPLSILDNIVNGFFAVDIVLSFFVAFLDKSTYLLVDDPKRIAWRYT  154

Query  2168  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSY  1989
             STW + D+ ST+P+E  A L    H     Y +  MLR WRLRRVS  F RLEKD +FSY
Sbjct  155   STWLIFDIVSTVPYELFASLL---HKTIQGYGIFSMLRLWRLRRVSKCFARLEKDRKFSY  211

Query  1988  FWVRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYW  1815
             FW+R  +L    L +VHC  C  Y +A  YP     +  L   N  +++L IRY++AMYW
Sbjct  212   FWIRSTKLYLAALFVVHCGACFCYSIAAHYPDPSMTFMALAEENWTKKNLLIRYVTAMYW  271

Query  1814  SMTTMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSI  1635
             S+TT +T GYGD+H  N  E  FI+FYM+FNLGL AYIIGNMT+LVV  T RT+ FR++I
Sbjct  272   SITTFSTTGYGDIHGNNASERAFILFYMIFNLGLLAYIIGNMTSLVVHVTSRTINFRDTI  331

Query  1634  QAASNFVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPV  1461
             QAAS F  RN+LP RL+EQ++A++ LR++  +E L Q+ +I+ LPK I  SI H+LF   
Sbjct  332   QAASAFAQRNNLPVRLQEQMVAHLSLRYRTDSEGLQQKDIIDSLPKAIRSSISHYLFYEN  391

Query  1460  VEKVYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMEN  1281
             V+K+YLF+G+S ++L  LV +MKAEY PP+EDVI++NE+P D YI+V+G V++I      
Sbjct  392   VDKIYLFRGISNDLLFQLVTEMKAEYFPPKEDVILRNEAPTDFYIMVTGAVDIIARVNGV  451

Query  1280  EQVVWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIK  1101
             +QVV    +G +FGEVG LC RPQ FT RTK LSQLL+L  T+ L  +Q    D   ++ 
Sbjct  452   DQVVGEARTGQVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAFLNLVQANVGDGAIIMN  511

Query  1100  NFLQHHkklkdlklgdLF--IEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNI  927
             N LQH K  +D  + D+   IE+    G  ++ ++L      G+   L+ LLK G +PN 
Sbjct  512   NLLQHLKDSEDPVMKDILADIELMLAQGKMDLPLSLCFAADRGDDLLLHHLLKRGSNPNE  571

Query  926   GDSKGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHW  747
              D+ G+T LHIAASKG++ CV++LL+ G + +++D EGN  LW+AI+ +   I  +L   
Sbjct  572   TDTNGRTALHIAASKGNQYCVVLLLEKGADPNIRDSEGNVPLWEAISGRHEEIAKLLSEN  631

Query  746   ASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKL  567
              +       G   C A   N    ++++LK+G  +   D +G+TA+  A+ E   +++K 
Sbjct  632   GATLSFDTVGHFSCLAVGQNSLDTLKDILKYGGDISLPDVNGTTALHRAVSEGNVEIVKF  691

Query  566   LVMNGAEID---------------------DAVKLNLAPLD-----LTEVLQKRELGHRI  465
             L+   A++D                      A+  N  P++     ++   + + L    
Sbjct  692   LLEQRADMDKPDVYGWTARGLAEHQGHEDIKALFHNQRPVEKKQNFVSGTPEFKSLMKHC  751

Query  464   AMPNTILHEA-----------ASKWAKDDHQNS---------SSMPQQCSIRV-SIYRG-  351
             + P  I H +           + +W   + +NS         + + +  S R  +I  G 
Sbjct  752   SEPVMIYHRSREAMPPLDRAVSQRWKPSNFKNSLFGIMSAANTGVERGASTRTAAISEGA  811

Query  350   ---HPA-TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
                +PA      +    G+++KLP+++ EL  I  +KLGF AT   +  +EGA ID I +
Sbjct  812   GVVYPARVTISGEVSSSGKVVKLPDSLEELFEIGEKKLGFVAT--KILSKEGAEIDDISI  869

Query  182   IRDNDKLFIV  153
             IRD D L ++
Sbjct  870   IRDGDYLLLL  879



>ref|XP_004293012.1| PREDICTED: potassium channel AKT6-like [Fragaria vesca subsp. 
vesca]
Length=880

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/703 (43%), Positives = 430/703 (61%), Gaps = 12/703 (2%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSSQ--GLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  2316
             LS  ILP LG++   H   +    +ISP + RY+ W+++++L V Y+AWVCPFE  FL+S
Sbjct  35    LSDGILPSLGAASRNHRRPKLRRFIISPFNPRYKLWQSFLILWVFYTAWVCPFEFGFLDS  94

Query  2315  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  2136
                  L + DN+V+  F +DI+LTFFVAY+D TT LLI   K IA RY  TW   D+ S 
Sbjct  95    P-RGPLAITDNVVNGLFGIDIILTFFVAYLDKTTYLLIDSPKLIALRYAKTWLAFDIISI  153

Query  2135  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFV  1956
             IP EF   +     H    Y    +LR WRLRRVS  F RLEKD  FSYFWVRC++L+FV
Sbjct  154   IPSEFAQTVLP---HPLANYGYFNILRLWRLRRVSAMFARLEKDRNFSYFWVRCSKLVFV  210

Query  1955  TLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYG  1782
             TL  VHC GC++YF+A  Y    + WLG L  N ++ S+  RY+++MYWS+ T+TT GYG
Sbjct  211   TLFTVHCGGCIFYFIAANYHDPKRTWLGLLTDNFKDISVWNRYVTSMYWSIITLTTTGYG  270

Query  1781  DLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNH  1602
             DLH VN+ EMIF IFYMLFN+GL AY+IGNMTNL+V GT RT +FR+SI AAS+F  RN 
Sbjct  271   DLHPVNSQEMIFDIFYMLFNVGLQAYLIGNMTNLIVHGTARTRQFRDSIHAASSFAVRNQ  330

Query  1601  LPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVS  1428
             +P RL EQ+LA++CL+++  +E L QQ  ++ LP  I  SI H+LF  +V+ VYLF+GVS
Sbjct  331   IPDRLHEQMLAHLCLKYRTNSEGLQQQETLDALPHAIRSSISHYLFNSLVDNVYLFQGVS  390

Query  1427  REILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGD  1248
             R++L  LVA+MKAEY PP+EDVI+QNE+P D+YI+V+G VE+I  +   E V     +GD
Sbjct  391   RDMLFQLVAEMKAEYFPPKEDVILQNEAPTDMYIVVTGSVELILQKNGVEMVFREAKTGD  450

Query  1247  MFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkd  1068
             +FG +G LC RPQ FT RTK L QLL+L  T+ L  +Q    D   ++ NFL H +  KD
Sbjct  451   VFGAIGVLCYRPQLFTVRTKGLCQLLRLNRTNFLNIVQANVGDGTIIMSNFLHHLRDEKD  510

Query  1067  lklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHI  894
               +  +  ++      G   M ++L       +   L++LL+ G DPN  D  G+T +HI
Sbjct  511   PIMEGILTDVEHMLARGKSGMPLSLGFAAKRSDDLLLHQLLRRGADPNETDHNGRTAMHI  570

Query  893   AASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD  714
             AAS G + CV +LL++G + ++KD E N  LW+AI  K  S+  +L    +       G 
Sbjct  571   AASIGSKHCVTLLLEYGGDPNIKDCEENVPLWEAIIGKHESLIKLLLENGAEISAGGVGH  630

Query  713   LLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA  534
               C A + N   ++++++++G  V      G+TA+  A+ +  A+++  L+  GA+ D+ 
Sbjct  631   YACTAVEQNSLELLKDIVQYGGDVTLPKSDGTTALHTAISDGNAEIVNFLLEQGADPDER  690

Query  533   VKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDHQ  405
                  +P  L E     E+       + +     +    D HQ
Sbjct  691   DSYGWSPRALAEHQGHEEIIELFQNKSGVKKPTTASQPNDPHQ  733



>ref|XP_009117222.1| PREDICTED: potassium channel AKT6 [Brassica rapa]
Length=877

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/678 (46%), Positives = 426/678 (63%), Gaps = 12/678 (2%)
 Frame = -2

Query  2513  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  2334
             DE  S    SK +LP LG++    +S +  +ISP D RYR WET++V LV Y+AW  PFE
Sbjct  35    DETMSQYSHSKGLLPSLGAT--ARSSLRPFIISPFDPRYRAWETFLVFLVLYTAWASPFE  92

Query  2333  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  2154
               FL+ +    L ++DNIV+ FFA+DIVLTFFVA++D  T LLI   K+IA RY+STWF 
Sbjct  93    FGFLQ-RPRAPLSILDNIVNGFFAIDIVLTFFVAFLDKVTYLLIDDPKRIAWRYVSTWFA  151

Query  2153  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRC  1974
              DV ST P+E    L    H     Y +  MLR WRLRRVSN F RLEKD R+SYFWVR 
Sbjct  152   FDVISTFPYESFGSLL---HSSIQGYGIFSMLRLWRLRRVSNCFARLEKDRRYSYFWVRS  208

Query  1973  ARLLFVTLLLVHCAGCLYYFLADRYPHQGKNW--LGSLNVREESLKIRYISAMYWSMTTM  1800
              +LL  TL ++HC  C  Y +A  YP   K +  L   N ++  L ++Y +AMYWS+TT 
Sbjct  209   TKLLLCTLFVIHCGACFLYSIASHYPDPSKTFMALTDENWKQSPLAVQYNTAMYWSITTF  268

Query  1799  TTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASN  1620
             +T GYGD+H VN+ EM FI+FYM+FNLGL+AYIIGNMTNLVV  T RT +FR++IQAAS 
Sbjct  269   STTGYGDIHGVNSKEMTFILFYMVFNLGLSAYIIGNMTNLVVHVTSRTRKFRDTIQAASG  328

Query  1619  FVSRNHLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVY  1446
             F  RN+LP RL++Q++A++CLR++  +E L QQ +I+ LPK I  SI H+LF  VV+ +Y
Sbjct  329   FGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDNIY  388

Query  1445  LFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVW  1266
             LF G+S ++L  LV +MKAEY PP+EDVI+QNE+P D YI+V+G VE+I      EQVV 
Sbjct  389   LFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVEIIARVNGVEQVVS  448

Query  1265  TLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH  1086
                 G++FGEVG LC RPQ FT RTK L+QLL+L  T+LL  +Q    D   ++ N LQH
Sbjct  449   EAQGGNVFGEVGVLCYRPQLFTVRTKRLTQLLRLNRTTLLNLVQANVGDGAIIMNNLLQH  508

Query  1085  HkklkdlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKG  912
              K  +D  +  +  +       G  ++ ++L    A G+   L++LL+ G + N  D  G
Sbjct  509   LKDSEDPVMKGILADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSNSNEMDKNG  568

Query  911   KTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISD  732
             +T LHIAAS+G   CV++LL+HG + ++KD EGN  LW+AI      I  +L    +   
Sbjct  569   RTALHIAASRGSHYCVVLLLEHGADPNIKDSEGNVPLWEAIIGGHGEIAKLLAENGAKLS  628

Query  731   PYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNG  552
                     C A + +    +++++K+G  +   D  G+TA+  A+ E   +++K L+  G
Sbjct  629   LDSVSYYSCLAVEKHSLEALKDIIKYGGDITLPDGTGTTALHRAVSEGHVEIVKFLLDKG  688

Query  551   AEIDDAVKLNLAPLDLTE  498
             A++D        P  L E
Sbjct  689   ADLDMPDSYGWTPRGLAE  706



>ref|XP_009601872.1| PREDICTED: potassium channel AKT1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=936

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/852 (41%), Positives = 492/852 (58%), Gaps = 82/852 (10%)
 Frame = -2

Query  2489  LSKFILPPLGSSQPTHTSS-QGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESK  2313
             LS  ILP LG+     T   +  +I P D  YR W++++  LV Y+AWVCPFE  FLE K
Sbjct  82    LSTGILPSLGARTTNRTVKLRRFIIHPSDHHYRAWQSFLAALVIYTAWVCPFEFGFLE-K  140

Query  2312  LDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTI  2133
              +  L + DNIV+ FFA+DIVL FFVAY D TT +L+   K+IA +Y   W + DV STI
Sbjct  141   PERPLAIADNIVNAFFAIDIVLNFFVAYRDKTTYVLVDSHKRIAKKYARAWMICDVISTI  200

Query  2132  PFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVT  1953
             P E    +          Y +  MLR WRLRRVS  F RLEKD  F+Y+ VRCA+L+ VT
Sbjct  201   PSELARKIPKPFDE----YDLFYMLRLWRLRRVSALFARLEKDRNFNYYCVRCAKLICVT  256

Query  1952  LLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGD  1779
             L  VHCAGC YY +A  YP   K W+G+   +   +SL  RYI+++YWS+TT+TTVGYGD
Sbjct  257   LFAVHCAGCFYYLIAAHYPDPNKTWIGASMDDFLNQSLWNRYITSIYWSITTLTTVGYGD  316

Query  1778  LHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHL  1599
             LH  NT EMIF IFYMLFNLGLTAY+IGNMT L+V  T RT +FR++IQAASNF  RN L
Sbjct  317   LHPENTREMIFDIFYMLFNLGLTAYLIGNMTLLIVHETSRTRQFRDTIQAASNFAQRNQL  376

Query  1598  PARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSR  1425
             PARL++Q++A++CL+++  +E + QQ  ++ LPK I  SI H+LF  +V+ VYLF GVS 
Sbjct  377   PARLQDQMVAHLCLKYRTDSEGVQQQETLDSLPKAIRSSISHYLFYSLVDGVYLFNGVSN  436

Query  1424  EILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDM  1245
             ++L  LV++MKAEY PP+EDVI+QNE+P D YI+V+G+V+++  +   EQV+  + +GD+
Sbjct  437   DLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGDVDLLILKNGAEQVIGEVKAGDL  496

Query  1244  FGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklkdl  1065
              GE+G LC  PQ F  RTK+L+QLL++  T+ L  +Q    D   ++ N LQH K++KD 
Sbjct  497   CGEIGVLCYMPQLFAVRTKSLTQLLRMNRTTFLNIVQANVGDGTIIMNNLLQHLKEMKDP  556

Query  1064  klgdLFIEIGDEDGDPNMSINLFTVVAT--GNATFLNELLKAGLDPNIGDSKGKTPLHIA  891
              +  +  E         M + L    AT  G+   L+ LLK GLDPN  D  G++ LHIA
Sbjct  557   IMEGVLQETEKMLARGRMDLPLTLCFATLRGDNLLLHHLLKRGLDPNESDKNGRSALHIA  616

Query  890   ASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGD  714
             ASKG + CV++LL  G N +++D EGN  LW+AI  K  S+  +L  + A +S    AGD
Sbjct  617   ASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLLVNNGAKLS----AGD  672

Query  713   LL---CKAAKMNDSSVMQELLKHGLHVDSKDRHG-STAIQAAMEENQADMIKLLVMNGAE  546
             +    C AA+ N+ +++++++ +G  + S + +G S+A+  A+ E   +++  L+  GA 
Sbjct  673   VCQFACIAAEQNNLNLLKKIVHYGGDITSPNINGSSSALHVAVCEGNVEIVNYLLDQGAN  732

Query  545   IDDAVKLNLAPLDL--------------------TEVLQK-------RELGHRIAMPNTI  447
             ID   +    P DL                    T+ + +       R LG   + P  +
Sbjct  733   IDQVDQHGWTPRDLAVQQGHEDIKLLFQSKKLTTTQTIPEEHPQSGVRFLGRFKSEPTIM  792

Query  446   --LHEAASKWAKDDHQNSS-----------------SMPQQCSIRVSIYRGHPATRRETQ  324
               + +  S  A D     S                 S  Q     + + +   AT   T+
Sbjct  793   PPMFQGGSFLAGDGSWGRSRPRRRTNNFHNSLFGLMSAEQTNGRDLCLSKNQAATAVTTK  852

Query  323   ---------CPE----PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDV  183
                      CPE     G+L+ LP +  EL+     K G     + + + +GA I+ I++
Sbjct  853   TYSSRVTVSCPEKGDFAGKLVLLPHSFQELLEFGATKYGI--LQARVLNNDGAEIEGIEL  910

Query  182   IRDNDKLFIVAD  147
             IRD D L   +D
Sbjct  911   IRDGDFLIFASD  922



>ref|XP_008394036.1| PREDICTED: potassium channel AKT1-like isoform X2 [Malus domestica]
Length=880

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/855 (39%), Positives = 492/855 (58%), Gaps = 93/855 (11%)
 Frame = -2

Query  2489  LSKFILPPLGSS---QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLE  2319
             LS  ILP LG++   +P H   +  +ISP +  Y+ W+++++LLV Y+AWVCPFE  FL+
Sbjct  42    LSNGILPSLGATARNRPKHKLHR-FIISPFNYYYKLWQSFLILLVFYTAWVCPFEFGFLD  100

Query  2318  SKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAS  2139
              +    L + DN+V+  FA+DIVLTFF+AY+D TT LLI + K IA RY  TW   D+ S
Sbjct  101   -RAKGPLAIADNVVNALFAIDIVLTFFIAYLDKTTYLLIDNHKIIALRYAKTWLAFDIIS  159

Query  2138  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLF  1959
             TIP+E    +          Y    +LRFWRLRR S   +RLEKD  +SYFWVR  +L+F
Sbjct  160   TIPWELAQRVLPPPLE---TYGYFNILRFWRLRRFSAMISRLEKDRNYSYFWVRYCKLIF  216

Query  1958  VTLLLVHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGY  1785
             VTLL VHCAGC +YFLA  YP+  + W G +  N ++ SL  RY+++MYWS+ T+TT GY
Sbjct  217   VTLLTVHCAGCFFYFLAVHYPNPRRTWFGLIVENFQQLSLWDRYVTSMYWSIITLTTTGY  276

Query  1784  GDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRN  1605
             GD H VN+ EM F IFYMLFN+GL AY+IGNMTNL+V GT RT +FR+SIQAA++F  RN
Sbjct  277   GDFHPVNSQEMTFNIFYMLFNVGLQAYLIGNMTNLIVHGTARTRQFRDSIQAATSFAHRN  336

Query  1604  HLPARLKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGV  1431
              +P  L EQ+LA++CL+++  +E L QQ  ++ LPK I  SI H+LF P+V+ VYLF+GV
Sbjct  337   QIPDHLHEQMLAHLCLKYRTNSEGLQQQEALDALPKAIRCSISHYLFYPLVDSVYLFQGV  396

Query  1430  SREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSG  1251
             SR++L  LV++MKAEY PP+EDVI+QNE+P D+YI+ +G V           VV    +G
Sbjct  397   SRDLLFQLVSEMKAEYFPPKEDVILQNEAPTDMYIVATGSV-----------VVHEAKTG  445

Query  1250  DMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQHHkklk  1071
             D+ GE+G LC RPQ  T RTK LSQLL+L  T+ L  +Q    D   ++ NFL+H K++K
Sbjct  446   DVVGEIGVLCYRPQMVTVRTKGLSQLLRLNRTAFLNLVQANVGDGTIIMNNFLKHLKEMK  505

Query  1070  dlklgdLFIEIGD--EDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLH  897
             +     +  +I      G  ++ ++L      G+   L+ LL+ G DPN  D+ G+T +H
Sbjct  506   NPLAEGILRDIEHVLASGKMDLPLSLCFAAQRGDDLLLHRLLRRGSDPNEMDNNGRTAMH  565

Query  896   IAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAG  717
             IAAS G+E C ++LL++  + +++D EGN  +W+AI+ K  S+  +L    +  +    G
Sbjct  566   IAASNGNEHCALLLLEYEADPNIQDSEGNVPIWEAISGKHESLIKLLLDNGAKINSGNVG  625

Query  716   DLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  537
             +  C A + N+  ++++++ +   V     +G+ A+  A+ E   +M+K L+  GAE D 
Sbjct  626   NFACAAVEQNNLELLKDIVTYNGDVTLPKSNGTAALHTAVCEGNVEMVKFLLEQGAEADK  685

Query  536   AVKLNLAPLDLTEVLQKREL----GHR------------IAMPNTILHEAASK-------  426
                    P  L E     E+     H+            + MP  ++     K       
Sbjct  686   PDGYGWTPRALAEHQGHEEIMELFQHKWESNKPTKKPTVVPMPKDLIPSRPGKFRSEPTL  745

Query  425   --WAKDDHQNSSSMPQQCSIRV-SIYR---------------------------------  354
               +A+D   + S M  + + R+  I+R                                 
Sbjct  746   PPYARDGRPSYSDMTSENTRRMDKIFRNSLFGFMSAANTNTGEKDRDIVASTGSLARSTS  805

Query  353   --GHPATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  192
                +PA R    CP+ G    +L+ LP+++ +L+ +  +K  F AT   +  E+GA ++ 
Sbjct  806   RNSYPA-RVTLSCPKKGQTAAKLVLLPDSLQQLLDLGAKKFQFTAT--KVLTEDGAEVED  862

Query  191   IDVIRDNDKLFIVAD  147
             ++++RD D L +  D
Sbjct  863   VELVRDGDHLVLAGD  877



>gb|KHN06658.1| Potassium channel AKT1 [Glycine soja]
Length=850

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/847 (40%), Positives = 486/847 (57%), Gaps = 82/847 (10%)
 Frame = -2

Query  2510  EDFSLGKLSKFILPPLGSSQPTHTSSQ----GLVISPMDSRYRCWETWMVLLVAYSAWVC  2343
             ED S   L+  +LP LG++   + S +      ++SP +  Y+ W T++++LV Y+AW+C
Sbjct  23    EDGSQYSLTGVLLPSLGATAIRNGSGRPKFRQYIVSPYNRHYKLWNTFLLILVFYTAWMC  82

Query  2342  PFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST  2163
             PFE  FLE K +  + + DN+V++FFA+DIVLTFFVAY+D +T LL+   K IA RY  +
Sbjct  83    PFEFGFLE-KSNIAVAITDNVVNVFFAIDIVLTFFVAYLDKSTYLLVDDHKLIALRYAKS  141

Query  2162  WFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFW  1983
             W ++DV +TIP+E V  +      +   YS    LR WRL RVS  F RLEKD  ++YF 
Sbjct  142   WLILDVIATIPYEVVILILPPSLQI---YSYFNFLRLWRLHRVSAMFARLEKDRNYNYFL  198

Query  1982  VRCARLLFVTLLLVHCAGCLYYFLADRYPHQGKNWLGSL-NVREESLKIRYISAMYWSMT  1806
             VRC +L  VTL  VH A C +YFLA R  +    WLG + +  +++L  +Y+ A+YWS+ 
Sbjct  199   VRCCKLTCVTLFSVHAAACFFYFLAAR-DNPESTWLGLVPDAIDQNLWGKYVVAIYWSIV  257

Query  1805  TMTTVGYGDLHAVNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAA  1626
             T+ +VGYGDLH VNT EM+F IFYMLFNLGLT+Y+IGNMTN+VV  T RT  +R+++Q+A
Sbjct  258   TLVSVGYGDLHPVNTKEMVFDIFYMLFNLGLTSYLIGNMTNMVVHWTERTKRYRDTVQSA  317

Query  1625  SNFVSRNHLPARLKEQILAYMCLRFKA--ESLNQQPLIEQLPKTICKSICHHLFLPVVEK  1452
             SNF  RNHLP RL+EQI A++ ++++   E L QQ +I+ LPK I  SI H+LF  +V+K
Sbjct  318   SNFAHRNHLPNRLQEQIFAHLLMKYRTDLEGLQQQEIIDSLPKAIHSSISHYLFFSLVDK  377

Query  1451  VYLFKGVSREILLLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQV  1272
             VYLF GVS ++L  LV +MKAEY PP++DVI+QNE+P D YI V+G             V
Sbjct  378   VYLFHGVSNDLLFQLVTEMKAEYFPPKDDVILQNEAPTDFYIFVTGAA-----------V  426

Query  1271  VWTLNSGDMFGEVGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFL  1092
             V    SGD+ GE+G LC RPQ FT RTK LSQ+L+L  TS L       ED   ++ NFL
Sbjct  427   VGEAKSGDVVGEIGVLCYRPQLFTVRTKRLSQILRLSRTSFLNLSHSNVEDGTMIMNNFL  486

Query  1091  Q--HHkklkdlklgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDS  918
             Q  H  +   +K      E     G  ++ I+L    + G+   L++LLK G DPN  D 
Sbjct  487   QNLHESEDPLMKEILAETEAMLARGKMDLPISLLFAASRGDDILLHQLLKKGSDPNEPDK  546

Query  917   KGKTPLHIAASKGHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWAS  741
              GKT LHIAASKG + CV +LL+HG N ++KD++GN  LW+AI     S+  +L  + A 
Sbjct  547   DGKTALHIAASKGKDHCVALLLEHGANPNIKDLDGNVPLWEAIKGGHDSVMKLLIDNGAD  606

Query  740   ISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLV  561
             IS   V G L C +   N+  +++++++ G  V     +GSTA+ AA+ E  A+++K L+
Sbjct  607   ISSGDV-GSLACISVAQNNLELLKDIVQCGGDVTRSASNGSTALHAAVCEGNAEIVKFLL  665

Query  560   MNGAEIDDAVKLNLAP------------LDLTEVLQKRELGHRIAMPNTI----------  447
              +GA+ID      L P            +++ + + + +  H I   + +          
Sbjct  666   EHGADIDKQDDSGLTPRILADQQCHEEIINIFKKVGQNKAPHGIPTTSFVARCQSKPTIL  725

Query  446   -LHEAAS------KWAKDDHQNSSSMPQQCSI-------------------RVSIYRGHP  345
              +H+ +        W  D+HQ     P   S                         R   
Sbjct  726   GIHQGSKPPNEEVTWF-DNHQRRKMSPFHNSFFGIMSTENYDKKDSTSSSKTSHTSREEL  784

Query  344   ATRRETQCPEPG----RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIR  177
               R    CPE G    +L+ LP+++ EL+ I  EK  FD + + +  +E A I+ I VIR
Sbjct  785   PARVTLSCPEKGEHGKKLVFLPKSLEELLRIGAEK--FDFSPTKILSKERAEIEDIYVIR  842

Query  176   DNDKLFI  156
             D D L +
Sbjct  843   DGDLLIL  849



>ref|XP_002514366.1| Potassium channel AKT6, putative [Ricinus communis]
 gb|EEF48320.1| Potassium channel AKT6, putative [Ricinus communis]
Length=886

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/655 (47%), Positives = 421/655 (64%), Gaps = 14/655 (2%)
 Frame = -2

Query  2477  ILPPLGSSQPTHTSSQ--GLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  2304
             ILP LG++  +H   Q    ++SP D RYR WET++V LV Y+AW  PFE  FLE    T
Sbjct  42    ILPSLGATARSHRRIQLRRFIVSPFDPRYRIWETYLVFLVFYTAWASPFEFGFLERPTGT  101

Query  2303  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  2124
              L V+DN+V+ FFA+DIVLTFF+AY+D +T LLI +RK+IA RY  TW   DV STIP E
Sbjct  102   -LAVIDNVVNAFFAIDIVLTFFLAYLDKSTYLLIDNRKQIALRYARTWLAFDVISTIPSE  160

Query  2123  FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLEKDIRFSYFWVRCARLLFVTLLL  1944
              V  +          Y    MLR WRLRRVS FF RLEKD  +SYF VRC++L+ VTL +
Sbjct  161   LVRTILPDGFQ---TYGYFSMLRLWRLRRVSRFFARLEKDRNYSYFVVRCSKLVCVTLFV  217

Query  1943  VHCAGCLYYFLADRYPHQGKNWLGSL--NVREESLKIRYISAMYWSMTTMTTVGYGDLHA  1770
             ++ AGC YY LA  Y      W+GS+  +  +E L IRY++++YWS+TT+TT GYGDLHA
Sbjct  218   INIAGCFYYRLAATYHDPANTWIGSVWKDFHKERLWIRYVTSLYWSITTLTTTGYGDLHA  277

Query  1769  VNTLEMIFIIFYMLFNLGLTAYIIGNMTNLVVEGTRRTMEFRNSIQAASNFVSRNHLPAR  1590
             VN  EM+F + YM+F+LGLTAY+IGNMTNLVV  T RT +FR++IQAAS+F  RN LP R
Sbjct  278   VNDREMVFTMCYMMFDLGLTAYLIGNMTNLVVHATSRTRQFRDTIQAASSFAQRNQLPVR  337

Query  1589  LKEQILAYMCLRFK--AESLNQQPLIEQLPKTICKSICHHLFLPVVEKVYLFKGVSREIL  1416
             L++Q++A++ L+++  +E L+QQ  I  LPK I  SI  +LF  +V+KVYLF+GVS ++L
Sbjct  338   LQDQMIAHLSLKYRTDSEGLHQQETINSLPKAIRSSIASYLFYSLVDKVYLFRGVSNDLL  397

Query  1415  LLLVADMKAEYIPPREDVIMQNESPDDVYIIVSGEVEMIDNEMENEQVVWTLNSGDMFGE  1236
               LVA+MKAEY PPREDVI+QNE+P D+YI+V+G V+++  +   EQVV    +G+  GE
Sbjct  398   FQLVAEMKAEYFPPREDVILQNEAPTDMYILVTGAVDLVVKKNGIEQVVGEAKTGEFIGE  457

Query  1235  VGALCCRPQSFTYRtktlsqllklkttslLEALQMKREDNITMIKNFLQH--Hkklkdlk  1062
             +G +C RPQ FT RTK LSQLL++  T  L  +Q    D   +I N LQH    K   ++
Sbjct  458   IGLVCYRPQMFTARTKRLSQLLRMNRTVFLNIVQSNVGDGTIIINNLLQHLKELKDPMME  517

Query  1061  lgdLFIEIGDEDGDPNMSINLFTVVATGNATFLNELLKAGLDPNIGDSKGKTPLHIAASK  882
                 + E     G  ++ + L      G+   L++LL+ GLDPN  D+  KT LH AAS 
Sbjct  518   GVLSYTEQMLARGRMDLPLTLCFAAMRGDDLLLHQLLRRGLDPNEWDNNEKTALHFAASN  577

Query  881   GHEECVMVLLKHGCNIHLKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLC  705
             G + CVM+LL++G + + KD EGN  LW+A+  K  S+  +L  + AS S   V G    
Sbjct  578   GSDHCVMLLLEYGADPNRKDSEGNVPLWEALLGKHESVVQLLLDNGASFSSADV-GQFAL  636

Query  704   KAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID  540
              A + N+  +++E+   G  V    R G   + +A+ +   +M+K L+  GA++D
Sbjct  637   AAIEQNNLDLLKEITNCGGDVTQPTRTGIIPLHSAISDGNFEMVKFLLDQGADVD  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8504099159760